F474866

General Info

Members Datasets Scaffolds Average Seq Length
681 389 1362 256

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0132967|Ga0496121_0132967_812_1675
Length 287
Sequence VLDEVLAGRRGGLPELSYLLVAETLSGAMRGTVRKITLPRRLVADLMHASIRVPFVSFARPLHIRALQEARAQAAQRPGWAAIFVKAFALVAKEEPILRTLYVKWPMPAFYELPRSVAMVAIARVEDGQDCVLPQKVTAPDEMPLAEVDALIRHAKDAPINEVPAFRKILRTTRLPLPLRRLFWAIGLNFGRQRANYFGSFGVTSVAAYGAGQLHAISPGPFVLSYGVEKPDQTIDVVLRWDHRITDAAPMAKALNRLEQVLNGEIAAELRANRTQSEPKPVRAVAT

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
177 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
178 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
179 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
180 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
181 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
202 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
205 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
206 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
237 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
238 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
241 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
269 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
270 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
292 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
293 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
294 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
302 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
303 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
311 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
312 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
313 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
316 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
317 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
318 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
319 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
320 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
321 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
322 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
323 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
324 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
325 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
326 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
327 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
328 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
329 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
330 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
331 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
332 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
333 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
334 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
335 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
336 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
337 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
338 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
339 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
340 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
341 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
342 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
343 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
344 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
345 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
346 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
347 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
348 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
349 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
350 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
351 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
352 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
353 2791355199
354 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
355 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
356 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
357 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
358 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
359 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
360 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
361 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
362 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
363 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
364 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
365 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
366 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
367 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
368 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
369 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
370 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
371 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
372 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
373 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
374 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
375 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
376 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
377 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
378 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
379 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
380 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
381 2922425934
382 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
383 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
384 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
385 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
386 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
387 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
388 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
389 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.78
Metatranscriptomes 0
Isolates 7.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.54
Nodule 5.14
Rhizoplane 7.64
Rhizosphere 68.87
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0132967 3300048924 Bacteria 1858
2 JGI25406J46586_10000101 3300003203 Bacteria 38086
3 JGI25153J46596_10000366 3300003215 Bacteria 31011
4 rootH1_10311687 3300003323 Bacteria 1453
5 JGI25404J52841_10001176 3300003659 Bacteria 4465
6 JGI25404J52841_10005591 3300003659 Bacteria 2597
7 JGI25404J52841_10012355 3300003659 Bacteria 1849
8 Ga0070658_10075965 3300005327 Bacteria 2756
9 Ga0070676_10207093 3300005328 Bacteria 1289
10 Ga0070690_100297909 3300005330 Bacteria 1155
11 Ga0068869_100055295 3300005334 Bacteria 2892
12 Ga0070680_100010206 3300005336 Bacteria 7240
13 Ga0070682_100244113 3300005337 Bacteria 1291
14 Ga0068868_100015888 3300005338 Bacteria 5578
15 Ga0068868_100401854 3300005338 Bacteria 1182
16 Ga0070691_10078977 3300005341 Bacteria 1608
17 Ga0070661_100117286 3300005344 Bacteria 1991
18 Ga0070668_100089005 3300005347 Bacteria 2431
19 Ga0070668_100212102 3300005347 Bacteria 1593
20 Ga0070668_100280028 3300005347 Bacteria 1392
21 Ga0070668_100301720 3300005347 Bacteria 1343
22 Ga0070668_100434105 3300005347 Bacteria 1126
23 Ga0070671_100138520 3300005355 Bacteria 2052
24 Ga0070671_100476033 3300005355 Bacteria 1073
25 Ga0070674_100082069 3300005356 Bacteria 2305
26 Ga0070674_100277629 3300005356 Bacteria 1327
27 Ga0070659_100105258 3300005366 Bacteria 2273
28 Ga0070659_100350454 3300005366 Bacteria 1238
29 Ga0070667_100377117 3300005367 Bacteria 1288
30 Ga0070714_100027346 3300005435 Bacteria 4722
31 Ga0070713_100040752 3300005436 Bacteria 3778
32 Ga0070713_100155251 3300005436 Bacteria 2039
33 Ga0070713_100188452 3300005436 Bacteria 1857
34 Ga0070710_10126601 3300005437 Bacteria 1552
35 Ga0070711_100067274 3300005439 Bacteria 2513
36 Ga0070705_100386617 3300005440 Bacteria 1032
37 Ga0070700_100100374 3300005441 Bacteria 1906
38 Ga0070663_100021332 3300005455 Bacteria 4307
39 Ga0070663_100054669 3300005455 Bacteria 2854
40 Ga0070663_100173166 3300005455 Bacteria 1669
41 Ga0070663_100406350 3300005455 Bacteria 1114
42 Ga0070678_100167358 3300005456 Bacteria 1787
43 Ga0070678_100214679 3300005456 Bacteria 1596
44 Ga0070662_100122815 3300005457 Bacteria 1992
45 Ga0070681_10111762 3300005458 Bacteria 2671
46 Ga0070681_10157512 3300005458 Bacteria 2195
47 Ga0070706_100711841 3300005467 Bacteria 931
48 Ga0070699_100101996 3300005518 Bacteria 2516
49 Ga0070679_100042441 3300005530 Bacteria 4529
50 Ga0070679_100270335 3300005530 Bacteria 1654
51 Ga0070684_100015968 3300005535 Bacteria 6131
52 Ga0070697_100013902 3300005536 Bacteria 6318
53 Ga0068853_100011732 3300005539 Bacteria 7120
54 Ga0068853_100572264 3300005539 Bacteria 1071
55 Ga0070672_100135810 3300005543 Bacteria 2025
56 Ga0070693_100386360 3300005547 Bacteria 967
57 Ga0070665_100024503 3300005548 Bacteria 6078
58 Ga0070665_100040613 3300005548 Bacteria 4676
59 Ga0070665_100064016 3300005548 Bacteria 3687
60 Ga0070665_100213917 3300005548 Bacteria 1928
61 Ga0070665_100350091 3300005548 Bacteria 1482
62 Ga0068855_100060159 3300005563 Bacteria 4443
63 Ga0068855_100408493 3300005563 Bacteria 1487
64 Ga0068855_100490309 3300005563 Bacteria 1336
65 Ga0070664_100033202 3300005564 Bacteria 4320
66 Ga0070664_100454355 3300005564 Bacteria 1176
67 Ga0070664_100569117 3300005564 Bacteria 1049
68 Ga0068857_100007520 3300005577 Bacteria 9374
69 Ga0068857_100044741 3300005577 Bacteria 3928
70 Ga0068857_100113947 3300005577 Bacteria 2431
71 Ga0068854_100148414 3300005578 Bacteria 1805
72 Ga0068856_100007308 3300005614 Bacteria 10783
73 Ga0068856_100196642 3300005614 Bacteria 2030
74 Ga0068852_100015317 3300005616 Bacteria 5939
75 Ga0068852_100270872 3300005616 Bacteria 1634
76 Ga0068852_100389428 3300005616 Bacteria 1369
77 Ga0068852_100563436 3300005616 Bacteria 1141
78 Ga0068859_100338201 3300005617 Bacteria 1599
79 Ga0068864_100792320 3300005618 Bacteria 931
80 Ga0068861_100183743 3300005719 Bacteria 1742
81 Ga0068861_100378092 3300005719 Bacteria 1250
82 Ga0068851_10035713 3300005834 Bacteria 2486
83 Ga0068851_10042077 3300005834 Bacteria 2299
84 Ga0068851_10098288 3300005834 Bacteria 1550
85 Ga0068863_100116240 3300005841 Bacteria 2549
86 Ga0068858_100083372 3300005842 Bacteria 2973
87 Ga0068858_100385602 3300005842 Bacteria 1345
88 Ga0068860_100000317 3300005843 Bacteria 65673
89 Ga0068860_100487922 3300005843 Bacteria 1229
90 Ga0068860_100506737 3300005843 Bacteria 1205
91 Ga0068862_100448049 3300005844 Bacteria 1216
92 Ga0068862_100469237 3300005844 Bacteria 1189
93 Ga0068862_100601639 3300005844 Bacteria 1055
94 Ga0081455_10002423 3300005937 Bacteria 22248
95 Ga0081455_10014321 3300005937 Bacteria 7781
96 Ga0081455_10027456 3300005937 Bacteria 5217
97 Ga0081455_10043450 3300005937 Bacteria 3930
98 Ga0081538_10078133 3300005981 Bacteria 1778
99 Ga0081540_1002773 3300005983 Bacteria 14213
100 Ga0081540_1019810 3300005983 Bacteria 4072
101 Ga0081540_1028597 3300005983 Bacteria 3127
102 Ga0081540_1030875 3300005983 Bacteria 2959
103 Ga0081540_1050086 3300005983 Bacteria 2078
104 Ga0081539_10000008 3300005985 Bacteria 525071
105 Ga0081539_10014085 3300005985 Bacteria 5950
106 Ga0075365_10048361 3300006038 Bacteria 2799
107 Ga0075365_10049203 3300006038 Bacteria 2777
108 Ga0075365_10058056 3300006038 Bacteria 2575
109 Ga0075363_100015314 3300006048 Bacteria 3768
110 Ga0075363_100033887 3300006048 Bacteria 2663
111 Ga0075363_100065873 3300006048 Bacteria 1959
112 Ga0075364_10008417 3300006051 Bacteria 6165
113 Ga0070716_100177431 3300006173 Bacteria 1396
114 Ga0070716_100182513 3300006173 Bacteria 1379
115 Ga0070712_100044408 3300006175 Bacteria 3064
116 Ga0070712_100058594 3300006175 Bacteria 2709
117 Ga0070712_100087440 3300006175 Bacteria 2274
118 Ga0075362_10033896 3300006177 Bacteria 2223
119 Ga0075367_10092168 3300006178 Bacteria 1844
120 Ga0075367_10099401 3300006178 Bacteria 1777
121 Ga0075369_10054110 3300006186 Bacteria 1742
122 Ga0075369_10094644 3300006186 Bacteria 1335
123 Ga0075366_10081527 3300006195 Bacteria 1932
124 Ga0075370_10101270 3300006353 Bacteria 1667
125 Ga0068871_100034617 3300006358 Bacteria 4009
126 Ga0075428_100123099 3300006844 Bacteria 2823
127 Ga0075433_10366859 3300006852 Bacteria 1272
128 Ga0068865_100103820 3300006881 Bacteria 2085
129 Ga0068865_100186220 3300006881 Bacteria 1602
130 Ga0097620_100338211 3300006931 Bacteria 1599
131 Ga0097620_100488555 3300006931 Bacteria 1326
132 Ga0099794_10010584 3300007265 Bacteria 3922
133 Ga0099795_10014016 3300007788 Bacteria 2475
134 Ga0099795_10035564 3300007788 Bacteria 1742
135 Ga0099795_10144979 3300007788 Bacteria 968
136 Ga0105240_10015488 3300009093 Bacteria 10365
137 Ga0105240_10027333 3300009093 Bacteria 7470
138 Ga0105240_10157122 3300009093 Bacteria 2703
139 Ga0111539_10153919 3300009094 Bacteria 2691
140 Ga0105245_10599251 3300009098 Bacteria 1128
141 Ga0105247_10065888 3300009101 Bacteria 2254
142 Ga0105247_10082679 3300009101 Bacteria 2027
143 Ga0105247_10206439 3300009101 Bacteria 1323
144 Ga0105247_10265813 3300009101 Bacteria 1178
145 Ga0114129_10189934 3300009147 Bacteria 2790
146 Ga0105243_10455932 3300009148 Bacteria 1201
147 Ga0105243_10482308 3300009148 Bacteria 1170
148 Ga0105241_10001933 3300009174 Bacteria 15677
149 Ga0105242_10044906 3300009176 Bacteria 3579
150 Ga0105248_10169265 3300009177 Bacteria 2462
151 Ga0105248_10397306 3300009177 Bacteria 1552
152 Ga0105237_10052107 3300009545 Bacteria 4109
153 Ga0105237_10711044 3300009545 Bacteria 1011
154 Ga0105238_10027310 3300009551 Bacteria 5814
155 Ga0105238_10218701 3300009551 Bacteria 1881
156 Ga0105238_10261491 3300009551 Bacteria 1710
157 Ga0105249_10048330 3300009553 Bacteria 3879
158 Ga0105249_10108420 3300009553 Bacteria 2622
159 Ga0099796_10005800 3300010159 Bacteria 3110
160 Ga0105239_10003918 3300010375 Bacteria 18036
161 Ga0105239_10032269 3300010375 Bacteria 5756
162 Ga0105239_10112481 3300010375 Bacteria 3019
163 Ga0105239_10427151 3300010375 Bacteria 1502
164 Ga0105239_10644473 3300010375 Bacteria 1210
165 Ga0105239_10936745 3300010375 Bacteria 995
166 Ga0105246_10022596 3300011119 Bacteria 4059
167 Ga0105246_10147661 3300011119 Bacteria 1776
168 Ga0157373_10023533 3300013100 Bacteria 4464
169 Ga0157370_10050985 3300013104 Bacteria 3954
170 Ga0157370_10064097 3300013104 Bacteria 3479
171 Ga0157369_10020578 3300013105 Bacteria 7376
172 Ga0157374_10116079 3300013296 Bacteria 2579
173 Ga0157378_10133867 3300013297 Bacteria 2297
174 Ga0157378_10234185 3300013297 Bacteria 1751
175 Ga0157378_10301901 3300013297 Bacteria 1550
176 Ga0163162_10065624 3300013306 Bacteria 3677
177 Ga0163162_10275084 3300013306 Bacteria 1816
178 Ga0163162_10415914 3300013306 Bacteria 1477
179 Ga0157375_10047153 3300013308 Bacteria 4206
180 Ga0157375_10409004 3300013308 Bacteria 1523
181 Ga0163163_10118731 3300014325 Bacteria 2677
182 Ga0163163_10475253 3300014325 Bacteria 1311
183 Ga0157380_10344633 3300014326 Bacteria 1391
184 Ga0157379_10295378 3300014968 Bacteria 1476
185 Ga0157379_10628229 3300014968 Bacteria 1004
186 Ga0157376_10232917 3300014969 Bacteria 1712
187 Ga0163161_10152397 3300017792 Bacteria 1758
188 Ga0163161_10241358 3300017792 Bacteria 1405
189 Ga0213872_10020912 3300021361 Bacteria 3015
190 Ga0209233_1013207 3300025261 Bacteria 2362
191 Ga0209758_1001988 3300025297 Bacteria 22050
192 Ga0209758_1002062 3300025297 Bacteria 21474
193 Ga0207426_1003194 3300025302 Bacteria 9234
194 Ga0209257_1022337 3300025304 Bacteria 2260
195 Ga0207656_10010983 3300025321 Bacteria 3409
196 Ga0207656_10057189 3300025321 Bacteria 1701
197 Ga0207656_10149263 3300025321 Bacteria 1106
198 Ga0207692_10066134 3300025898 Bacteria 1889
199 Ga0207688_10041574 3300025901 Bacteria 2558
200 Ga0207699_10236627 3300025906 Bacteria 1253
201 Ga0207645_10153219 3300025907 Bacteria 1505
202 Ga0207705_10128360 3300025909 Bacteria 1885
203 Ga0207654_10000409 3300025911 Bacteria 24915
204 Ga0207654_10027785 3300025911 Bacteria 3079
205 Ga0207707_10000466 3300025912 Bacteria 41992
206 Ga0207695_10001179 3300025913 Bacteria 45082
207 Ga0207695_10057285 3300025913 Bacteria 4049
208 Ga0207671_10295800 3300025914 Bacteria 1279
209 Ga0207693_10047433 3300025915 Bacteria 3375
210 Ga0207693_10075916 3300025915 Bacteria 2632
211 Ga0207660_10004908 3300025917 Bacteria 8710
212 Ga0207660_10611588 3300025917 Unclassified 888
213 Ga0207657_10004634 3300025919 Bacteria 14526
214 Ga0207657_10015386 3300025919 Bacteria 7411
215 Ga0207652_10002138 3300025921 Bacteria 16939
216 Ga0207694_10000131 3300025924 Bacteria 76343
217 Ga0207694_10014107 3300025924 Bacteria 6024
218 Ga0207694_10177895 3300025924 Bacteria 1724
219 Ga0207694_10457065 3300025924 Bacteria 1066
220 Ga0207659_10296136 3300025926 Bacteria 1327
221 Ga0207659_10425981 3300025926 Bacteria 1114
222 Ga0207687_10017929 3300025927 Bacteria 4671
223 Ga0207687_10170251 3300025927 Bacteria 1679
224 Ga0207700_10439564 3300025928 Bacteria 1148
225 Ga0207664_10076606 3300025929 Bacteria 2708
226 Ga0207664_10079826 3300025929 Bacteria 2657
227 Ga0207644_10546543 3300025931 Bacteria 958
228 Ga0207690_10098731 3300025932 Bacteria 2081
229 Ga0207706_10394548 3300025933 Bacteria 1200
230 Ga0207706_10426775 3300025933 Bacteria 1148
231 Ga0207706_10443301 3300025933 Bacteria 1124
232 Ga0207709_10136546 3300025935 Bacteria 1680
233 Ga0207669_10197703 3300025937 Bacteria 1456
234 Ga0207669_10521505 3300025937 Bacteria 954
235 Ga0207704_10039581 3300025938 Bacteria 2747
236 Ga0207704_10370988 3300025938 Bacteria 1120
237 Ga0207665_10032684 3300025939 Bacteria 3445
238 Ga0207711_10108226 3300025941 Bacteria 2469
239 Ga0207661_10630671 3300025944 Bacteria 985
240 Ga0207679_10210002 3300025945 Bacteria 1632
241 Ga0207667_10012774 3300025949 Bacteria 9646
242 Ga0207668_10022935 3300025972 Bacteria 4002
243 Ga0207668_10026363 3300025972 Bacteria 3773
244 Ga0207668_10287357 3300025972 Bacteria 1351
245 Ga0207668_10301459 3300025972 Bacteria 1322
246 Ga0207640_10173308 3300025981 Bacteria 1610
247 Ga0207640_10222317 3300025981 Bacteria 1447
248 Ga0207677_10008684 3300026023 Bacteria 5688
249 Ga0207703_10071370 3300026035 Bacteria 2868
250 Ga0207703_10569507 3300026035 Bacteria 1069
251 Ga0207639_10009801 3300026041 Bacteria 6620
252 Ga0207678_10029342 3300026067 Bacteria 4801
253 Ga0207678_10040741 3300026067 Bacteria 4027
254 Ga0207678_10056118 3300026067 Bacteria 3392
255 Ga0207678_10073505 3300026067 Bacteria 2930
256 Ga0207678_10285598 3300026067 Bacteria 1417
257 Ga0207678_10314808 3300026067 Bacteria 1346
258 Ga0207678_10549394 3300026067 Bacteria 1010
259 Ga0207702_10000005 3300026078 Bacteria 420296
260 Ga0207702_10041464 3300026078 Bacteria 3860
261 Ga0207641_10146719 3300026088 Bacteria 2134
262 Ga0207648_10029160 3300026089 Bacteria 4894
263 Ga0207676_10046804 3300026095 Bacteria 3349
264 Ga0207676_10325347 3300026095 Bacteria 1413
265 Ga0207676_10746907 3300026095 Bacteria 951
266 Ga0207674_10121029 3300026116 Bacteria 2585
267 Ga0207683_10054649 3300026121 Bacteria 3501
268 Ga0207683_10082425 3300026121 Bacteria 2857
269 Ga0207683_10171284 3300026121 Bacteria 1966
270 Ga0207683_10267798 3300026121 Bacteria 1560
271 Ga0207683_10275414 3300026121 Bacteria 1537
272 Ga0207683_10427965 3300026121 Bacteria 1219
273 Ga0207698_10184982 3300026142 Bacteria 1850
274 Ga0207698_10316920 3300026142 Bacteria 1459
275 Ga0207698_10333157 3300026142 Bacteria 1426
276 Ga0209588_1003663 3300027671 Bacteria 4270
277 Ga0209588_1010269 3300027671 Bacteria 2812
278 Ga0268266_10003531 3300028379 Bacteria 15523
279 Ga0268266_10016020 3300028379 Bacteria 6410
280 Ga0268266_10095655 3300028379 Bacteria 2609
281 Ga0268266_10625981 3300028379 Bacteria 1035
282 Ga0268265_10016485 3300028380 Bacteria 5077
283 Ga0268265_10234218 3300028380 Bacteria 1616
284 Ga0268265_10348360 3300028380 Bacteria 1351
285 Ga0268264_10000035 3300028381 Bacteria 398196
286 Ga0268264_10522113 3300028381 Bacteria 1161
287 Ga0265334_10002345 3300028573 Bacteria 8909
288 Ga0307517_10000049 3300028786 Bacteria 160368
289 Ga0307517_10121697 3300028786 Bacteria 1926
290 Ga0307515_10328546 3300028794 Bacteria 1190
291 Ga0307515_10368512 3300028794 Bacteria 1074
292 Ga0265338_10000065 3300028800 Bacteria 188966
293 Ga0307511_10119711 3300030521 Bacteria 1634
294 Ga0265330_10088915 3300031235 Bacteria 1327
295 Ga0265325_10005453 3300031241 Bacteria 7850
296 Ga0265340_10034032 3300031247 Bacteria 2535
297 Ga0265340_10057096 3300031247 Bacteria 1876
298 Ga0265339_10005966 3300031249 Bacteria 8054
299 Ga0265339_10051154 3300031249 Bacteria 2256
300 Ga0265339_10124077 3300031249 Bacteria 1325
301 Ga0307513_10114991 3300031456 Bacteria 2674
302 Ga0307509_10029857 3300031507 Bacteria 6041
303 Ga0307408_100347334 3300031548 Bacteria 1258
304 Ga0307408_100408467 3300031548 Bacteria 1168
305 Ga0265313_10135803 3300031595 Bacteria 1062
306 Ga0307508_10000090 3300031616 Bacteria 106893
307 Ga0307508_10065785 3300031616 Bacteria 3193
308 Ga0265314_10035278 3300031711 Bacteria 3647
309 Ga0265314_10098883 3300031711 Bacteria 1881
310 Ga0265314_10110044 3300031711 Bacteria 1752
311 Ga0265342_10005498 3300031712 Bacteria 9637
312 Ga0265342_10069463 3300031712 Bacteria 2057
313 Ga0307516_10107825 3300031730 Bacteria 2593
314 Ga0307413_10104874 3300031824 Bacteria 1878
315 Ga0307407_10204741 3300031903 Bacteria 1325
316 Ga0307409_100140919 3300031995 Bacteria 2077
317 Ga0307411_10608180 3300032005 Bacteria 941
318 Ga0307415_100069197 3300032126 Bacteria 2474
319 Ga0307415_100297476 3300032126 Bacteria 1335
320 Ga0307415_100420859 3300032126 Bacteria 1146
321 Ga0307510_10004617 3300033180 Bacteria 16241
322 Ga0307510_10020616 3300033180 Bacteria 7699
323 Ga0307510_10049660 3300033180 Bacteria 4459
324 Ga0307510_10288449 3300033180 Bacteria 1108
325 Ga0307510_10308340 3300033180 Bacteria 1043
326 Ga0315911_1000011 3300033442 Bacteria 264678
327 Ga0373930_0022194 3300034816 Bacteria 1253
328 Ga0373928_0038315 3300035084 Bacteria 1091
329 Ga0373934_0012795 3300035086 Bacteria 3169
330 Ga0373940_0016125 3300035088 Bacteria 1848
331 Ga0373949_0091520 3300035090 Bacteria 823
332 Ga0373923_0008238 3300035111 Bacteria 3707
333 Ga0373945_0014375 3300035116 Bacteria 2651
334 Ga0373953_0003083 3300035117 Bacteria 5124
335 Ga0373953_0028556 3300035117 Bacteria 2152
336 Ga0373954_0095401 3300035118 Bacteria 1432
337 Ga0373956_0000726 3300035119 Bacteria 13568
338 Ga0373957_0004882 3300035120 Bacteria 4115
339 Ga0373957_0058486 3300035120 Bacteria 1489
340 Ga0373943_0004812 3300035170 Bacteria 6099
341 Ga0373943_0150650 3300035170 Bacteria 1260
342 Ga0373955_0003241 3300035172 Bacteria 7127
343 Ga0373955_0159578 3300035172 Bacteria 1330
344 Ga0373961_0062211 3300035241 Bacteria 1136
345 Ga0373924_0021046 3300035410 Bacteria 2541
346 Ga0373931_0001506 3300035691 Bacteria 10029
347 Ga0373931_0041769 3300035691 Bacteria 2410
348 Ga0373931_0165874 3300035691 Bacteria 1298
349 Ga0373935_0153542 3300035692 Bacteria 1564
350 Ga0373927_0001005 3300035695 Bacteria 21497
351 Ga0373927_0005832 3300035695 Bacteria 8449
352 Ga0373927_0046813 3300035695 Bacteria 2797
353 Ga0373933_0009400 3300035724 Bacteria 5339
354 Ga0373933_0033690 3300035724 Bacteria 2981
355 Ga0373947_0003823 3300035725 Bacteria 8867
356 Ga0373937_0002920 3300036401 Bacteria 14286
357 Ga0373937_0060818 3300036401 Bacteria 3471
358 Ga0373937_0061629 3300036401 Bacteria 3448
359 Ga0373937_0101399 3300036401 Bacteria 2671
360 Ga0373937_0210903 3300036401 Bacteria 1827
361 Ga0373925_0006131 3300037068 Bacteria 8880
362 Ga0373925_0051552 3300037068 Bacteria 3072
363 Ga0373925_0427393 3300037068 Bacteria 1083
364 Ga0395900_0053575 3300037418 Bacteria 4152
365 Ga0395901_0179868 3300038443 Bacteria 2218
366 Ga0395901_0915093 3300038443 Bacteria 858
367 Ga0395901_1045332 3300038443 Bacteria 790
368 Ga0436360_0187845 3300039438 Bacteria 1117
369 Ga0436361_0371881 3300039447 Bacteria 3224
370 Ga0436361_0442731 3300039447 Bacteria 3924
371 Ga0436363_1282749 3300039450 Bacteria 942
372 Ga0439465_0069692 3300041413 Bacteria 1177
373 Ga0451791_1590430 3300041451 Bacteria 1223
374 Ga0451800_1673708 3300041459 Bacteria 1510
375 Ga0466970_0305989 3300044765 Bacteria 897
376 Ga0466957_0354246 3300044842 Bacteria 996
377 Ga0466967_0140691 3300045976 Bacteria 2248
378 Ga0495592_0001015 3300046454 Bacteria 19460
379 Ga0495603_0010944 3300046455 Bacteria 5503
380 Ga0495603_0056159 3300046455 Bacteria 2332
381 Ga0495603_0074360 3300046455 Bacteria 1995
382 Ga0495603_0209696 3300046455 Bacteria 1125
383 Ga0495629_0003238 3300046459 Bacteria 12332
384 Ga0495629_0011592 3300046459 Bacteria 6400
385 Ga0495629_0054448 3300046459 Bacteria 2798
386 Ga0495629_0197502 3300046459 Bacteria 1391
387 Ga0495638_0062988 3300046460 Bacteria 2288
388 Ga0495638_0258760 3300046460 Bacteria 956
389 Ga0495641_0009631 3300046461 Bacteria 5717
390 Ga0495641_0047197 3300046461 Bacteria 1978
391 Ga0495651_0015940 3300046462 Bacteria 5820
392 Ga0495651_0085725 3300046462 Bacteria 2372
393 Ga0495651_0242619 3300046462 Bacteria 1235
394 Ga0495651_0503811 3300046462 Bacteria 775
395 Ga0495653_0000934 3300046463 Bacteria 22498
396 Ga0495653_0142684 3300046463 Bacteria 1682
397 Ga0495580_0000612 3300046472 Bacteria 30191
398 Ga0495580_0335631 3300046472 Bacteria 1026
399 Ga0495580_0368315 3300046472 Bacteria 972
400 Ga0495639_0001536 3300046475 Bacteria 10297
401 Ga0495639_0150722 3300046475 Bacteria 1122
402 Ga0495662_0000686 3300046476 Bacteria 16015
403 Ga0495662_0227721 3300046476 Bacteria 919
404 Ga0495664_0065629 3300046477 Bacteria 2164
405 Ga0495664_0143367 3300046477 Bacteria 1448
406 Ga0495594_0060259 3300046499 Bacteria 2099
407 Ga0495594_0117200 3300046499 Bacteria 1504
408 Ga0495606_0006577 3300046507 Bacteria 10687
409 Ga0495608_0002093 3300046511 Bacteria 14381
410 Ga0495608_0013352 3300046511 Bacteria 5698
411 Ga0495608_0118822 3300046511 Bacteria 1696
412 Ga0495616_0060559 3300046513 Bacteria 1859
413 Ga0495618_0106025 3300046514 Bacteria 1799
414 Ga0495620_0105975 3300046515 Bacteria 1117
415 Ga0495628_0020462 3300046516 Bacteria 5456
416 Ga0495630_0002217 3300046517 Bacteria 13536
417 Ga0495630_0050507 3300046517 Bacteria 3113
418 Ga0495630_0127018 3300046517 Bacteria 1936
419 Ga0495632_0067712 3300046519 Bacteria 1721
420 Ga0495644_0037504 3300046523 Bacteria 1829
421 Ga0495644_0102427 3300046523 Bacteria 1084
422 Ga0495648_0024936 3300046524 Bacteria 4059
423 Ga0495666_0033405 3300046526 Bacteria 2513
424 Ga0495652_0002209 3300046529 Bacteria 20424
425 Ga0495652_0112630 3300046529 Bacteria 2185
426 Ga0495665_0000866 3300046531 Bacteria 15828
427 Ga0495640_0003099 3300046533 Bacteria 13412
428 Ga0495640_0026887 3300046533 Bacteria 4153
429 Ga0495640_0060112 3300046533 Bacteria 2585
430 Ga0495586_0181153 3300046535 Bacteria 1192
431 Ga0495587_0015200 3300046536 Bacteria 4810
432 Ga0495587_0060153 3300046536 Bacteria 2228
433 Ga0495609_0094082 3300046538 Bacteria 1302
434 Ga0495645_0012499 3300046543 Bacteria 5983
435 Ga0495645_0372414 3300046543 Bacteria 915
436 Ga0495622_0010588 3300046557 Bacteria 4255
437 Ga0495622_0033434 3300046557 Bacteria 2400
438 Ga0495622_0041090 3300046557 Bacteria 2151
439 Ga0495633_0016209 3300046558 Bacteria 3850
440 Ga0495667_0009515 3300046559 Bacteria 6585
441 Ga0495667_0102639 3300046559 Bacteria 1849
442 Ga0495667_0339842 3300046559 Bacteria 949
443 Ga0495656_0024862 3300046615 Bacteria 2370
444 Ga0495656_0171903 3300046615 Bacteria 1060
445 Ga0495668_0187894 3300046616 Bacteria 1131
446 Ga0495634_0045191 3300046642 Bacteria 2978
447 Ga0495611_0154633 3300046648 Bacteria 1071
448 Ga0495635_0000540 3300046663 Bacteria 24055
449 Ga0495635_0062629 3300046663 Bacteria 2554
450 Ga0495635_0065285 3300046663 Bacteria 2497
451 Ga0495588_0026578 3300046674 Bacteria 2891
452 Ga0495657_0001615 3300046675 Bacteria 19351
453 Ga0495657_0352837 3300046675 Bacteria 870
454 Ga0495599_0007666 3300046678 Bacteria 6555
455 Ga0495599_0130042 3300046678 Bacteria 1564
456 Ga0495623_0042546 3300046679 Bacteria 2893
457 Ga0495646_0010030 3300046680 Bacteria 6021
458 Ga0495646_0160143 3300046680 Bacteria 1246
459 Ga0495647_0021408 3300046681 Bacteria 2328
460 Ga0495658_0160068 3300046683 Bacteria 1388
461 Ga0495613_0069070 3300046689 Bacteria 2577
462 Ga0495624_0000079 3300046690 Bacteria 63196
463 Ga0495670_0054154 3300046691 Bacteria 2009
464 Ga0495670_0230220 3300046691 Bacteria 985
465 Ga0495589_0117953 3300046794 Bacteria 1279
466 Ga0495600_0004052 3300046809 Bacteria 8710
467 Ga0495600_0065595 3300046809 Bacteria 2374
468 Ga0495600_0137267 3300046809 Bacteria 1588
469 Ga0495600_0168998 3300046809 Bacteria 1412
470 Ga0495581_0000260 3300047315 Bacteria 25339
471 Ga0495581_0375513 3300047315 Bacteria 830
472 Ga0495604_0021019 3300047317 Bacteria 5207
473 Ga0495636_0100646 3300047318 Bacteria 1263
474 Ga0495674_0062608 3300047319 Bacteria 3238
475 Ga0495674_0064849 3300047319 Bacteria 3174
476 Ga0495674_0561004 3300047319 Bacteria 908
477 Ga0495676_0093962 3300047321 Bacteria 2235
478 Ga0495680_0012504 3300047322 Bacteria 7465
479 Ga0495680_0118005 3300047322 Bacteria 1961
480 Ga0495687_103989 3300047443 Bacteria 1059
481 Ga0495675_0001958 3300047444 Bacteria 12284
482 Ga0495675_0048595 3300047444 Bacteria 2698
483 Ga0495685_058857 3300047447 Bacteria 1297
484 Ga0495673_0015936 3300047469 Bacteria 3857
485 Ga0495673_0087248 3300047469 Bacteria 1281
486 Ga0495681_0082376 3300047470 Bacteria 1434
487 Ga0495684_0001865 3300047471 Bacteria 16864
488 Ga0495684_0007297 3300047471 Bacteria 8566
489 Ga0495684_0010601 3300047471 Bacteria 7124
490 Ga0495686_0181777 3300047472 Bacteria 1218
491 Ga0495686_0185346 3300047472 Bacteria 1203
492 Ga0495686_0197752 3300047472 Bacteria 1155
493 Ga0495686_0283535 3300047472 Bacteria 920
494 Ga0495593_0027612 3300047673 Bacteria 3123
495 Ga0495593_0126761 3300047673 Bacteria 1297
496 Ga0495602_0040611 3300048088 Bacteria 4262
497 Ga0496100_0059701 3300048903 Bacteria 2507
498 Ga0496100_0307617 3300048903 Bacteria 1188
499 Ga0496101_0015844 3300048904 Bacteria 5088
500 Ga0496101_0106191 3300048904 Bacteria 2108
501 Ga0496101_0281375 3300048904 Bacteria 1300
502 Ga0496102_0000518 3300048905 Bacteria 42014
503 Ga0496102_0088496 3300048905 Bacteria 2863
504 Ga0496102_0861594 3300048905 Bacteria 828
505 Ga0496103_0097246 3300048906 Bacteria 1861
506 Ga0496104_0081312 3300048907 Bacteria 3089
507 Ga0496104_0148553 3300048907 Bacteria 2250
508 Ga0496105_0004162 3300048908 Bacteria 10857
509 Ga0496105_0004256 3300048908 Bacteria 10766
510 Ga0496105_0496758 3300048908 Bacteria 958
511 Ga0496106_0015576 3300048909 Bacteria 5623
512 Ga0496106_0034762 3300048909 Bacteria 3766
513 Ga0496106_0059004 3300048909 Bacteria 2906
514 Ga0496106_0103365 3300048909 Bacteria 2211
515 Ga0496106_0326882 3300048909 Bacteria 1231
516 Ga0496106_0346934 3300048909 Bacteria 1192
517 Ga0496107_0038508 3300048910 Bacteria 3429
518 Ga0496107_0500936 3300048910 Bacteria 901
519 Ga0496108_0005230 3300048911 Bacteria 10477
520 Ga0496108_0034870 3300048911 Bacteria 4181
521 Ga0496108_0251129 3300048911 Bacteria 1539
522 Ga0496108_0344599 3300048911 Bacteria 1300
523 Ga0496108_0498172 3300048911 Bacteria 1064
524 Ga0496109_0005646 3300048912 Bacteria 10464
525 Ga0496109_0040291 3300048912 Bacteria 4231
526 Ga0496109_0281973 3300048912 Bacteria 1566
527 Ga0496109_0420102 3300048912 Bacteria 1263
528 Ga0496110_0065369 3300048913 Bacteria 3215
529 Ga0496110_0096837 3300048913 Bacteria 2644
530 Ga0496110_0172693 3300048913 Bacteria 1961
531 Ga0496111_0088140 3300048914 Bacteria 2272
532 Ga0496112_0000016 3300048915 Bacteria 194634
533 Ga0496112_0030428 3300048915 Bacteria 5224
534 Ga0496112_0069799 3300048915 Bacteria 3470
535 Ga0496113_0133554 3300048916 Bacteria 1949
536 Ga0496114_0023481 3300048917 Bacteria 5033
537 Ga0496114_0105206 3300048917 Bacteria 2414
538 Ga0496114_0243626 3300048917 Bacteria 1581
539 Ga0496114_0350706 3300048917 Bacteria 1305
540 Ga0496114_0752066 3300048917 Bacteria 852
541 Ga0496115_0001962 3300048918 Bacteria 14682
542 Ga0496115_0048010 3300048918 Bacteria 3415
543 Ga0496115_0077414 3300048918 Bacteria 2704
544 Ga0496115_0211815 3300048918 Bacteria 1600
545 Ga0496115_0234256 3300048918 Bacteria 1514
546 Ga0496116_0192763 3300048919 Bacteria 1077
547 Ga0496117_0039261 3300048920 Bacteria 3496
548 Ga0496118_0206977 3300048921 Bacteria 1155
549 Ga0496119_0114892 3300048922 Bacteria 1488
550 Ga0496121_0001006 3300048924 Bacteria 50348
551 Ga0496121_0007140 3300048924 Bacteria 13552
552 Ga0496121_0012978 3300048924 Bacteria 9004
553 Ga0496121_0037388 3300048924 Bacteria 4312
554 Ga0496121_0059500 3300048924 Bacteria 3149
555 Ga0496121_0240944 3300048924 Bacteria 1260
556 Ga0496121_0284476 3300048924 Bacteria 1129
557 Ga0496122_0028275 3300048925 Bacteria 4764
558 Ga0496124_0163386 3300048927 Bacteria 1733
559 Ga0496124_0339593 3300048927 Bacteria 1067
560 Ga0496124_0348823 3300048927 Bacteria 1048
561 Ga0496126_0005437 3300048929 Bacteria 14524
562 Ga0496126_0005856 3300048929 Bacteria 13876
563 Ga0496126_0010695 3300048929 Bacteria 9587
564 Ga0496126_0024996 3300048929 Bacteria 5757
565 Ga0496126_0040655 3300048929 Bacteria 4310
566 Ga0496126_0048260 3300048929 Bacteria 3892
567 Ga0496126_0105848 3300048929 Bacteria 2455
568 Ga0496126_0109713 3300048929 Bacteria 2405
569 Ga0496126_0112766 3300048929 Bacteria 2367
570 Ga0496126_0328395 3300048929 Bacteria 1256
571 Ga0496126_0424776 3300048929 Bacteria 1074
572 Ga0501067_0133959 3300049583 Bacteria 1379
573 Ga0501069_0238305 3300049585 Bacteria 1060
574 Ga0501080_0813931 3300049742 Bacteria 819
575 nmdc:mga03683_34046_c1 3300050489 Bacteria 2060
576 nmdc:mga03683_37958_c1 3300050489 Bacteria 1965
577 nmdc:mga03n38_10056_c1 3300050490 Bacteria 3465
578 nmdc:mga03n38_104613_c1 3300050490 Bacteria 1370
579 nmdc:mga03n38_6302_c1 3300050490 Bacteria 4111
580 nmdc:mga0yw44_156249_c1 3300050492 Bacteria 1491
581 nmdc:mga0yw44_40419_c1 3300050492 Bacteria 2771
582 nmdc:mga06z11_219654_c1 3300050494 Bacteria 1110
583 nmdc:mga06z11_345734_c1 3300050494 Bacteria 890
584 nmdc:mga07m45_181694_c1 3300050496 Bacteria 1223
585 nmdc:mga07m45_258554_c1 3300050496 Bacteria 1013
586 nmdc:mga05p37_73611_c1 3300050507 Bacteria 4204
587 nmdc:mga09592_201978_c1 3300050508 Bacteria 1721
588 nmdc:mga08y16_180641_c1 3300050511 Bacteria 2191
589 nmdc:mga0n895_150649_c1 3300050512 Bacteria 2356
590 nmdc:mga0n895_68361_c1 3300050512 Bacteria 3519
591 nmdc:mga0sz30_35207_c1 3300050516 Bacteria 2088
592 Ga0495601_0136144 3300053077 Bacteria 1601
593 Ga0495601_0185486 3300053077 Bacteria 1360
594 Ga0495612_0027321 3300053078 Bacteria 2294
595 Ga0500635_0016208 3300053080 Bacteria 2212
596 Ga0500635_0043627 3300053080 Bacteria 1509
597 Ga0495619_0411778 3300053085 Bacteria 933
598 Ga0500578_0153859 3300053086 Bacteria 1431
599 Ga0500643_009012 3300053087 Bacteria 3856
600 Ga0500647_0030004 3300053091 Bacteria 2581
601 Ga0500651_0019669 3300053093 Bacteria 4198
602 Ga0500651_0364100 3300053093 Bacteria 818
603 Ga0500566_0000064 3300053094 Bacteria 50908
604 Ga0500566_0000487 3300053094 Bacteria 22108
605 Ga0500648_071546 3300053097 Bacteria 1960
606 Ga0500554_006673 3300053102 Bacteria 2606
607 Ga0500556_0118411 3300053104 Bacteria 1032
608 Ga0500557_000039 3300053105 Bacteria 66862
609 Ga0500562_065621 3300053108 Bacteria 977
610 Ga0500572_000026 3300053111 Bacteria 45518
611 Ga0500582_054883 3300053114 Bacteria 1319
612 Ga0500591_052437 3300053115 Bacteria 1909
613 Ga0500595_002953 3300053119 Bacteria 8096
614 Ga0500595_004822 3300053119 Bacteria 5969
615 Ga0500595_013331 3300053119 Bacteria 3151
616 Ga0500595_016291 3300053119 Bacteria 2772
617 Ga0500614_001497 3300053123 Bacteria 5564
618 Ga0500559_0003076 3300053136 Bacteria 8326
619 Ga0500573_0088162 3300053140 Bacteria 1755
620 Ga0500603_001132 3300053150 Bacteria 6234
621 Ga0500603_035474 3300053150 Bacteria 1308
622 Ga0500603_040205 3300053150 Bacteria 1245
623 Ga0500630_000572 3300053159 Bacteria 16714
624 Ga0500638_025631 3300053162 Bacteria 2820
625 Ga0500639_000353 3300053163 Bacteria 22721
626 Ga0500636_0033322 3300053177 Bacteria 3050
627 Ga0500637_0027232 3300053178 Bacteria 3154
628 Ga0500637_0072075 3300053178 Bacteria 1987
629 Ga0530510_0266624 3300061734 Bacteria 1278
630 Ga0530510_0645359 3300061734 Bacteria 806
631 2509153764 2508501128 Bacteria 8613869
632 2513660052 2513237096 Bacteria 8722461
633 2513676489 2513237098 Bacteria 9902361
634 2513696982 2513237101 Bacteria 7952346
635 2513720603 2513237104 Bacteria 10034502
636 2513858230 2513237137 Bacteria 9558895
637 2513878070 2513237139 Bacteria 8737671
638 2513892026 2513237141 Bacteria 8496279
639 2513922138 2513237145 Bacteria 8979722
640 2514012633 2513237161 Bacteria 8871253
641 2517893881 2517572143 Bacteria 9484767
642 2671122874 2667528175 Bacteria 7532676
643 2723846425 2721755755 Bacteria 8322773
644 2793072480 2791355197 Bacteria 8420563
645 2793076916
646 2805920030 2802429603 Bacteria 8777136
647 2824674292 2824671348 Bacteria 8369588
648 2824690914 2824687955 Bacteria 8360029
649 2824698510 2824696289 Bacteria 8335049
650 2824778227 2824773399 Bacteria 8360218
651 2838127481 2838122688 Bacteria 8803140
652 2841941566 2841941048 Bacteria 8688029
653 2841952418 2841949485 Bacteria 8680857
654 2841967710 2841966195 Bacteria 8673214
655 2841982124 2841974524 Bacteria 8931498
656 2841986442 2841983080 Bacteria 8395090
657 2842038206 2842038055 Bacteria 8002051
658 2842048848 2842045827 Bacteria 8006841
659 2847945079 2847939898 Bacteria 8606328
660 2849080735 2849076700 Bacteria 7039503
661 2874610607 2874604998 Bacteria 7834745
662 2874636094 2874628541 Bacteria 8630250
663 2879118669 2879110137 Bacteria 8907982
664 2885382471 2885374607 Bacteria 8927485
665 2885387389 2885383462 Bacteria 9473874
666 2889039062 2889033259 Bacteria 9099371
667 2903771737 2903768456 Bacteria 9749579
668 2906630149 2906626472 Bacteria 8826946
669 2906663976 2906660503 Bacteria 8595048
670 2908744281 2908739725 Bacteria 8628932
671 2922362236 2922361189 Bacteria 7436256
672 2922388009 2922386360 Bacteria 7017218
673 2922428554
674 3005478685 3005474847 Bacteria 9259049
675 8006930899 8006926726 Bacteria 6749210
676 8006964811 8006964411 Bacteria 8966052
677 8006991792 8006984368 Bacteria 9651211
678 8006995547 8006994254 Bacteria 8309700
679 8016590788 8016583857 Bacteria 10421953
680 8056676407 8056673599 Bacteria 7871253
681 8056685075 8056681323 Bacteria 8472857
682 Ga0496121_0132967
683 JGI25406J46586_10000101
684 JGI25153J46596_10000366
685 rootH1_10311687
686 JGI25404J52841_10001176
687 JGI25404J52841_10005591
688 JGI25404J52841_10012355
689 Ga0070658_10075965
690 Ga0070676_10207093
691 Ga0070690_100297909
692 Ga0068869_100055295
693 Ga0070680_100010206
694 Ga0070682_100244113
695 Ga0068868_100015888
696 Ga0068868_100401854
697 Ga0070691_10078977
698 Ga0070661_100117286
699 Ga0070668_100089005
700 Ga0070668_100212102
701 Ga0070668_100280028
702 Ga0070668_100301720
703 Ga0070668_100434105
704 Ga0070671_100138520
705 Ga0070671_100476033
706 Ga0070674_100082069
707 Ga0070674_100277629
708 Ga0070659_100105258
709 Ga0070659_100350454
710 Ga0070667_100377117
711 Ga0070714_100027346
712 Ga0070713_100040752
713 Ga0070713_100155251
714 Ga0070713_100188452
715 Ga0070710_10126601
716 Ga0070711_100067274
717 Ga0070705_100386617
718 Ga0070700_100100374
719 Ga0070663_100021332
720 Ga0070663_100054669
721 Ga0070663_100173166
722 Ga0070663_100406350
723 Ga0070678_100167358
724 Ga0070678_100214679
725 Ga0070662_100122815
726 Ga0070681_10111762
727 Ga0070681_10157512
728 Ga0070706_100711841
729 Ga0070699_100101996
730 Ga0070679_100042441
731 Ga0070679_100270335
732 Ga0070684_100015968
733 Ga0070697_100013902
734 Ga0068853_100011732
735 Ga0068853_100572264
736 Ga0070672_100135810
737 Ga0070693_100386360
738 Ga0070665_100024503
739 Ga0070665_100040613
740 Ga0070665_100064016
741 Ga0070665_100213917
742 Ga0070665_100350091
743 Ga0068855_100060159
744 Ga0068855_100408493
745 Ga0068855_100490309
746 Ga0070664_100033202
747 Ga0070664_100454355
748 Ga0070664_100569117
749 Ga0068857_100007520
750 Ga0068857_100044741
751 Ga0068857_100113947
752 Ga0068854_100148414
753 Ga0068856_100007308
754 Ga0068856_100196642
755 Ga0068852_100015317
756 Ga0068852_100270872
757 Ga0068852_100389428
758 Ga0068852_100563436
759 Ga0068859_100338201
760 Ga0068864_100792320
761 Ga0068861_100183743
762 Ga0068861_100378092
763 Ga0068851_10035713
764 Ga0068851_10042077
765 Ga0068851_10098288
766 Ga0068863_100116240
767 Ga0068858_100083372
768 Ga0068858_100385602
769 Ga0068860_100000317
770 Ga0068860_100487922
771 Ga0068860_100506737
772 Ga0068862_100448049
773 Ga0068862_100469237
774 Ga0068862_100601639
775 Ga0081455_10002423
776 Ga0081455_10014321
777 Ga0081455_10027456
778 Ga0081455_10043450
779 Ga0081538_10078133
780 Ga0081540_1002773
781 Ga0081540_1019810
782 Ga0081540_1028597
783 Ga0081540_1030875
784 Ga0081540_1050086
785 Ga0081539_10000008
786 Ga0081539_10014085
787 Ga0075365_10048361
788 Ga0075365_10049203
789 Ga0075365_10058056
790 Ga0075363_100015314
791 Ga0075363_100033887
792 Ga0075363_100065873
793 Ga0075364_10008417
794 Ga0070716_100177431
795 Ga0070716_100182513
796 Ga0070712_100044408
797 Ga0070712_100058594
798 Ga0070712_100087440
799 Ga0075362_10033896
800 Ga0075367_10092168
801 Ga0075367_10099401
802 Ga0075369_10054110
803 Ga0075369_10094644
804 Ga0075366_10081527
805 Ga0075370_10101270
806 Ga0068871_100034617
807 Ga0075428_100123099
808 Ga0075433_10366859
809 Ga0068865_100103820
810 Ga0068865_100186220
811 Ga0097620_100338211
812 Ga0097620_100488555
813 Ga0099794_10010584
814 Ga0099795_10014016
815 Ga0099795_10035564
816 Ga0099795_10144979
817 Ga0105240_10015488
818 Ga0105240_10027333
819 Ga0105240_10157122
820 Ga0111539_10153919
821 Ga0105245_10599251
822 Ga0105247_10065888
823 Ga0105247_10082679
824 Ga0105247_10206439
825 Ga0105247_10265813
826 Ga0114129_10189934
827 Ga0105243_10455932
828 Ga0105243_10482308
829 Ga0105241_10001933
830 Ga0105242_10044906
831 Ga0105248_10169265
832 Ga0105248_10397306
833 Ga0105237_10052107
834 Ga0105237_10711044
835 Ga0105238_10027310
836 Ga0105238_10218701
837 Ga0105238_10261491
838 Ga0105249_10048330
839 Ga0105249_10108420
840 Ga0099796_10005800
841 Ga0105239_10003918
842 Ga0105239_10032269
843 Ga0105239_10112481
844 Ga0105239_10427151
845 Ga0105239_10644473
846 Ga0105239_10936745
847 Ga0105246_10022596
848 Ga0105246_10147661
849 Ga0157373_10023533
850 Ga0157370_10050985
851 Ga0157370_10064097
852 Ga0157369_10020578
853 Ga0157374_10116079
854 Ga0157378_10133867
855 Ga0157378_10234185
856 Ga0157378_10301901
857 Ga0163162_10065624
858 Ga0163162_10275084
859 Ga0163162_10415914
860 Ga0157375_10047153
861 Ga0157375_10409004
862 Ga0163163_10118731
863 Ga0163163_10475253
864 Ga0157380_10344633
865 Ga0157379_10295378
866 Ga0157379_10628229
867 Ga0157376_10232917
868 Ga0163161_10152397
869 Ga0163161_10241358
870 Ga0213872_10020912
871 Ga0209233_1013207
872 Ga0209758_1001988
873 Ga0209758_1002062
874 Ga0207426_1003194
875 Ga0209257_1022337
876 Ga0207656_10010983
877 Ga0207656_10057189
878 Ga0207656_10149263
879 Ga0207692_10066134
880 Ga0207688_10041574
881 Ga0207699_10236627
882 Ga0207645_10153219
883 Ga0207705_10128360
884 Ga0207654_10000409
885 Ga0207654_10027785
886 Ga0207707_10000466
887 Ga0207695_10001179
888 Ga0207695_10057285
889 Ga0207671_10295800
890 Ga0207693_10047433
891 Ga0207693_10075916
892 Ga0207660_10004908
893 Ga0207660_10611588
894 Ga0207657_10004634
895 Ga0207657_10015386
896 Ga0207652_10002138
897 Ga0207694_10000131
898 Ga0207694_10014107
899 Ga0207694_10177895
900 Ga0207694_10457065
901 Ga0207659_10296136
902 Ga0207659_10425981
903 Ga0207687_10017929
904 Ga0207687_10170251
905 Ga0207700_10439564
906 Ga0207664_10076606
907 Ga0207664_10079826
908 Ga0207644_10546543
909 Ga0207690_10098731
910 Ga0207706_10394548
911 Ga0207706_10426775
912 Ga0207706_10443301
913 Ga0207709_10136546
914 Ga0207669_10197703
915 Ga0207669_10521505
916 Ga0207704_10039581
917 Ga0207704_10370988
918 Ga0207665_10032684
919 Ga0207711_10108226
920 Ga0207661_10630671
921 Ga0207679_10210002
922 Ga0207667_10012774
923 Ga0207668_10022935
924 Ga0207668_10026363
925 Ga0207668_10287357
926 Ga0207668_10301459
927 Ga0207640_10173308
928 Ga0207640_10222317
929 Ga0207677_10008684
930 Ga0207703_10071370
931 Ga0207703_10569507
932 Ga0207639_10009801
933 Ga0207678_10029342
934 Ga0207678_10040741
935 Ga0207678_10056118
936 Ga0207678_10073505
937 Ga0207678_10285598
938 Ga0207678_10314808
939 Ga0207678_10549394
940 Ga0207702_10000005
941 Ga0207702_10041464
942 Ga0207641_10146719
943 Ga0207648_10029160
944 Ga0207676_10046804
945 Ga0207676_10325347
946 Ga0207676_10746907
947 Ga0207674_10121029
948 Ga0207683_10054649
949 Ga0207683_10082425
950 Ga0207683_10171284
951 Ga0207683_10267798
952 Ga0207683_10275414
953 Ga0207683_10427965
954 Ga0207698_10184982
955 Ga0207698_10316920
956 Ga0207698_10333157
957 Ga0209588_1003663
958 Ga0209588_1010269
959 Ga0268266_10003531
960 Ga0268266_10016020
961 Ga0268266_10095655
962 Ga0268266_10625981
963 Ga0268265_10016485
964 Ga0268265_10234218
965 Ga0268265_10348360
966 Ga0268264_10000035
967 Ga0268264_10522113
968 Ga0265334_10002345
969 Ga0307517_10000049
970 Ga0307517_10121697
971 Ga0307515_10328546
972 Ga0307515_10368512
973 Ga0265338_10000065
974 Ga0307511_10119711
975 Ga0265330_10088915
976 Ga0265325_10005453
977 Ga0265340_10034032
978 Ga0265340_10057096
979 Ga0265339_10005966
980 Ga0265339_10051154
981 Ga0265339_10124077
982 Ga0307513_10114991
983 Ga0307509_10029857
984 Ga0307408_100347334
985 Ga0307408_100408467
986 Ga0265313_10135803
987 Ga0307508_10000090
988 Ga0307508_10065785
989 Ga0265314_10035278
990 Ga0265314_10098883
991 Ga0265314_10110044
992 Ga0265342_10005498
993 Ga0265342_10069463
994 Ga0307516_10107825
995 Ga0307413_10104874
996 Ga0307407_10204741
997 Ga0307409_100140919
998 Ga0307411_10608180
999 Ga0307415_100069197
1000 Ga0307415_100297476
1001 Ga0307415_100420859
1002 Ga0307510_10004617
1003 Ga0307510_10020616
1004 Ga0307510_10049660
1005 Ga0307510_10288449
1006 Ga0307510_10308340
1007 Ga0315911_1000011
1008 Ga0373930_0022194
1009 Ga0373928_0038315
1010 Ga0373934_0012795
1011 Ga0373940_0016125
1012 Ga0373949_0091520
1013 Ga0373923_0008238
1014 Ga0373945_0014375
1015 Ga0373953_0003083
1016 Ga0373953_0028556
1017 Ga0373954_0095401
1018 Ga0373956_0000726
1019 Ga0373957_0004882
1020 Ga0373957_0058486
1021 Ga0373943_0004812
1022 Ga0373943_0150650
1023 Ga0373955_0003241
1024 Ga0373955_0159578
1025 Ga0373961_0062211
1026 Ga0373924_0021046
1027 Ga0373931_0001506
1028 Ga0373931_0041769
1029 Ga0373931_0165874
1030 Ga0373935_0153542
1031 Ga0373927_0001005
1032 Ga0373927_0005832
1033 Ga0373927_0046813
1034 Ga0373933_0009400
1035 Ga0373933_0033690
1036 Ga0373947_0003823
1037 Ga0373937_0002920
1038 Ga0373937_0060818
1039 Ga0373937_0061629
1040 Ga0373937_0101399
1041 Ga0373937_0210903
1042 Ga0373925_0006131
1043 Ga0373925_0051552
1044 Ga0373925_0427393
1045 Ga0395900_0053575
1046 Ga0395901_0179868
1047 Ga0395901_0915093
1048 Ga0395901_1045332
1049 Ga0436360_0187845
1050 Ga0436361_0371881
1051 Ga0436361_0442731
1052 Ga0436363_1282749
1053 Ga0439465_0069692
1054 Ga0451791_1590430
1055 Ga0451800_1673708
1056 Ga0466970_0305989
1057 Ga0466957_0354246
1058 Ga0466967_0140691
1059 Ga0495592_0001015
1060 Ga0495603_0010944
1061 Ga0495603_0056159
1062 Ga0495603_0074360
1063 Ga0495603_0209696
1064 Ga0495629_0003238
1065 Ga0495629_0011592
1066 Ga0495629_0054448
1067 Ga0495629_0197502
1068 Ga0495638_0062988
1069 Ga0495638_0258760
1070 Ga0495641_0009631
1071 Ga0495641_0047197
1072 Ga0495651_0015940
1073 Ga0495651_0085725
1074 Ga0495651_0242619
1075 Ga0495651_0503811
1076 Ga0495653_0000934
1077 Ga0495653_0142684
1078 Ga0495580_0000612
1079 Ga0495580_0335631
1080 Ga0495580_0368315
1081 Ga0495639_0001536
1082 Ga0495639_0150722
1083 Ga0495662_0000686
1084 Ga0495662_0227721
1085 Ga0495664_0065629
1086 Ga0495664_0143367
1087 Ga0495594_0060259
1088 Ga0495594_0117200
1089 Ga0495606_0006577
1090 Ga0495608_0002093
1091 Ga0495608_0013352
1092 Ga0495608_0118822
1093 Ga0495616_0060559
1094 Ga0495618_0106025
1095 Ga0495620_0105975
1096 Ga0495628_0020462
1097 Ga0495630_0002217
1098 Ga0495630_0050507
1099 Ga0495630_0127018
1100 Ga0495632_0067712
1101 Ga0495644_0037504
1102 Ga0495644_0102427
1103 Ga0495648_0024936
1104 Ga0495666_0033405
1105 Ga0495652_0002209
1106 Ga0495652_0112630
1107 Ga0495665_0000866
1108 Ga0495640_0003099
1109 Ga0495640_0026887
1110 Ga0495640_0060112
1111 Ga0495586_0181153
1112 Ga0495587_0015200
1113 Ga0495587_0060153
1114 Ga0495609_0094082
1115 Ga0495645_0012499
1116 Ga0495645_0372414
1117 Ga0495622_0010588
1118 Ga0495622_0033434
1119 Ga0495622_0041090
1120 Ga0495633_0016209
1121 Ga0495667_0009515
1122 Ga0495667_0102639
1123 Ga0495667_0339842
1124 Ga0495656_0024862
1125 Ga0495656_0171903
1126 Ga0495668_0187894
1127 Ga0495634_0045191
1128 Ga0495611_0154633
1129 Ga0495635_0000540
1130 Ga0495635_0062629
1131 Ga0495635_0065285
1132 Ga0495588_0026578
1133 Ga0495657_0001615
1134 Ga0495657_0352837
1135 Ga0495599_0007666
1136 Ga0495599_0130042
1137 Ga0495623_0042546
1138 Ga0495646_0010030
1139 Ga0495646_0160143
1140 Ga0495647_0021408
1141 Ga0495658_0160068
1142 Ga0495613_0069070
1143 Ga0495624_0000079
1144 Ga0495670_0054154
1145 Ga0495670_0230220
1146 Ga0495589_0117953
1147 Ga0495600_0004052
1148 Ga0495600_0065595
1149 Ga0495600_0137267
1150 Ga0495600_0168998
1151 Ga0495581_0000260
1152 Ga0495581_0375513
1153 Ga0495604_0021019
1154 Ga0495636_0100646
1155 Ga0495674_0062608
1156 Ga0495674_0064849
1157 Ga0495674_0561004
1158 Ga0495676_0093962
1159 Ga0495680_0012504
1160 Ga0495680_0118005
1161 Ga0495687_103989
1162 Ga0495675_0001958
1163 Ga0495675_0048595
1164 Ga0495685_058857
1165 Ga0495673_0015936
1166 Ga0495673_0087248
1167 Ga0495681_0082376
1168 Ga0495684_0001865
1169 Ga0495684_0007297
1170 Ga0495684_0010601
1171 Ga0495686_0181777
1172 Ga0495686_0185346
1173 Ga0495686_0197752
1174 Ga0495686_0283535
1175 Ga0495593_0027612
1176 Ga0495593_0126761
1177 Ga0495602_0040611
1178 Ga0496100_0059701
1179 Ga0496100_0307617
1180 Ga0496101_0015844
1181 Ga0496101_0106191
1182 Ga0496101_0281375
1183 Ga0496102_0000518
1184 Ga0496102_0088496
1185 Ga0496102_0861594
1186 Ga0496103_0097246
1187 Ga0496104_0081312
1188 Ga0496104_0148553
1189 Ga0496105_0004162
1190 Ga0496105_0004256
1191 Ga0496105_0496758
1192 Ga0496106_0015576
1193 Ga0496106_0034762
1194 Ga0496106_0059004
1195 Ga0496106_0103365
1196 Ga0496106_0326882
1197 Ga0496106_0346934
1198 Ga0496107_0038508
1199 Ga0496107_0500936
1200 Ga0496108_0005230
1201 Ga0496108_0034870
1202 Ga0496108_0251129
1203 Ga0496108_0344599
1204 Ga0496108_0498172
1205 Ga0496109_0005646
1206 Ga0496109_0040291
1207 Ga0496109_0281973
1208 Ga0496109_0420102
1209 Ga0496110_0065369
1210 Ga0496110_0096837
1211 Ga0496110_0172693
1212 Ga0496111_0088140
1213 Ga0496112_0000016
1214 Ga0496112_0030428
1215 Ga0496112_0069799
1216 Ga0496113_0133554
1217 Ga0496114_0023481
1218 Ga0496114_0105206
1219 Ga0496114_0243626
1220 Ga0496114_0350706
1221 Ga0496114_0752066
1222 Ga0496115_0001962
1223 Ga0496115_0048010
1224 Ga0496115_0077414
1225 Ga0496115_0211815
1226 Ga0496115_0234256
1227 Ga0496116_0192763
1228 Ga0496117_0039261
1229 Ga0496118_0206977
1230 Ga0496119_0114892
1231 Ga0496121_0001006
1232 Ga0496121_0007140
1233 Ga0496121_0012978
1234 Ga0496121_0037388
1235 Ga0496121_0059500
1236 Ga0496121_0240944
1237 Ga0496121_0284476
1238 Ga0496122_0028275
1239 Ga0496124_0163386
1240 Ga0496124_0339593
1241 Ga0496124_0348823
1242 Ga0496126_0005437
1243 Ga0496126_0005856
1244 Ga0496126_0010695
1245 Ga0496126_0024996
1246 Ga0496126_0040655
1247 Ga0496126_0048260
1248 Ga0496126_0105848
1249 Ga0496126_0109713
1250 Ga0496126_0112766
1251 Ga0496126_0328395
1252 Ga0496126_0424776
1253 Ga0501067_0133959
1254 Ga0501069_0238305
1255 Ga0501080_0813931
1256 nmdc:mga03683_34046_c1
1257 nmdc:mga03683_37958_c1
1258 nmdc:mga03n38_10056_c1
1259 nmdc:mga03n38_104613_c1
1260 nmdc:mga03n38_6302_c1
1261 nmdc:mga0yw44_156249_c1
1262 nmdc:mga0yw44_40419_c1
1263 nmdc:mga06z11_219654_c1
1264 nmdc:mga06z11_345734_c1
1265 nmdc:mga07m45_181694_c1
1266 nmdc:mga07m45_258554_c1
1267 nmdc:mga05p37_73611_c1
1268 nmdc:mga09592_201978_c1
1269 nmdc:mga08y16_180641_c1
1270 nmdc:mga0n895_150649_c1
1271 nmdc:mga0n895_68361_c1
1272 nmdc:mga0sz30_35207_c1
1273 Ga0495601_0136144
1274 Ga0495601_0185486
1275 Ga0495612_0027321
1276 Ga0500635_0016208
1277 Ga0500635_0043627
1278 Ga0495619_0411778
1279 Ga0500578_0153859
1280 Ga0500643_009012
1281 Ga0500647_0030004
1282 Ga0500651_0019669
1283 Ga0500651_0364100
1284 Ga0500566_0000064
1285 Ga0500566_0000487
1286 Ga0500648_071546
1287 Ga0500554_006673
1288 Ga0500556_0118411
1289 Ga0500557_000039
1290 Ga0500562_065621
1291 Ga0500572_000026
1292 Ga0500582_054883
1293 Ga0500591_052437
1294 Ga0500595_002953
1295 Ga0500595_004822
1296 Ga0500595_013331
1297 Ga0500595_016291
1298 Ga0500614_001497
1299 Ga0500559_0003076
1300 Ga0500573_0088162
1301 Ga0500603_001132
1302 Ga0500603_035474
1303 Ga0500603_040205
1304 Ga0500630_000572
1305 Ga0500638_025631
1306 Ga0500639_000353
1307 Ga0500636_0033322
1308 Ga0500637_0027232
1309 Ga0500637_0072075
1310 Ga0530510_0266624
1311 Ga0530510_0645359
1312 2509153764
1313 2513660052
1314 2513676489
1315 2513696982
1316 2513720603
1317 2513858230
1318 2513878070
1319 2513892026
1320 2513922138
1321 2514012633
1322 2517893881
1323 2671122874
1324 2723846425
1325 2793072480
1326 2793076916
1327 2805920030
1328 2824674292
1329 2824690914
1330 2824698510
1331 2824778227
1332 2838127481
1333 2841941566
1334 2841952418
1335 2841967710
1336 2841982124
1337 2841986442
1338 2842038206
1339 2842048848
1340 2847945079
1341 2849080735
1342 2874610607
1343 2874636094
1344 2879118669
1345 2885382471
1346 2885387389
1347 2889039062
1348 2903771737
1349 2906630149
1350 2906663976
1351 2908744281
1352 2922362236
1353 2922388009
1354 2922428554
1355 3005478685
1356 8006930899
1357 8006964811
1358 8006991792
1359 8006995547
1360 8016590788
1361 8056676407
1362 8056685075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rqc-assembly4.cif.gz_B crystal structure of the catalytic core of the 2-oxoacid dehydrogenase multienzyme complex from thermoplasma acidophilum 0.7404 2 239
3rqc-assembly4.cif.gz_B crystal structure of the catalytic core of the 2-oxoacid dehydrogenase multienzyme complex from thermoplasma acidophilum 0.7284 2 239
8p5s-assembly1.cif.gz_A crystal structure of the homohexameric 2-oxoglutarate dehydrogenase odha from corynebacterium glutamicum 0.7038 1 247
8p5x-assembly1.cif.gz_A single particle cryo-em structure of the complex between corynebacterium glutamicum homohexameric 2-oxoglutarate dehydrogenase odha and the fha-protein inhibitor odhi 0.7034 2 247
8p5v-assembly1.cif.gz_A single particle cryo-em structure of homohexameric 2-oxoglutarate dehydrogenase odha from corynebacterium glutamicum in complex with the product succinyl-coa 0.7028 1 247
ID Description Score Start End Superfamily
af_Q55FT0_10_134_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8212 206 237 3.30.450.30
af_Q8IJJ4_405_638_3.30.559.10 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.7307 1 238 3.30.559.10
af_O45279_88_321_3.30.559.10 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.711 1 243 3.30.559.10
af_O06159_171_389_3.30.559.10 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.7094 8 238 3.30.559.10
af_O06159_171_389_3.30.559.10 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.7008 8 238 3.30.559.10
ID Description Score Start End GO Terms
AF-A0A401TP85-F1-model_v4 Uncharacterized protein 0.9711 19 171
AF-A0A140GVL5-F1-model_v4 Uncharacterized protein 0.9675 5 244
AF-A0A2T0SGS7-F1-model_v4 2-oxoacid dehydrogenase/acyltransferase catalytic subunit 0.9645 16 244
AF-A0A525KM36-F1-model_v4 Acyltransferase 0.9633 1 247 GO:0016746
AF-Q11CI3-F1-model_v4 2-oxoacid dehydrogenase acyltransferase catalytic domain-containing protein 0.9625 19 247

Map