F474792
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 680 | 373 | 643 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300042005|Ga0439448_0022644|Ga0439448_0022644_365_1117 |
| Length | 250 |
| Sequence | MSGNPIIRLNGARTLFYKEVLRFWKVSFQTVAAPVLTAVLYLLIFGHVLENRVKVYDNVGYTSFLIPGLVMMSVLQNAFANSSSSLIQSKITGNLVFLLVTPLSHWAWFLAYVGASLVRGLAVGLGVFAVTAWFAPPGFALLGAGMLGSLGLIAGLWAEKFDQMAAFQNFIIVPMTFLSGVFYSVHSLPPFWQGVSHLNPFFYMIDGFRRGFFGVSDVSPWLSLSVVATSFVLVSAIALRLLKTGYKLRH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 6 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 7 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 8 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 9 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 10 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 11 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 12 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 13 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 14 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 15 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 16 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 17 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 18 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 19 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 20 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 21 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 22 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 23 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 24 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 25 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 26 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 27 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 28 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 29 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 30 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 31 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 32 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 33 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 34 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 35 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 36 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 37 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 38 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 39 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 40 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 55 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 76 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 97 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 98 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 99 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 111 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 131 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 192 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 206 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 207 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 208 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 214 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 217 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 218 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 221 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 222 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 227 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 228 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 229 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 231 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 241 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 242 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 243 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 244 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 245 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 248 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 249 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 250 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 251 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 252 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 253 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 254 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 255 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 256 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 257 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 258 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 259 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 260 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 261 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 262 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 263 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 264 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 265 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 266 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 267 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 268 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 269 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 272 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 273 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 274 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 299 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 300 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 306 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 307 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 308 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 309 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 310 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 311 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 312 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 313 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 314 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 315 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 316 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 317 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 318 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 319 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 320 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 332 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 333 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 334 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 335 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 336 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 337 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 338 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 340 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 341 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 342 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 343 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 344 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 345 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 349 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 350 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 351 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 360 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 361 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 363 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 364 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 365 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 366 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 367 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 368 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 369 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 370 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 371 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 372 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 373 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.56 |
| Metatranscriptomes | 0 |
| Isolates | 5.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.71 |
| Nodule | 0.59 |
| Rhizoplane | 2.35 |
| Rhizosphere | 70.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1016063 | 3300002705 | Bacteria | 1472 |
| 2 | JGI25152J39213_1000516 | 3300002773 | Bacteria | 21501 |
| 3 | JGI25150J39212_1009378 | 3300002774 | Bacteria | 1867 |
| 4 | JGI25151J46595_10000121 | 3300003187 | Bacteria | 106308 |
| 5 | JGI25153J46596_10000543 | 3300003215 | Bacteria | 23510 |
| 6 | JGI25153J46596_10005712 | 3300003215 | Bacteria | 6487 |
| 7 | rootH2_10002268 | 3300003320 | Bacteria | 2287 |
| 8 | Ga0055535_1000618 | 3300003761 | Bacteria | 28963 |
| 9 | Ga0055529_1000053 | 3300003763 | Bacteria | 198996 |
| 10 | Ga0055529_1001095 | 3300003763 | Bacteria | 12204 |
| 11 | Ga0055526_1007216 | 3300003771 | Bacteria | 5833 |
| 12 | Ga0055524_1000247 | 3300003775 | Bacteria | 56379 |
| 13 | Ga0055530_10004453 | 3300003791 | Bacteria | 7195 |
| 14 | Ga0055540_1000260 | 3300003792 | Bacteria | 47714 |
| 15 | Ga0055540_1005560 | 3300003792 | Bacteria | 5259 |
| 16 | Ga0055540_1038671 | 3300003792 | Bacteria | 1044 |
| 17 | Ga0055531_10000105 | 3300003794 | Bacteria | 91871 |
| 18 | Ga0055531_10011138 | 3300003794 | Bacteria | 4377 |
| 19 | Ga0065165_1000521 | 3300005262 | Bacteria | 58807 |
| 20 | Ga0065165_1002331 | 3300005262 | Bacteria | 16569 |
| 21 | Ga0070658_10293216 | 3300005327 | Bacteria | 1386 |
| 22 | Ga0070676_10043832 | 3300005328 | Bacteria | 2601 |
| 23 | Ga0070676_10297556 | 3300005328 | Bacteria | 1093 |
| 24 | Ga0070683_100460717 | 3300005329 | Bacteria | 1213 |
| 25 | Ga0070690_100097048 | 3300005330 | Bacteria | 1949 |
| 26 | Ga0070670_100010621 | 3300005331 | Bacteria | 7865 |
| 27 | Ga0070670_100380408 | 3300005331 | Bacteria | 1244 |
| 28 | Ga0070677_10000741 | 3300005333 | Bacteria | 10908 |
| 29 | Ga0070677_10131373 | 3300005333 | Bacteria | 1143 |
| 30 | Ga0068869_100190965 | 3300005334 | Bacteria | 1610 |
| 31 | Ga0070666_10375841 | 3300005335 | Bacteria | 1019 |
| 32 | Ga0068868_100002184 | 3300005338 | Bacteria | 13491 |
| 33 | Ga0068868_100022204 | 3300005338 | Bacteria | 4788 |
| 34 | Ga0068868_100077659 | 3300005338 | Bacteria | 2656 |
| 35 | Ga0068868_100257875 | 3300005338 | Bacteria | 1469 |
| 36 | Ga0070689_100154089 | 3300005340 | Bacteria | 1855 |
| 37 | Ga0070687_100087950 | 3300005343 | Bacteria | 1712 |
| 38 | Ga0070661_100000361 | 3300005344 | Bacteria | 35932 |
| 39 | Ga0070661_100045911 | 3300005344 | Bacteria | 3194 |
| 40 | Ga0070668_100232233 | 3300005347 | Bacteria | 1525 |
| 41 | Ga0070669_100025458 | 3300005353 | Bacteria | 4250 |
| 42 | Ga0070675_100000345 | 3300005354 | Bacteria | 31378 |
| 43 | Ga0070675_100005881 | 3300005354 | Bacteria | 9399 |
| 44 | Ga0070675_100066125 | 3300005354 | Bacteria | 2989 |
| 45 | Ga0070675_100160050 | 3300005354 | Bacteria | 1935 |
| 46 | Ga0070675_100352375 | 3300005354 | Bacteria | 1305 |
| 47 | Ga0070675_100607702 | 3300005354 | Bacteria | 992 |
| 48 | Ga0070671_100001168 | 3300005355 | Bacteria | 19603 |
| 49 | Ga0070671_100006977 | 3300005355 | Bacteria | 9047 |
| 50 | Ga0070671_100037374 | 3300005355 | Bacteria | 4026 |
| 51 | Ga0070671_100062581 | 3300005355 | Bacteria | 3098 |
| 52 | Ga0070671_100137745 | 3300005355 | Bacteria | 2058 |
| 53 | Ga0070671_100255293 | 3300005355 | Bacteria | 1489 |
| 54 | Ga0070671_100427027 | 3300005355 | Bacteria | 1135 |
| 55 | Ga0070674_100003690 | 3300005356 | Bacteria | 8625 |
| 56 | Ga0070674_100026418 | 3300005356 | Bacteria | 3792 |
| 57 | Ga0070674_100029445 | 3300005356 | Bacteria | 3617 |
| 58 | Ga0070674_100181127 | 3300005356 | Bacteria | 1614 |
| 59 | Ga0070674_100313785 | 3300005356 | Bacteria | 1254 |
| 60 | Ga0070673_100011217 | 3300005364 | Bacteria | 6111 |
| 61 | Ga0070673_100048015 | 3300005364 | Bacteria | 3325 |
| 62 | Ga0070673_100092831 | 3300005364 | Bacteria | 2470 |
| 63 | Ga0070673_100465855 | 3300005364 | Bacteria | 1138 |
| 64 | Ga0070688_100104820 | 3300005365 | Bacteria | 1871 |
| 65 | Ga0070659_100001606 | 3300005366 | Bacteria | 16262 |
| 66 | Ga0070667_100515932 | 3300005367 | Bacteria | 1096 |
| 67 | Ga0070701_10301101 | 3300005438 | Bacteria | 986 |
| 68 | Ga0070700_100015225 | 3300005441 | Bacteria | 4358 |
| 69 | Ga0070694_100022166 | 3300005444 | Bacteria | 4067 |
| 70 | Ga0070663_100000113 | 3300005455 | Bacteria | 37716 |
| 71 | Ga0070663_100141706 | 3300005455 | Bacteria | 1836 |
| 72 | Ga0070663_100362828 | 3300005455 | Bacteria | 1175 |
| 73 | Ga0070678_100045152 | 3300005456 | Bacteria | 3150 |
| 74 | Ga0070678_100061182 | 3300005456 | Bacteria | 2774 |
| 75 | Ga0070678_100103672 | 3300005456 | Bacteria | 2210 |
| 76 | Ga0070678_100206299 | 3300005456 | Bacteria | 1625 |
| 77 | Ga0070678_100243295 | 3300005456 | Bacteria | 1505 |
| 78 | Ga0070678_100293416 | 3300005456 | Bacteria | 1379 |
| 79 | Ga0070678_100505917 | 3300005456 | Bacteria | 1066 |
| 80 | Ga0070662_100092313 | 3300005457 | Bacteria | 2275 |
| 81 | Ga0070662_100212958 | 3300005457 | Bacteria | 1538 |
| 82 | Ga0068867_100039987 | 3300005459 | Bacteria | 3420 |
| 83 | Ga0068867_100042155 | 3300005459 | Bacteria | 3337 |
| 84 | Ga0068867_100051624 | 3300005459 | Bacteria | 3033 |
| 85 | Ga0068867_100152324 | 3300005459 | Bacteria | 1817 |
| 86 | Ga0068867_100464269 | 3300005459 | Bacteria | 1081 |
| 87 | Ga0070706_100259897 | 3300005467 | Bacteria | 1621 |
| 88 | Ga0068853_100066195 | 3300005539 | Bacteria | 3138 |
| 89 | Ga0068853_100296793 | 3300005539 | Bacteria | 1493 |
| 90 | Ga0070672_100000229 | 3300005543 | Bacteria | 31255 |
| 91 | Ga0070672_100007945 | 3300005543 | Bacteria | 7248 |
| 92 | Ga0070672_100033131 | 3300005543 | Bacteria | 3909 |
| 93 | Ga0070672_100077310 | 3300005543 | Bacteria | 2661 |
| 94 | Ga0070672_100083064 | 3300005543 | Bacteria | 2570 |
| 95 | Ga0070672_100123786 | 3300005543 | Bacteria | 2119 |
| 96 | Ga0070672_100127409 | 3300005543 | Bacteria | 2089 |
| 97 | Ga0070672_100178702 | 3300005543 | Bacteria | 1768 |
| 98 | Ga0070672_100461019 | 3300005543 | Bacteria | 1095 |
| 99 | Ga0070695_100006828 | 3300005545 | Bacteria | 6757 |
| 100 | Ga0070696_100470642 | 3300005546 | Bacteria | 995 |
| 101 | Ga0070665_100008299 | 3300005548 | Bacteria | 10502 |
| 102 | Ga0070665_100110937 | 3300005548 | Bacteria | 2745 |
| 103 | Ga0068855_100037002 | 3300005563 | Bacteria | 5807 |
| 104 | Ga0068855_100074829 | 3300005563 | Bacteria | 3933 |
| 105 | Ga0068855_100257578 | 3300005563 | Bacteria | 1944 |
| 106 | Ga0068855_100263794 | 3300005563 | Bacteria | 1918 |
| 107 | Ga0070664_100001095 | 3300005564 | Bacteria | 21389 |
| 108 | Ga0070664_100468852 | 3300005564 | Bacteria | 1158 |
| 109 | Ga0070664_100526544 | 3300005564 | Bacteria | 1091 |
| 110 | Ga0068854_100246202 | 3300005578 | Bacteria | 1425 |
| 111 | Ga0068856_100846951 | 3300005614 | Bacteria | 933 |
| 112 | Ga0068852_100060346 | 3300005616 | Bacteria | 3292 |
| 113 | Ga0068852_100130740 | 3300005616 | Bacteria | 2312 |
| 114 | Ga0068852_100418408 | 3300005616 | Bacteria | 1321 |
| 115 | Ga0068852_100805575 | 3300005616 | Bacteria | 953 |
| 116 | Ga0068859_100016893 | 3300005617 | Bacteria | 7325 |
| 117 | Ga0068859_100193649 | 3300005617 | Bacteria | 2117 |
| 118 | Ga0068864_100001954 | 3300005618 | Bacteria | 16951 |
| 119 | Ga0068864_100003420 | 3300005618 | Bacteria | 13128 |
| 120 | Ga0068864_100084362 | 3300005618 | Bacteria | 2791 |
| 121 | Ga0068864_100085934 | 3300005618 | Bacteria | 2767 |
| 122 | Ga0068864_100095719 | 3300005618 | Bacteria | 2626 |
| 123 | Ga0068864_100266993 | 3300005618 | Bacteria | 1593 |
| 124 | Ga0068861_100184381 | 3300005719 | Bacteria | 1739 |
| 125 | Ga0068851_10089650 | 3300005834 | Bacteria | 1618 |
| 126 | Ga0068870_10024913 | 3300005840 | Bacteria | 2965 |
| 127 | Ga0068863_100002555 | 3300005841 | Bacteria | 18065 |
| 128 | Ga0068863_100343394 | 3300005841 | Bacteria | 1452 |
| 129 | Ga0068863_100389602 | 3300005841 | Bacteria | 1361 |
| 130 | Ga0068863_100802714 | 3300005841 | Bacteria | 939 |
| 131 | Ga0068858_100003018 | 3300005842 | Bacteria | 16882 |
| 132 | Ga0068858_100221385 | 3300005842 | Bacteria | 1792 |
| 133 | Ga0068860_100177313 | 3300005843 | Bacteria | 2059 |
| 134 | Ga0068862_100015164 | 3300005844 | Bacteria | 6400 |
| 135 | Ga0068862_100072879 | 3300005844 | Bacteria | 2967 |
| 136 | Ga0075368_10002096 | 3300006042 | Bacteria | 6443 |
| 137 | Ga0075363_100007907 | 3300006048 | Bacteria | 4923 |
| 138 | Ga0075363_100036439 | 3300006048 | Bacteria | 2580 |
| 139 | Ga0075364_10000064 | 3300006051 | Bacteria | 40534 |
| 140 | Ga0075364_10020412 | 3300006051 | Bacteria | 4166 |
| 141 | Ga0075362_10014630 | 3300006177 | Bacteria | 3171 |
| 142 | Ga0075362_10154514 | 3300006177 | Bacteria | 1102 |
| 143 | Ga0075367_10013598 | 3300006178 | Bacteria | 4381 |
| 144 | Ga0075366_10005804 | 3300006195 | Bacteria | 6704 |
| 145 | Ga0075366_10016366 | 3300006195 | Bacteria | 4262 |
| 146 | Ga0075366_10018370 | 3300006195 | Bacteria | 4036 |
| 147 | Ga0075366_10034296 | 3300006195 | Bacteria | 2988 |
| 148 | Ga0075366_10034591 | 3300006195 | Bacteria | 2976 |
| 149 | Ga0075366_10055744 | 3300006195 | Bacteria | 2347 |
| 150 | Ga0075366_10084801 | 3300006195 | Bacteria | 1894 |
| 151 | Ga0075366_10207229 | 3300006195 | Bacteria | 1193 |
| 152 | Ga0075366_10218308 | 3300006195 | Bacteria | 1161 |
| 153 | Ga0097621_100082815 | 3300006237 | Bacteria | 2672 |
| 154 | Ga0097621_100264535 | 3300006237 | Bacteria | 1510 |
| 155 | Ga0097621_100619378 | 3300006237 | Bacteria | 991 |
| 156 | Ga0075370_10000133 | 3300006353 | Bacteria | 24995 |
| 157 | Ga0075370_10001450 | 3300006353 | Bacteria | 10303 |
| 158 | Ga0075370_10004793 | 3300006353 | Bacteria | 6624 |
| 159 | Ga0075370_10010590 | 3300006353 | Bacteria | 4828 |
| 160 | Ga0075370_10013745 | 3300006353 | Bacteria | 4308 |
| 161 | Ga0075370_10061761 | 3300006353 | Bacteria | 2134 |
| 162 | Ga0075370_10167909 | 3300006353 | Bacteria | 1289 |
| 163 | Ga0068871_100051059 | 3300006358 | Bacteria | 3347 |
| 164 | Ga0068871_100140339 | 3300006358 | Bacteria | 2054 |
| 165 | Ga0068871_100191824 | 3300006358 | Bacteria | 1760 |
| 166 | Ga0075430_100120727 | 3300006846 | Bacteria | 2185 |
| 167 | Ga0075433_10333635 | 3300006852 | Bacteria | 1341 |
| 168 | Ga0075429_100005760 | 3300006880 | Bacteria | 10698 |
| 169 | Ga0068865_100078479 | 3300006881 | Bacteria | 2362 |
| 170 | Ga0068865_100197302 | 3300006881 | Bacteria | 1560 |
| 171 | Ga0097620_100016893 | 3300006931 | Bacteria | 7325 |
| 172 | Ga0097620_100193659 | 3300006931 | Bacteria | 2117 |
| 173 | Ga0079104_1000711 | 3300006946 | Bacteria | 30224 |
| 174 | Ga0105244_10038976 | 3300009036 | Bacteria | 2476 |
| 175 | Ga0105245_10295752 | 3300009098 | Bacteria | 1587 |
| 176 | Ga0105245_10376253 | 3300009098 | Bacteria | 1413 |
| 177 | Ga0114129_10215733 | 3300009147 | Bacteria | 2591 |
| 178 | Ga0105243_10041618 | 3300009148 | Bacteria | 3593 |
| 179 | Ga0105243_10064760 | 3300009148 | Bacteria | 2934 |
| 180 | Ga0105243_10079507 | 3300009148 | Bacteria | 2673 |
| 181 | Ga0105242_10040441 | 3300009176 | Bacteria | 3757 |
| 182 | Ga0105242_10436922 | 3300009176 | Bacteria | 1230 |
| 183 | Ga0105242_10470836 | 3300009176 | Bacteria | 1188 |
| 184 | Ga0105248_10004052 | 3300009177 | Bacteria | 16195 |
| 185 | Ga0105248_10166922 | 3300009177 | Bacteria | 2481 |
| 186 | Ga0105248_10899838 | 3300009177 | Bacteria | 999 |
| 187 | Ga0105248_10979104 | 3300009177 | Bacteria | 955 |
| 188 | Ga0105238_10041318 | 3300009551 | Bacteria | 4670 |
| 189 | Ga0105249_10033740 | 3300009553 | Bacteria | 4635 |
| 190 | Ga0105249_10468261 | 3300009553 | Bacteria | 1301 |
| 191 | Ga0157374_10060726 | 3300013296 | Bacteria | 3538 |
| 192 | Ga0157374_10071555 | 3300013296 | Bacteria | 3270 |
| 193 | Ga0157374_10077294 | 3300013296 | Bacteria | 3150 |
| 194 | Ga0157374_10133827 | 3300013296 | Bacteria | 2401 |
| 195 | Ga0157374_10544521 | 3300013296 | Bacteria | 1168 |
| 196 | Ga0157378_10097588 | 3300013297 | Bacteria | 2678 |
| 197 | Ga0157378_10174826 | 3300013297 | Bacteria | 2016 |
| 198 | Ga0163162_10059242 | 3300013306 | Bacteria | 3861 |
| 199 | Ga0163162_10198545 | 3300013306 | Bacteria | 2134 |
| 200 | Ga0157375_10009144 | 3300013308 | Bacteria | 8683 |
| 201 | Ga0157375_10161725 | 3300013308 | Bacteria | 2381 |
| 202 | Ga0157375_10264666 | 3300013308 | Bacteria | 1881 |
| 203 | Ga0163163_10039345 | 3300014325 | Bacteria | 4615 |
| 204 | Ga0163163_10331363 | 3300014325 | Bacteria | 1577 |
| 205 | Ga0163163_10986658 | 3300014325 | Bacteria | 906 |
| 206 | Ga0157380_10065129 | 3300014326 | Bacteria | 2928 |
| 207 | Ga0182008_10001633 | 3300014497 | Bacteria | 14849 |
| 208 | Ga0157379_10016771 | 3300014968 | Bacteria | 6446 |
| 209 | Ga0157376_10210490 | 3300014969 | Bacteria | 1795 |
| 210 | Ga0182007_10003809 | 3300015262 | Bacteria | 7024 |
| 211 | Ga0163161_10001851 | 3300017792 | Bacteria | 15456 |
| 212 | Ga0163161_10126584 | 3300017792 | Bacteria | 1924 |
| 213 | Ga0163161_10471997 | 3300017792 | Bacteria | 1017 |
| 214 | Ga0213872_10001003 | 3300021361 | Bacteria | 19713 |
| 215 | Ga0213872_10017110 | 3300021361 | Bacteria | 3356 |
| 216 | Ga0213872_10083421 | 3300021361 | Bacteria | 1434 |
| 217 | Ga0209258_100074 | 3300025242 | Bacteria | 271062 |
| 218 | Ga0207425_1000426 | 3300025245 | Bacteria | 28024 |
| 219 | Ga0209759_1000909 | 3300025256 | Bacteria | 21990 |
| 220 | Ga0209129_1000269 | 3300025258 | Bacteria | 51170 |
| 221 | Ga0209455_1000066 | 3300025272 | Bacteria | 316811 |
| 222 | Ga0209455_1000447 | 3300025272 | Bacteria | 31733 |
| 223 | Ga0209673_1002449 | 3300025273 | Bacteria | 12865 |
| 224 | Ga0209673_1006112 | 3300025273 | Bacteria | 5905 |
| 225 | Ga0209676_1006101 | 3300025292 | Bacteria | 6052 |
| 226 | Ga0209025_1000019 | 3300025294 | Bacteria | 631548 |
| 227 | Ga0209564_1000300 | 3300025295 | Bacteria | 98386 |
| 228 | Ga0209758_1000453 | 3300025297 | Bacteria | 68482 |
| 229 | Ga0209758_1000605 | 3300025297 | Bacteria | 55552 |
| 230 | Ga0209050_1000770 | 3300025298 | Bacteria | 46024 |
| 231 | Ga0209050_1003148 | 3300025298 | Bacteria | 12579 |
| 232 | Ga0209050_1009610 | 3300025298 | Bacteria | 4920 |
| 233 | Ga0209256_1000049 | 3300025299 | Bacteria | 310696 |
| 234 | Ga0209051_1000247 | 3300025303 | Bacteria | 91122 |
| 235 | Ga0209051_1003582 | 3300025303 | Bacteria | 10098 |
| 236 | Ga0209051_1010607 | 3300025303 | Bacteria | 4629 |
| 237 | Ga0209051_1014684 | 3300025303 | Bacteria | 3641 |
| 238 | Ga0209051_1034612 | 3300025303 | Bacteria | 1891 |
| 239 | Ga0209257_1000047 | 3300025304 | Bacteria | 460507 |
| 240 | Ga0209257_1000141 | 3300025304 | Bacteria | 201130 |
| 241 | Ga0209257_1008855 | 3300025304 | Bacteria | 5557 |
| 242 | Ga0207697_10020000 | 3300025315 | Bacteria | 2742 |
| 243 | Ga0207656_10053271 | 3300025321 | Bacteria | 1755 |
| 244 | Ga0207656_10054319 | 3300025321 | Bacteria | 1741 |
| 245 | Ga0207682_10001493 | 3300025893 | Bacteria | 10802 |
| 246 | Ga0207682_10018894 | 3300025893 | Bacteria | 2697 |
| 247 | Ga0207682_10026689 | 3300025893 | Bacteria | 2297 |
| 248 | Ga0207642_10185226 | 3300025899 | Bacteria | 1138 |
| 249 | Ga0207645_10018015 | 3300025907 | Bacteria | 4656 |
| 250 | Ga0207645_10045823 | 3300025907 | Bacteria | 2794 |
| 251 | Ga0207645_10147664 | 3300025907 | Bacteria | 1533 |
| 252 | Ga0207643_10013289 | 3300025908 | Bacteria | 4455 |
| 253 | Ga0207705_10195193 | 3300025909 | Bacteria | 1532 |
| 254 | Ga0207684_10401818 | 3300025910 | Bacteria | 1178 |
| 255 | Ga0207662_10042029 | 3300025918 | Bacteria | 2693 |
| 256 | Ga0207657_10082993 | 3300025919 | Bacteria | 2689 |
| 257 | Ga0207649_10000335 | 3300025920 | Bacteria | 35710 |
| 258 | Ga0207649_10360688 | 3300025920 | Bacteria | 1078 |
| 259 | Ga0207681_10031313 | 3300025923 | Bacteria | 3473 |
| 260 | Ga0207681_10149690 | 3300025923 | Bacteria | 1747 |
| 261 | Ga0207681_10527783 | 3300025923 | Bacteria | 969 |
| 262 | Ga0207694_10023193 | 3300025924 | Bacteria | 4712 |
| 263 | Ga0207650_10000230 | 3300025925 | Bacteria | 62576 |
| 264 | Ga0207650_10007627 | 3300025925 | Bacteria | 7370 |
| 265 | Ga0207650_10009807 | 3300025925 | Bacteria | 6548 |
| 266 | Ga0207650_10109025 | 3300025925 | Bacteria | 2141 |
| 267 | Ga0207650_10233462 | 3300025925 | Bacteria | 1484 |
| 268 | Ga0207659_10006351 | 3300025926 | Bacteria | 7237 |
| 269 | Ga0207659_10039115 | 3300025926 | Bacteria | 3304 |
| 270 | Ga0207659_10562769 | 3300025926 | Bacteria | 970 |
| 271 | Ga0207687_10014332 | 3300025927 | Bacteria | 5187 |
| 272 | Ga0207687_10051884 | 3300025927 | Bacteria | 2860 |
| 273 | Ga0207687_10188673 | 3300025927 | Bacteria | 1603 |
| 274 | Ga0207644_10006307 | 3300025931 | Bacteria | 7723 |
| 275 | Ga0207644_10012592 | 3300025931 | Bacteria | 5622 |
| 276 | Ga0207644_10051464 | 3300025931 | Bacteria | 2956 |
| 277 | Ga0207644_10071322 | 3300025931 | Bacteria | 2541 |
| 278 | Ga0207644_10166785 | 3300025931 | Bacteria | 1716 |
| 279 | Ga0207644_10345904 | 3300025931 | Bacteria | 1206 |
| 280 | Ga0207690_10000176 | 3300025932 | Bacteria | 49560 |
| 281 | Ga0207706_10004610 | 3300025933 | Bacteria | 12933 |
| 282 | Ga0207706_10227064 | 3300025933 | Bacteria | 1634 |
| 283 | Ga0207706_10369066 | 3300025933 | Bacteria | 1246 |
| 284 | Ga0207686_10038520 | 3300025934 | Bacteria | 2893 |
| 285 | Ga0207709_10042931 | 3300025935 | Bacteria | 2723 |
| 286 | Ga0207709_10315696 | 3300025935 | Bacteria | 1168 |
| 287 | Ga0207670_10015720 | 3300025936 | Bacteria | 4529 |
| 288 | Ga0207669_10008524 | 3300025937 | Bacteria | 4819 |
| 289 | Ga0207669_10109822 | 3300025937 | Bacteria | 1845 |
| 290 | Ga0207669_10129968 | 3300025937 | Bacteria | 1728 |
| 291 | Ga0207704_10050520 | 3300025938 | Bacteria | 2509 |
| 292 | Ga0207704_10061517 | 3300025938 | Bacteria | 2329 |
| 293 | Ga0207691_10000681 | 3300025940 | Bacteria | 33590 |
| 294 | Ga0207691_10012349 | 3300025940 | Bacteria | 8186 |
| 295 | Ga0207691_10059728 | 3300025940 | Bacteria | 3466 |
| 296 | Ga0207691_10300713 | 3300025940 | Bacteria | 1379 |
| 297 | Ga0207711_10016311 | 3300025941 | Bacteria | 6171 |
| 298 | Ga0207711_10090689 | 3300025941 | Bacteria | 2687 |
| 299 | Ga0207711_10134673 | 3300025941 | Bacteria | 2218 |
| 300 | Ga0207689_10006365 | 3300025942 | Bacteria | 10455 |
| 301 | Ga0207679_10000168 | 3300025945 | Bacteria | 54187 |
| 302 | Ga0207679_10117672 | 3300025945 | Bacteria | 2109 |
| 303 | Ga0207679_10224739 | 3300025945 | Bacteria | 1581 |
| 304 | Ga0207667_10057815 | 3300025949 | Bacteria | 4069 |
| 305 | Ga0207667_10061276 | 3300025949 | Bacteria | 3936 |
| 306 | Ga0207667_10329679 | 3300025949 | Bacteria | 1558 |
| 307 | Ga0207667_10395546 | 3300025949 | Bacteria | 1407 |
| 308 | Ga0207651_10037610 | 3300025960 | Bacteria | 3172 |
| 309 | Ga0207651_10136651 | 3300025960 | Bacteria | 1886 |
| 310 | Ga0207651_10280827 | 3300025960 | Bacteria | 1376 |
| 311 | Ga0207712_10031683 | 3300025961 | Bacteria | 3563 |
| 312 | Ga0207712_10212147 | 3300025961 | Bacteria | 1543 |
| 313 | Ga0207668_10221587 | 3300025972 | Bacteria | 1519 |
| 314 | Ga0207640_10134770 | 3300025981 | Bacteria | 1791 |
| 315 | Ga0207658_10025833 | 3300025986 | Bacteria | 4113 |
| 316 | Ga0207658_10031284 | 3300025986 | Bacteria | 3777 |
| 317 | Ga0207658_10142722 | 3300025986 | Bacteria | 1940 |
| 318 | Ga0207677_10015578 | 3300026023 | Bacteria | 4477 |
| 319 | Ga0207677_10103338 | 3300026023 | Bacteria | 2103 |
| 320 | Ga0207703_10012819 | 3300026035 | Bacteria | 6536 |
| 321 | Ga0207703_10624673 | 3300026035 | Bacteria | 1020 |
| 322 | Ga0207639_10024959 | 3300026041 | Bacteria | 4331 |
| 323 | Ga0207639_10269695 | 3300026041 | Bacteria | 1492 |
| 324 | Ga0207678_10034429 | 3300026067 | Bacteria | 4411 |
| 325 | Ga0207708_10022695 | 3300026075 | Bacteria | 4739 |
| 326 | Ga0207641_10083955 | 3300026088 | Bacteria | 2771 |
| 327 | Ga0207641_10113960 | 3300026088 | Bacteria | 2401 |
| 328 | Ga0207641_10380090 | 3300026088 | Bacteria | 1352 |
| 329 | Ga0207641_10603217 | 3300026088 | Bacteria | 1075 |
| 330 | Ga0207648_10024898 | 3300026089 | Bacteria | 5337 |
| 331 | Ga0207648_10050744 | 3300026089 | Bacteria | 3627 |
| 332 | Ga0207648_10077174 | 3300026089 | Bacteria | 2904 |
| 333 | Ga0207676_10001953 | 3300026095 | Bacteria | 15029 |
| 334 | Ga0207676_10112721 | 3300026095 | Bacteria | 2279 |
| 335 | Ga0207676_10119757 | 3300026095 | Bacteria | 2217 |
| 336 | Ga0207676_10126745 | 3300026095 | Bacteria | 2163 |
| 337 | Ga0207676_10315668 | 3300026095 | Bacteria | 1432 |
| 338 | Ga0207674_10010750 | 3300026116 | Bacteria | 10333 |
| 339 | Ga0207675_100008514 | 3300026118 | Bacteria | 9650 |
| 340 | Ga0207683_10006633 | 3300026121 | Bacteria | 9904 |
| 341 | Ga0207683_10409194 | 3300026121 | Bacteria | 1248 |
| 342 | Ga0207698_10043913 | 3300026142 | Bacteria | 3353 |
| 343 | Ga0207698_10076176 | 3300026142 | Bacteria | 2684 |
| 344 | Ga0207698_10106125 | 3300026142 | Bacteria | 2342 |
| 345 | Ga0207698_10125036 | 3300026142 | Bacteria | 2185 |
| 346 | Ga0207698_10353264 | 3300026142 | Bacteria | 1389 |
| 347 | Ga0207698_10368060 | 3300026142 | Bacteria | 1363 |
| 348 | Ga0209281_1000395 | 3300027111 | Bacteria | 67983 |
| 349 | Ga0209996_1001152 | 3300027395 | Bacteria | 3169 |
| 350 | Ga0209995_1004071 | 3300027471 | Bacteria | 2334 |
| 351 | Ga0209968_1000428 | 3300027526 | Bacteria | 6838 |
| 352 | Ga0209966_1000008 | 3300027695 | Bacteria | 88938 |
| 353 | Ga0209998_10005832 | 3300027717 | Bacteria | 2564 |
| 354 | Ga0209813_10050727 | 3300027866 | Bacteria | 1296 |
| 355 | Ga0209974_10114282 | 3300027876 | Bacteria | 952 |
| 356 | Ga0268266_10656411 | 3300028379 | Bacteria | 1010 |
| 357 | Ga0268266_10769069 | 3300028379 | Bacteria | 930 |
| 358 | Ga0268265_10222213 | 3300028380 | Bacteria | 1653 |
| 359 | Ga0265336_10000024 | 3300028666 | Bacteria | 188787 |
| 360 | Ga0307517_10005635 | 3300028786 | Bacteria | 18785 |
| 361 | Ga0307517_10098192 | 3300028786 | Bacteria | 2332 |
| 362 | Ga0307515_10000011 | 3300028794 | Bacteria | 633903 |
| 363 | Ga0307515_10000084 | 3300028794 | Bacteria | 221434 |
| 364 | Ga0307515_10000382 | 3300028794 | Bacteria | 107907 |
| 365 | Ga0307515_10020861 | 3300028794 | Bacteria | 11649 |
| 366 | Ga0307515_10030153 | 3300028794 | Bacteria | 9126 |
| 367 | Ga0307515_10073520 | 3300028794 | Bacteria | 4593 |
| 368 | Ga0265324_10001883 | 3300029957 | Bacteria | 11301 |
| 369 | Ga0268256_1026036 | 3300030500 | Bacteria | 1477 |
| 370 | Ga0307511_10155354 | 3300030521 | Bacteria | 1300 |
| 371 | Ga0307512_10209709 | 3300030522 | Bacteria | 1038 |
| 372 | Ga0265332_10082005 | 3300031238 | Bacteria | 1368 |
| 373 | Ga0265328_10000252 | 3300031239 | Bacteria | 24700 |
| 374 | Ga0265329_10026703 | 3300031242 | Bacteria | 1901 |
| 375 | Ga0265331_10000050 | 3300031250 | Bacteria | 181286 |
| 376 | Ga0265327_10000109 | 3300031251 | Bacteria | 181275 |
| 377 | Ga0265327_10000789 | 3300031251 | Bacteria | 48791 |
| 378 | Ga0265327_10019962 | 3300031251 | Bacteria | 4101 |
| 379 | Ga0307513_10002473 | 3300031456 | Bacteria | 25565 |
| 380 | Ga0307513_10026225 | 3300031456 | Bacteria | 6725 |
| 381 | Ga0307513_10071479 | 3300031456 | Bacteria | 3621 |
| 382 | Ga0307509_10000063 | 3300031507 | Bacteria | 143708 |
| 383 | Ga0307509_10040214 | 3300031507 | Bacteria | 5086 |
| 384 | Ga0307509_10177792 | 3300031507 | Bacteria | 1998 |
| 385 | Ga0307408_100000029 | 3300031548 | Bacteria | 227806 |
| 386 | Ga0307408_100226249 | 3300031548 | Bacteria | 1529 |
| 387 | Ga0307508_10000109 | 3300031616 | Bacteria | 97316 |
| 388 | Ga0307508_10005254 | 3300031616 | Bacteria | 12357 |
| 389 | Ga0307508_10201116 | 3300031616 | Bacteria | 1593 |
| 390 | Ga0307514_10000954 | 3300031649 | Bacteria | 43472 |
| 391 | Ga0307514_10010207 | 3300031649 | Bacteria | 7861 |
| 392 | Ga0307514_10029981 | 3300031649 | Bacteria | 4369 |
| 393 | Ga0307514_10077236 | 3300031649 | Bacteria | 2477 |
| 394 | Ga0265314_10017068 | 3300031711 | Bacteria | 5707 |
| 395 | Ga0307516_10000676 | 3300031730 | Bacteria | 46208 |
| 396 | Ga0307516_10001245 | 3300031730 | Bacteria | 35441 |
| 397 | Ga0307516_10031563 | 3300031730 | Bacteria | 5340 |
| 398 | Ga0307516_10095680 | 3300031730 | Bacteria | 2792 |
| 399 | Ga0307516_10179339 | 3300031730 | Bacteria | 1853 |
| 400 | Ga0307413_10083624 | 3300031824 | Bacteria | 2054 |
| 401 | Ga0307410_10022243 | 3300031852 | Bacteria | 3915 |
| 402 | Ga0307406_10007608 | 3300031901 | Bacteria | 6016 |
| 403 | Ga0307406_10183872 | 3300031901 | Bacteria | 1524 |
| 404 | Ga0307412_10000061 | 3300031911 | Bacteria | 126274 |
| 405 | Ga0307412_10036594 | 3300031911 | Bacteria | 3146 |
| 406 | Ga0307412_10239149 | 3300031911 | Bacteria | 1403 |
| 407 | Ga0307412_10551713 | 3300031911 | Bacteria | 968 |
| 408 | Ga0307416_100059775 | 3300032002 | Bacteria | 3099 |
| 409 | Ga0307416_100537383 | 3300032002 | Bacteria | 1240 |
| 410 | Ga0307411_10144890 | 3300032005 | Bacteria | 1757 |
| 411 | Ga0307415_100112331 | 3300032126 | Bacteria | 2024 |
| 412 | Ga0307507_10209700 | 3300033179 | Bacteria | 1331 |
| 413 | Ga0307510_10004418 | 3300033180 | Bacteria | 16555 |
| 414 | Ga0307510_10017213 | 3300033180 | Bacteria | 8527 |
| 415 | Ga0373940_0016864 | 3300035088 | Bacteria | 1814 |
| 416 | Ga0373939_0000012 | 3300035114 | Bacteria | 67223 |
| 417 | Ga0373960_0000218 | 3300035121 | Bacteria | 10541 |
| 418 | Ga0373961_0004072 | 3300035241 | Bacteria | 3559 |
| 419 | Ga0373931_0002689 | 3300035691 | Bacteria | 7910 |
| 420 | Ga0373935_0492792 | 3300035692 | Bacteria | 889 |
| 421 | Ga0373937_0630638 | 3300036401 | Bacteria | 1017 |
| 422 | Ga0373925_0155437 | 3300037068 | Bacteria | 1798 |
| 423 | Ga0395900_0000183 | 3300037418 | Bacteria | 100749 |
| 424 | Ga0395900_0027656 | 3300037418 | Bacteria | 5809 |
| 425 | Ga0395900_0079101 | 3300037418 | Bacteria | 3378 |
| 426 | Ga0395898_0001293 | 3300037466 | Bacteria | 36684 |
| 427 | Ga0395898_0112304 | 3300037466 | Bacteria | 2612 |
| 428 | Ga0395898_0152268 | 3300037466 | Bacteria | 2212 |
| 429 | Ga0395905_0000027 | 3300037471 | Bacteria | 297239 |
| 430 | Ga0395905_0002201 | 3300037471 | Bacteria | 22018 |
| 431 | Ga0395905_0027641 | 3300037471 | Bacteria | 5350 |
| 432 | Ga0395905_0074018 | 3300037471 | Bacteria | 3192 |
| 433 | Ga0395905_0250170 | 3300037471 | Bacteria | 1655 |
| 434 | Ga0395905_0458190 | 3300037471 | Bacteria | 1173 |
| 435 | Ga0436361_0039667 | 3300039447 | Bacteria | 5314 |
| 436 | Ga0436361_0110525 | 3300039447 | Bacteria | 45343 |
| 437 | Ga0439436_0001048 | 3300041404 | Bacteria | 7765 |
| 438 | Ga0439447_023051 | 3300041407 | Bacteria | 1625 |
| 439 | Ga0439466_0004086 | 3300041411 | Bacteria | 5638 |
| 440 | Ga0439465_0040301 | 3300041413 | Bacteria | 1509 |
| 441 | Ga0451793_0140833 | 3300041452 | Bacteria | 1415 |
| 442 | Ga0451800_1581513 | 3300041459 | Bacteria | 2092 |
| 443 | Ga0439431_0000483 | 3300041997 | Bacteria | 8459 |
| 444 | Ga0439431_0005469 | 3300041997 | Bacteria | 2805 |
| 445 | Ga0439433_0002772 | 3300041999 | Bacteria | 3733 |
| 446 | Ga0439442_024130 | 3300042002 | Bacteria | 1264 |
| 447 | Ga0439445_0059399 | 3300042004 | Bacteria | 1043 |
| 448 | Ga0439448_0022644 | 3300042005 | Bacteria | 1955 |
| 449 | Ga0439432_001040 | 3300042006 | Bacteria | 10528 |
| 450 | Ga0439449_0001389 | 3300042007 | Bacteria | 9472 |
| 451 | Ga0439449_0032823 | 3300042007 | Bacteria | 1934 |
| 452 | Ga0450888_001081 | 3300042126 | Bacteria | 2579 |
| 453 | Ga0450891_002454 | 3300042129 | Bacteria | 1867 |
| 454 | Ga0450892_003377 | 3300042130 | Bacteria | 1311 |
| 455 | Ga0450889_002584 | 3300042144 | Bacteria | 1796 |
| 456 | Ga0439434_0024175 | 3300042435 | Bacteria | 1832 |
| 457 | Ga0450893_0032148 | 3300042532 | Bacteria | 939 |
| 458 | Ga0451577_0000270 | 3300042876 | Bacteria | 101581 |
| 459 | Ga0451577_0003233 | 3300042876 | Bacteria | 18316 |
| 460 | Ga0451577_0008906 | 3300042876 | Bacteria | 9714 |
| 461 | Ga0451577_0076840 | 3300042876 | Bacteria | 2977 |
| 462 | Ga0451577_0394457 | 3300042876 | Bacteria | 1256 |
| 463 | Ga0466969_0000020 | 3300044656 | Bacteria | 101861 |
| 464 | Ga0466969_0189657 | 3300044656 | Bacteria | 939 |
| 465 | Ga0466965_0043431 | 3300044683 | Bacteria | 2219 |
| 466 | Ga0466965_0145957 | 3300044683 | Bacteria | 1234 |
| 467 | Ga0466966_0007572 | 3300044684 | Bacteria | 7193 |
| 468 | Ga0466966_0013049 | 3300044684 | Bacteria | 5500 |
| 469 | Ga0466966_0145052 | 3300044684 | Bacteria | 1449 |
| 470 | Ga0466961_0027938 | 3300044693 | Bacteria | 3627 |
| 471 | Ga0466961_0029661 | 3300044693 | Bacteria | 3514 |
| 472 | Ga0466963_0301687 | 3300044694 | Bacteria | 1126 |
| 473 | Ga0466964_0021846 | 3300044706 | Bacteria | 2477 |
| 474 | Ga0453684_0000868 | 3300044712 | Bacteria | 101512 |
| 475 | Ga0453684_0018604 | 3300044712 | Bacteria | 10651 |
| 476 | Ga0453684_0133946 | 3300044712 | Bacteria | 2970 |
| 477 | Ga0453684_0214160 | 3300044712 | Bacteria | 2237 |
| 478 | Ga0453684_0366101 | 3300044712 | Bacteria | 1622 |
| 479 | Ga0466968_0006113 | 3300044735 | Bacteria | 4523 |
| 480 | Ga0466970_0030545 | 3300044765 | Bacteria | 2841 |
| 481 | Ga0466970_0031448 | 3300044765 | Bacteria | 2803 |
| 482 | Ga0466957_0142010 | 3300044842 | Bacteria | 1547 |
| 483 | Ga0466960_0012273 | 3300044901 | Bacteria | 3611 |
| 484 | Ga0466960_0078188 | 3300044901 | Bacteria | 1660 |
| 485 | Ga0466959_0000210 | 3300045049 | Bacteria | 37745 |
| 486 | Ga0466959_0068705 | 3300045049 | Bacteria | 2567 |
| 487 | Ga0466959_0163203 | 3300045049 | Bacteria | 1565 |
| 488 | Ga0451576_0004748 | 3300045051 | Bacteria | 17449 |
| 489 | Ga0451576_0047445 | 3300045051 | Bacteria | 4516 |
| 490 | Ga0451576_0100852 | 3300045051 | Bacteria | 3002 |
| 491 | Ga0451576_0240622 | 3300045051 | Bacteria | 1891 |
| 492 | Ga0451576_0877205 | 3300045051 | Bacteria | 942 |
| 493 | Ga0495592_0006972 | 3300046454 | Bacteria | 8442 |
| 494 | Ga0495590_0042912 | 3300046457 | Bacteria | 1577 |
| 495 | Ga0495650_0024628 | 3300046471 | Bacteria | 2839 |
| 496 | Ga0495639_0023242 | 3300046475 | Bacteria | 2723 |
| 497 | Ga0495583_0000034 | 3300046506 | Bacteria | 246856 |
| 498 | Ga0495606_0001225 | 3300046507 | Bacteria | 35933 |
| 499 | Ga0495606_0121912 | 3300046507 | Bacteria | 1560 |
| 500 | Ga0495630_0364834 | 3300046517 | Bacteria | 1106 |
| 501 | Ga0495621_0013028 | 3300046539 | Bacteria | 2606 |
| 502 | Ga0495645_0073438 | 3300046543 | Bacteria | 2464 |
| 503 | Ga0495645_0133854 | 3300046543 | Bacteria | 1735 |
| 504 | Ga0495625_0004651 | 3300046660 | Bacteria | 12890 |
| 505 | Ga0495625_0015665 | 3300046660 | Bacteria | 5995 |
| 506 | Ga0495635_0348180 | 3300046663 | Bacteria | 989 |
| 507 | Ga0495588_0280673 | 3300046674 | Bacteria | 878 |
| 508 | Ga0495646_0047667 | 3300046680 | Bacteria | 2607 |
| 509 | Ga0495658_0075719 | 3300046683 | Bacteria | 1965 |
| 510 | Ga0495669_0022325 | 3300046684 | Bacteria | 2749 |
| 511 | Ga0495624_0036674 | 3300046690 | Bacteria | 3159 |
| 512 | Ga0495649_0000428 | 3300046694 | Bacteria | 36408 |
| 513 | Ga0495589_0002853 | 3300046794 | Bacteria | 9567 |
| 514 | Ga0495674_0290321 | 3300047319 | Bacteria | 1338 |
| 515 | Ga0495676_0007213 | 3300047321 | Bacteria | 10196 |
| 516 | Ga0495686_0023580 | 3300047472 | Bacteria | 4057 |
| 517 | Ga0496100_0009165 | 3300048903 | Bacteria | 5553 |
| 518 | Ga0496101_0004382 | 3300048904 | Bacteria | 8872 |
| 519 | Ga0496102_0006127 | 3300048905 | Bacteria | 10246 |
| 520 | Ga0496104_0269833 | 3300048907 | Bacteria | 1614 |
| 521 | Ga0496106_0007087 | 3300048909 | Bacteria | 8285 |
| 522 | Ga0496108_0036590 | 3300048911 | Bacteria | 4085 |
| 523 | Ga0496108_0125637 | 3300048911 | Bacteria | 2202 |
| 524 | Ga0496108_0317044 | 3300048911 | Bacteria | 1359 |
| 525 | Ga0496109_0009016 | 3300048912 | Bacteria | 8498 |
| 526 | Ga0496110_0057567 | 3300048913 | Bacteria | 3422 |
| 527 | Ga0496111_0071605 | 3300048914 | Bacteria | 2523 |
| 528 | Ga0496112_0004885 | 3300048915 | Bacteria | 11462 |
| 529 | Ga0496114_0194525 | 3300048917 | Bacteria | 1775 |
| 530 | Ga0496116_0022632 | 3300048919 | Bacteria | 4704 |
| 531 | Ga0496116_0024092 | 3300048919 | Bacteria | 4510 |
| 532 | Ga0496117_0009792 | 3300048920 | Bacteria | 8836 |
| 533 | Ga0496117_0069549 | 3300048920 | Bacteria | 2370 |
| 534 | Ga0496118_0011294 | 3300048921 | Bacteria | 8735 |
| 535 | Ga0496118_0018649 | 3300048921 | Bacteria | 6241 |
| 536 | Ga0496119_0028700 | 3300048922 | Bacteria | 3790 |
| 537 | Ga0496120_0004304 | 3300048923 | Bacteria | 12065 |
| 538 | Ga0496121_0000647 | 3300048924 | Bacteria | 65033 |
| 539 | Ga0496121_0010291 | 3300048924 | Bacteria | 10581 |
| 540 | Ga0496122_0000612 | 3300048925 | Bacteria | 73307 |
| 541 | Ga0496122_0003062 | 3300048925 | Bacteria | 22564 |
| 542 | Ga0496122_0022055 | 3300048925 | Bacteria | 5673 |
| 543 | Ga0496123_0000274 | 3300048926 | Bacteria | 101783 |
| 544 | Ga0496123_0002506 | 3300048926 | Bacteria | 22588 |
| 545 | Ga0496124_0000013 | 3300048927 | Bacteria | 484884 |
| 546 | Ga0496124_0000108 | 3300048927 | Bacteria | 167473 |
| 547 | Ga0496124_0048778 | 3300048927 | Bacteria | 3615 |
| 548 | Ga0496124_0196702 | 3300048927 | Bacteria | 1537 |
| 549 | Ga0496125_0000051 | 3300048928 | Bacteria | 285754 |
| 550 | Ga0496125_0004939 | 3300048928 | Bacteria | 15088 |
| 551 | Ga0496125_0014355 | 3300048928 | Bacteria | 7717 |
| 552 | Ga0496125_0272563 | 3300048928 | Bacteria | 1053 |
| 553 | Ga0496126_0008185 | 3300048929 | Bacteria | 11309 |
| 554 | Ga0496126_0015870 | 3300048929 | Bacteria | 7563 |
| 555 | Ga0501297_006242 | 3300049520 | Bacteria | 1268 |
| 556 | Ga0501300_001506 | 3300049523 | Bacteria | 3498 |
| 557 | Ga0501301_002968 | 3300049524 | Bacteria | 1148 |
| 558 | Ga0501031_0055745 | 3300049568 | Bacteria | 2575 |
| 559 | Ga0501032_0010987 | 3300049569 | Bacteria | 6509 |
| 560 | Ga0501033_0000668 | 3300049570 | Bacteria | 31668 |
| 561 | Ga0501033_0069374 | 3300049570 | Bacteria | 2591 |
| 562 | Ga0501033_0098599 | 3300049570 | Bacteria | 2134 |
| 563 | Ga0501033_0111228 | 3300049570 | Bacteria | 1993 |
| 564 | Ga0501034_0005349 | 3300049571 | Bacteria | 14062 |
| 565 | Ga0501034_0061854 | 3300049571 | Bacteria | 3759 |
| 566 | Ga0501036_0001501 | 3300049572 | Bacteria | 17997 |
| 567 | Ga0501037_0004363 | 3300049573 | Bacteria | 10269 |
| 568 | Ga0501037_0192545 | 3300049573 | Bacteria | 1443 |
| 569 | Ga0501038_0058343 | 3300049574 | Bacteria | 3309 |
| 570 | Ga0501038_0114468 | 3300049574 | Bacteria | 2231 |
| 571 | Ga0501043_0000002 | 3300049579 | Bacteria | 351081 |
| 572 | Ga0501046_0000008 | 3300049580 | Bacteria | 351167 |
| 573 | Ga0501046_0001989 | 3300049580 | Bacteria | 19418 |
| 574 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 575 | Ga0501047_0018975 | 3300049581 | Bacteria | 6596 |
| 576 | Ga0501047_0076103 | 3300049581 | Bacteria | 3230 |
| 577 | Ga0501048_0001479 | 3300049582 | Bacteria | 17811 |
| 578 | Ga0501048_0106826 | 3300049582 | Bacteria | 1976 |
| 579 | Ga0501198_000024 | 3300049649 | Bacteria | 67171 |
| 580 | Ga0501211_000808 | 3300049658 | Bacteria | 3239 |
| 581 | Ga0501222_000020 | 3300049662 | Bacteria | 67164 |
| 582 | Ga0501222_001766 | 3300049662 | Bacteria | 2997 |
| 583 | Ga0501223_024329 | 3300049663 | Bacteria | 1179 |
| 584 | Ga0501242_010433 | 3300049674 | Bacteria | 1109 |
| 585 | Ga0501221_002605 | 3300049704 | Bacteria | 2974 |
| 586 | Ga0501229_000206 | 3300049706 | Bacteria | 6441 |
| 587 | Ga0501080_0053880 | 3300049742 | Bacteria | 3746 |
| 588 | Ga0501232_000662 | 3300049757 | Bacteria | 2413 |
| 589 | Ga0501262_005503 | 3300049759 | Bacteria | 1495 |
| 590 | Ga0501267_002247 | 3300049764 | Bacteria | 1719 |
| 591 | Ga0501269_001983 | 3300049766 | Bacteria | 2581 |
| 592 | Ga0501274_003754 | 3300049771 | Bacteria | 1235 |
| 593 | Ga0501283_003257 | 3300049779 | Bacteria | 2141 |
| 594 | Ga0501035_0006298 | 3300049822 | Bacteria | 11155 |
| 595 | Ga0501035_0026335 | 3300049822 | Bacteria | 5321 |
| 596 | Ga0501035_0141426 | 3300049822 | Bacteria | 2092 |
| 597 | Ga0501035_0325646 | 3300049822 | Bacteria | 1290 |
| 598 | Ga0501044_0000316 | 3300049823 | Bacteria | 61151 |
| 599 | Ga0501044_0004069 | 3300049823 | Bacteria | 16400 |
| 600 | Ga0501044_0038183 | 3300049823 | Bacteria | 5016 |
| 601 | Ga0501044_0089818 | 3300049823 | Bacteria | 3100 |
| 602 | Ga0501044_0227929 | 3300049823 | Bacteria | 1812 |
| 603 | Ga0501045_0003417 | 3300049824 | Bacteria | 10864 |
| 604 | nmdc:mga03683_68446_c1 | 3300050489 | Bacteria | 1513 |
| 605 | nmdc:mga00v17_18021_c1 | 3300050491 | Bacteria | 4007 |
| 606 | nmdc:mga00v17_29017_c1 | 3300050491 | Bacteria | 3244 |
| 607 | nmdc:mga00v17_69137_c1 | 3300050491 | Bacteria | 2185 |
| 608 | nmdc:mga0k408_20607_c1 | 3300050493 | Bacteria | 3696 |
| 609 | nmdc:mga0k408_22368_c1 | 3300050493 | Bacteria | 3560 |
| 610 | nmdc:mga0k408_26608_c1 | 3300050493 | Bacteria | 3281 |
| 611 | nmdc:mga0k408_31894_c1 | 3300050493 | Bacteria | 3011 |
| 612 | nmdc:mga0k408_6011_c1 | 3300050493 | Bacteria | 6476 |
| 613 | nmdc:mga0k408_64479_c1 | 3300050493 | Bacteria | 2132 |
| 614 | nmdc:mga07m45_154696_c1 | 3300050496 | Bacteria | 1330 |
| 615 | nmdc:mga07m45_2735_c1 | 3300050496 | Bacteria | 8313 |
| 616 | nmdc:mga07m45_4966_c2 | 3300050496 | Bacteria | 6170 |
| 617 | nmdc:mga07m45_5336_c1 | 3300050496 | Bacteria | 6395 |
| 618 | nmdc:mga07m45_5339_c1 | 3300050496 | Bacteria | 6394 |
| 619 | nmdc:mga07m45_69460_c1 | 3300050496 | Bacteria | 2003 |
| 620 | nmdc:mga07m45_847_c1 | 3300050496 | Bacteria | 13276 |
| 621 | nmdc:mga05p37_29102_c1 | 3300050507 | Bacteria | 6742 |
| 622 | nmdc:mga09592_1310_c1 | 3300050508 | Bacteria | 19982 |
| 623 | nmdc:mga0qj67_19500_c1 | 3300050509 | Bacteria | 5181 |
| 624 | nmdc:mga08y16_608942_c1 | 3300050511 | Bacteria | 1100 |
| 625 | nmdc:mga0n895_80145_c1 | 3300050512 | Bacteria | 3252 |
| 626 | nmdc:mga0a205_25032_c1 | 3300050515 | Bacteria | 5682 |
| 627 | Ga0495601_0032309 | 3300053077 | Bacteria | 3258 |
| 628 | Ga0500635_0000008 | 3300053080 | Bacteria | 167327 |
| 629 | Ga0500578_0110065 | 3300053086 | Bacteria | 1737 |
| 630 | Ga0500644_0003424 | 3300053088 | Bacteria | 3925 |
| 631 | Ga0500651_0080058 | 3300053093 | Bacteria | 2023 |
| 632 | Ga0500651_0135077 | 3300053093 | Bacteria | 1490 |
| 633 | Ga0500652_000177 | 3300053131 | Bacteria | 24784 |
| 634 | Ga0500559_0000013 | 3300053136 | Bacteria | 163436 |
| 635 | Ga0500559_0004164 | 3300053136 | Bacteria | 6938 |
| 636 | Ga0500561_0009960 | 3300053137 | Bacteria | 1948 |
| 637 | Ga0500590_077134 | 3300053148 | Bacteria | 1644 |
| 638 | Ga0500600_0009254 | 3300053149 | Bacteria | 5942 |
| 639 | Ga0500622_0004247 | 3300053156 | Bacteria | 9113 |
| 640 | Ga0500622_0019490 | 3300053156 | Bacteria | 3602 |
| 641 | Ga0500622_0100443 | 3300053156 | Bacteria | 1425 |
| 642 | Ga0500570_103326 | 3300053724 | Bacteria | 1188 |
| 643 | Ga0500587_005845 | 3300053739 | Bacteria | 1645 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044683 | Ga0466965_0145957 | Ga0466965_0145957_120_902 | 228 |
| 2 | 3300044901 | Ga0466960_0012273 | Ga0466960_0012273_2418_3200 | 228 |
| 3 | 3300005616 | Ga0068852_100060346 | Ga0068852_1000603464 | 229 |
| 4 | 3300026142 | Ga0207698_10043913 | Ga0207698_100439134 | 229 |
| 5 | 3300005329 | Ga0070683_100460717 | Ga0070683_1004607171 | 230 |
| 6 | 3300005334 | Ga0068869_100190965 | Ga0068869_1001909652 | 230 |
| 7 | 3300005563 | Ga0068855_100037002 | Ga0068855_1000370026 | 230 |
| 8 | 3300005564 | Ga0070664_100526544 | Ga0070664_1005265441 | 230 |
| 9 | 3300005841 | Ga0068863_100389602 | Ga0068863_1003896023 | 230 |
| 10 | 3300006358 | Ga0068871_100140339 | Ga0068871_1001403393 | 230 |
| 11 | 3300013296 | Ga0157374_10133827 | Ga0157374_101338272 | 230 |
| 12 | 3300025933 | Ga0207706_10004610 | Ga0207706_100046105 | 230 |
| 13 | 3300025942 | Ga0207689_10006365 | Ga0207689_100063659 | 230 |
| 14 | 3300025945 | Ga0207679_10224739 | Ga0207679_102247391 | 230 |
| 15 | 3300025949 | Ga0207667_10395546 | Ga0207667_103955461 | 230 |
| 16 | 3300048911 | Ga0496108_0125637 | Ga0496108_0125637_635_1435 | 230 |
| 17 | 3300006846 | Ga0075430_100120727 | Ga0075430_1001207273 | 231 |
| 18 | 3300006880 | Ga0075429_100005760 | Ga0075429_1000057604 | 231 |
| 19 | 3300037471 | Ga0395905_0027641 | Ga0395905_0027641_1840_2619 | 231 |
| 20 | 3300050508 | nmdc:mga09592_1310_c1 | nmdc:mga09592_1310_c1_7691_8473 | 231 |
| 21 | 3300050509 | nmdc:mga0qj67_19500_c1 | nmdc:mga0qj67_19500_c1_3125_3907 | 231 |
| 22 | 3300005617 | Ga0068859_100193649 | Ga0068859_1001936492 | 233 |
| 23 | 3300006177 | Ga0075362_10014630 | Ga0075362_100146303 | 233 |
| 24 | 3300006195 | Ga0075366_10207229 | Ga0075366_102072292 | 233 |
| 25 | 3300006353 | Ga0075370_10004793 | Ga0075370_100047937 | 233 |
| 26 | 3300006931 | Ga0097620_100193659 | Ga0097620_1001936592 | 233 |
| 27 | 3300009147 | Ga0114129_10215733 | Ga0114129_102157332 | 233 |
| 28 | 3300050496 | nmdc:mga07m45_154696_c1 | nmdc:mga07m45_154696_c1_503_1297 | 233 |
| 29 | 3300050507 | nmdc:mga05p37_29102_c1 | nmdc:mga05p37_29102_c1_3792_4571 | 233 |
| 30 | 3300003791 | Ga0055530_10004453 | Ga0055530_100044533 | 234 |
| 31 | 3300003792 | Ga0055540_1000260 | Ga0055540_100026039 | 234 |
| 32 | 3300003794 | Ga0055531_10011138 | Ga0055531_100111383 | 234 |
| 33 | 3300025298 | Ga0209050_1009610 | Ga0209050_10096103 | 234 |
| 34 | 3300025303 | Ga0209051_1000247 | Ga0209051_100024739 | 234 |
| 35 | 3300025304 | Ga0209257_1000141 | Ga0209257_100014139 | 234 |
| 36 | 3300003775 | Ga0055524_1000247 | Ga0055524_100024715 | 235 |
| 37 | 3300006946 | Ga0079104_1000711 | Ga0079104_100071113 | 235 |
| 38 | 3300025299 | Ga0209256_1000049 | Ga0209256_100004959 | 235 |
| 39 | 3300027111 | Ga0209281_1000395 | Ga0209281_100039556 | 235 |
| 40 | 3300046539 | Ga0495621_0013028 | Ga0495621_0013028_219_965 | 235 |
| 41 | 3300005455 | Ga0070663_100000113 | Ga0070663_1000001139 | 236 |
| 42 | 3300009551 | Ga0105238_10041318 | Ga0105238_100413186 | 236 |
| 43 | 3300025924 | Ga0207694_10023193 | Ga0207694_100231931 | 236 |
| 44 | 3300005353 | Ga0070669_100025458 | Ga0070669_1000254583 | 239 |
| 45 | 3300005543 | Ga0070672_100123786 | Ga0070672_1001237863 | 239 |
| 46 | 3300025923 | Ga0207681_10527783 | Ga0207681_105277831 | 239 |
| 47 | 3300025925 | Ga0207650_10233462 | Ga0207650_102334622 | 239 |
| 48 | 3300025933 | Ga0207706_10369066 | Ga0207706_103690661 | 239 |
| 49 | 3300025960 | Ga0207651_10280827 | Ga0207651_102808273 | 239 |
| 50 | 3300021361 | Ga0213872_10083421 | Ga0213872_100834212 | 240 |
| 51 | 3300046506 | Ga0495583_0000034 | Ga0495583_0000034_15624_16397 | 242 |
| 52 | 3300046507 | Ga0495606_0001225 | Ga0495606_0001225_30972_31745 | 242 |
| 53 | 3300046684 | Ga0495669_0022325 | Ga0495669_0022325_843_1616 | 242 |
| 54 | 3300046694 | Ga0495649_0000428 | Ga0495649_0000428_9066_9839 | 242 |
| 55 | 3300046794 | Ga0495589_0002853 | Ga0495589_0002853_686_1459 | 242 |
| 56 | 3300037471 | Ga0395905_0250170 | Ga0395905_0250170_558_1352 | 243 |
| 57 | 3300046674 | Ga0495588_0280673 | Ga0495588_0280673_129_863 | 244 |
| 58 | 3300005539 | Ga0068853_100066195 | Ga0068853_1000661953 | 246 |
| 59 | 3300005563 | Ga0068855_100263794 | Ga0068855_1002637942 | 246 |
| 60 | 3300025949 | Ga0207667_10329679 | Ga0207667_103296791 | 246 |
| 61 | 3300026041 | Ga0207639_10024959 | Ga0207639_100249594 | 246 |
| 62 | 3300037418 | Ga0395900_0079101 | Ga0395900_0079101_361_1152 | 246 |
| 63 | 3300037466 | Ga0395898_0112304 | Ga0395898_0112304_289_1080 | 246 |
| 64 | iso_pu_bacteria | 2643221544 | 2643743617 | 247 |
| 65 | iso_pu_bacteria | 2643221585 | 2643936616 | 247 |
| 66 | iso_pu_bacteria | 2643221639 | 2644222503 | 247 |
| 67 | iso_pu_bacteria | 2643221646 | 2644256651 | 247 |
| 68 | iso_pu_bacteria | 2643221656 | 2644317972 | 247 |
| 69 | iso_pu_bacteria | 2643221660 | 2644341115 | 247 |
| 70 | iso_pu_bacteria | 2895511927 | 2895517803 | 247 |
| 71 | iso_pu_bacteria | 2904479285 | 2904481547 | 247 |
| 72 | 3300042005 | Ga0439448_0022644 | Ga0439448_0022644_365_1117 | 248 |
| 73 | 3300045051 | Ga0451576_0240622 | Ga0451576_0240622_547_1317 | 249 |
| 74 | 3300005841 | Ga0068863_100802714 | Ga0068863_1008027141 | 250 |
| 75 | 3300003794 | Ga0055531_10000105 | Ga0055531_100001059 | 251 |
| 76 | 3300005444 | Ga0070694_100022166 | Ga0070694_1000221664 | 251 |
| 77 | 3300005457 | Ga0070662_100212958 | Ga0070662_1002129581 | 251 |
| 78 | 3300005545 | Ga0070695_100006828 | Ga0070695_1000068282 | 251 |
| 79 | 3300005546 | Ga0070696_100470642 | Ga0070696_1004706421 | 251 |
| 80 | 3300005616 | Ga0068852_100805575 | Ga0068852_1008055752 | 251 |
| 81 | 3300006177 | Ga0075362_10154514 | Ga0075362_101545142 | 251 |
| 82 | 3300006195 | Ga0075366_10218308 | Ga0075366_102183081 | 251 |
| 83 | 3300006852 | Ga0075433_10333635 | Ga0075433_103336352 | 251 |
| 84 | 3300021361 | Ga0213872_10001003 | Ga0213872_100010036 | 251 |
| 85 | 3300025298 | Ga0209050_1003148 | Ga0209050_100314813 | 251 |
| 86 | 3300025303 | Ga0209051_1003582 | Ga0209051_10035829 | 251 |
| 87 | 3300025304 | Ga0209257_1000047 | Ga0209257_1000047225 | 251 |
| 88 | 3300025304 | Ga0209257_1008855 | Ga0209257_10088556 | 251 |
| 89 | 3300025938 | Ga0207704_10050520 | Ga0207704_100505201 | 251 |
| 90 | 3300026142 | Ga0207698_10353264 | Ga0207698_103532642 | 251 |
| 91 | 3300027395 | Ga0209996_1001152 | Ga0209996_10011522 | 251 |
| 92 | 3300027471 | Ga0209995_1004071 | Ga0209995_10040713 | 251 |
| 93 | 3300027526 | Ga0209968_1000428 | Ga0209968_10004283 | 251 |
| 94 | 3300027695 | Ga0209966_1000008 | Ga0209966_100000841 | 251 |
| 95 | 3300027717 | Ga0209998_10005832 | Ga0209998_100058323 | 251 |
| 96 | 3300027876 | Ga0209974_10114282 | Ga0209974_101142821 | 251 |
| 97 | 3300028794 | Ga0307515_10000011 | Ga0307515_10000011158 | 251 |
| 98 | 3300028794 | Ga0307515_10000084 | Ga0307515_10000084179 | 251 |
| 99 | 3300028794 | Ga0307515_10020861 | Ga0307515_100208613 | 251 |
| 100 | 3300028794 | Ga0307515_10073520 | Ga0307515_100735205 | 251 |
| 101 | 3300030522 | Ga0307512_10209709 | Ga0307512_102097092 | 251 |
| 102 | 3300031238 | Ga0265332_10082005 | Ga0265332_100820052 | 251 |
| 103 | 3300031239 | Ga0265328_10000252 | Ga0265328_100002529 | 251 |
| 104 | 3300031242 | Ga0265329_10026703 | Ga0265329_100267032 | 251 |
| 105 | 3300031250 | Ga0265331_10000050 | Ga0265331_10000050184 | 251 |
| 106 | 3300031251 | Ga0265327_10000109 | Ga0265327_1000010941 | 251 |
| 107 | 3300031456 | Ga0307513_10002473 | Ga0307513_1000247327 | 251 |
| 108 | 3300031456 | Ga0307513_10026225 | Ga0307513_100262257 | 251 |
| 109 | 3300031548 | Ga0307408_100000029 | Ga0307408_100000029141 | 251 |
| 110 | 3300031649 | Ga0307514_10000954 | Ga0307514_1000095427 | 251 |
| 111 | 3300031649 | Ga0307514_10010207 | Ga0307514_100102072 | 251 |
| 112 | 3300031711 | Ga0265314_10017068 | Ga0265314_100170685 | 251 |
| 113 | 3300031730 | Ga0307516_10095680 | Ga0307516_100956803 | 251 |
| 114 | 3300031901 | Ga0307406_10183872 | Ga0307406_101838722 | 251 |
| 115 | 3300031911 | Ga0307412_10239149 | Ga0307412_102391493 | 251 |
| 116 | 3300031911 | Ga0307412_10551713 | Ga0307412_105517132 | 251 |
| 117 | 3300032002 | Ga0307416_100537383 | Ga0307416_1005373832 | 251 |
| 118 | 3300035088 | Ga0373940_0016864 | Ga0373940_0016864_838_1593 | 251 |
| 119 | 3300035114 | Ga0373939_0000012 | Ga0373939_0000012_18188_18943 | 251 |
| 120 | 3300035121 | Ga0373960_0000218 | Ga0373960_0000218_7558_8313 | 251 |
| 121 | 3300035241 | Ga0373961_0004072 | Ga0373961_0004072_366_1121 | 251 |
| 122 | 3300035691 | Ga0373931_0002689 | Ga0373931_0002689_488_1243 | 251 |
| 123 | 3300037418 | Ga0395900_0000183 | Ga0395900_0000183_28427_29188 | 251 |
| 124 | 3300037466 | Ga0395898_0001293 | Ga0395898_0001293_1956_2717 | 251 |
| 125 | 3300037471 | Ga0395905_0000027 | Ga0395905_0000027_121160_121915 | 251 |
| 126 | 3300037471 | Ga0395905_0002201 | Ga0395905_0002201_970_1725 | 251 |
| 127 | 3300037471 | Ga0395905_0074018 | Ga0395905_0074018_2097_2852 | 251 |
| 128 | 3300039447 | Ga0436361_0110525 | Ga0436361_0110525_1197_1952 | 251 |
| 129 | 3300041413 | Ga0439465_0040301 | Ga0439465_0040301_346_1107 | 251 |
| 130 | 3300041997 | Ga0439431_0005469 | Ga0439431_0005469_735_1496 | 251 |
| 131 | 3300042126 | Ga0450888_001081 | Ga0450888_001081_556_1311 | 251 |
| 132 | 3300042129 | Ga0450891_002454 | Ga0450891_002454_799_1554 | 251 |
| 133 | 3300042130 | Ga0450892_003377 | Ga0450892_003377_370_1125 | 251 |
| 134 | 3300042144 | Ga0450889_002584 | Ga0450889_002584_150_905 | 251 |
| 135 | 3300042532 | Ga0450893_0032148 | Ga0450893_0032148_58_828 | 251 |
| 136 | 3300042876 | Ga0451577_0000270 | Ga0451577_0000270_50967_51722 | 251 |
| 137 | 3300042876 | Ga0451577_0003233 | Ga0451577_0003233_12959_13729 | 251 |
| 138 | 3300042876 | Ga0451577_0076840 | Ga0451577_0076840_1825_2586 | 251 |
| 139 | 3300044684 | Ga0466966_0007572 | Ga0466966_0007572_799_1554 | 251 |
| 140 | 3300044693 | Ga0466961_0027938 | Ga0466961_0027938_1559_2314 | 251 |
| 141 | 3300044712 | Ga0453684_0000868 | Ga0453684_0000868_49786_50541 | 251 |
| 142 | 3300044712 | Ga0453684_0018604 | Ga0453684_0018604_2497_3252 | 251 |
| 143 | 3300044712 | Ga0453684_0133946 | Ga0453684_0133946_1114_1875 | 251 |
| 144 | 3300044712 | Ga0453684_0214160 | Ga0453684_0214160_251_1012 | 251 |
| 145 | 3300044765 | Ga0466970_0031448 | Ga0466970_0031448_1636_2391 | 251 |
| 146 | 3300044901 | Ga0466960_0078188 | Ga0466960_0078188_47_802 | 251 |
| 147 | 3300045049 | Ga0466959_0068705 | Ga0466959_0068705_808_1563 | 251 |
| 148 | 3300045051 | Ga0451576_0004748 | Ga0451576_0004748_8402_9157 | 251 |
| 149 | 3300045051 | Ga0451576_0100852 | Ga0451576_0100852_1500_2255 | 251 |
| 150 | 3300045051 | Ga0451576_0877205 | Ga0451576_0877205_133_894 | 251 |
| 151 | 3300046660 | Ga0495625_0015665 | Ga0495625_0015665_5195_5962 | 251 |
| 152 | 3300048927 | Ga0496124_0000013 | Ga0496124_0000013_434409_435167 | 251 |
| 153 | 3300049520 | Ga0501297_006242 | Ga0501297_006242_313_1068 | 251 |
| 154 | 3300049523 | Ga0501300_001506 | Ga0501300_001506_303_1058 | 251 |
| 155 | 3300049524 | Ga0501301_002968 | Ga0501301_002968_74_829 | 251 |
| 156 | 3300049568 | Ga0501031_0055745 | Ga0501031_0055745_1166_1924 | 251 |
| 157 | 3300049569 | Ga0501032_0010987 | Ga0501032_0010987_1165_1923 | 251 |
| 158 | 3300049570 | Ga0501033_0000668 | Ga0501033_0000668_6666_7424 | 251 |
| 159 | 3300049570 | Ga0501033_0069374 | Ga0501033_0069374_457_1215 | 251 |
| 160 | 3300049571 | Ga0501034_0005349 | Ga0501034_0005349_6888_7646 | 251 |
| 161 | 3300049571 | Ga0501034_0061854 | Ga0501034_0061854_2624_3382 | 251 |
| 162 | 3300049572 | Ga0501036_0001501 | Ga0501036_0001501_13089_13847 | 251 |
| 163 | 3300049573 | Ga0501037_0004363 | Ga0501037_0004363_8453_9211 | 251 |
| 164 | 3300049573 | Ga0501037_0192545 | Ga0501037_0192545_504_1262 | 251 |
| 165 | 3300049574 | Ga0501038_0058343 | Ga0501038_0058343_1815_2573 | 251 |
| 166 | 3300049580 | Ga0501046_0001989 | Ga0501046_0001989_9481_10239 | 251 |
| 167 | 3300049581 | Ga0501047_0018975 | Ga0501047_0018975_453_1211 | 251 |
| 168 | 3300049582 | Ga0501048_0106826 | Ga0501048_0106826_54_812 | 251 |
| 169 | 3300049658 | Ga0501211_000808 | Ga0501211_000808_765_1520 | 251 |
| 170 | 3300049663 | Ga0501223_024329 | Ga0501223_024329_102_857 | 251 |
| 171 | 3300049674 | Ga0501242_010433 | Ga0501242_010433_53_808 | 251 |
| 172 | 3300049704 | Ga0501221_002605 | Ga0501221_002605_1353_2108 | 251 |
| 173 | 3300049706 | Ga0501229_000206 | Ga0501229_000206_2821_3576 | 251 |
| 174 | 3300049757 | Ga0501232_000662 | Ga0501232_000662_1308_2063 | 251 |
| 175 | 3300049759 | Ga0501262_005503 | Ga0501262_005503_409_1164 | 251 |
| 176 | 3300049764 | Ga0501267_002247 | Ga0501267_002247_522_1277 | 251 |
| 177 | 3300049766 | Ga0501269_001983 | Ga0501269_001983_474_1229 | 251 |
| 178 | 3300049771 | Ga0501274_003754 | Ga0501274_003754_419_1174 | 251 |
| 179 | 3300049779 | Ga0501283_003257 | Ga0501283_003257_98_853 | 251 |
| 180 | 3300049822 | Ga0501035_0006298 | Ga0501035_0006298_407_1165 | 251 |
| 181 | 3300049823 | Ga0501044_0038183 | Ga0501044_0038183_3308_4066 | 251 |
| 182 | 3300050496 | nmdc:mga07m45_69460_c1 | nmdc:mga07m45_69460_c1_35_799 | 251 |
| 183 | 3300050512 | nmdc:mga0n895_80145_c1 | nmdc:mga0n895_80145_c1_743_1516 | 251 |
| 184 | 3300050515 | nmdc:mga0a205_25032_c1 | nmdc:mga0a205_25032_c1_3099_3872 | 251 |
| 185 | 3300053137 | Ga0500561_0009960 | Ga0500561_0009960_279_1043 | 251 |
| 186 | iso_pu_bacteria | 2585428057 | 2587725527 | 251 |
| 187 | iso_pu_bacteria | 2585428058 | 2587734995 | 251 |
| 188 | iso_pu_bacteria | 2585428062 | 2587758433 | 251 |
| 189 | iso_pu_bacteria | 2588253510 | 2588290527 | 251 |
| 190 | iso_pu_bacteria | 2643221592 | 2643970042 | 251 |
| 191 | iso_pu_bacteria | 2643221625 | 2644142984 | 251 |
| 192 | iso_pu_bacteria | 2643221648 | 2644271956 | 251 |
| 193 | iso_pu_bacteria | 2643221654 | 2644303313 | 251 |
| 194 | iso_pu_bacteria | 2842733646 | 2842736416 | 251 |
| 195 | iso_pu_bacteria | 2885192300 | 2885196990 | 251 |
| 196 | 3300048924 | Ga0496121_0010291 | Ga0496121_0010291_1779_2558 | 252 |
| 197 | 3300049742 | Ga0501080_0053880 | Ga0501080_0053880_2690_3448 | 252 |
| 198 | 3300003792 | Ga0055540_1038671 | Ga0055540_10386711 | 253 |
| 199 | 3300005459 | Ga0068867_100039987 | Ga0068867_1000399872 | 253 |
| 200 | 3300005467 | Ga0070706_100259897 | Ga0070706_1002598973 | 253 |
| 201 | 3300005843 | Ga0068860_100177313 | Ga0068860_1001773133 | 253 |
| 202 | 3300006042 | Ga0075368_10002096 | Ga0075368_100020966 | 253 |
| 203 | 3300006048 | Ga0075363_100036439 | Ga0075363_1000364392 | 253 |
| 204 | 3300006178 | Ga0075367_10013598 | Ga0075367_100135985 | 253 |
| 205 | 3300006195 | Ga0075366_10018370 | Ga0075366_100183704 | 253 |
| 206 | 3300006195 | Ga0075366_10034591 | Ga0075366_100345912 | 253 |
| 207 | 3300006195 | Ga0075366_10055744 | Ga0075366_100557443 | 253 |
| 208 | 3300006195 | Ga0075366_10084801 | Ga0075366_100848012 | 253 |
| 209 | 3300006353 | Ga0075370_10000133 | Ga0075370_1000013319 | 253 |
| 210 | 3300006353 | Ga0075370_10001450 | Ga0075370_100014502 | 253 |
| 211 | 3300006353 | Ga0075370_10013745 | Ga0075370_100137455 | 253 |
| 212 | 3300009148 | Ga0105243_10079507 | Ga0105243_100795072 | 253 |
| 213 | 3300009176 | Ga0105242_10436922 | Ga0105242_104369221 | 253 |
| 214 | 3300025303 | Ga0209051_1010607 | Ga0209051_10106075 | 253 |
| 215 | 3300025910 | Ga0207684_10401818 | Ga0207684_104018181 | 253 |
| 216 | 3300025935 | Ga0207709_10042931 | Ga0207709_100429312 | 253 |
| 217 | 3300026089 | Ga0207648_10050744 | Ga0207648_100507444 | 253 |
| 218 | 3300028786 | Ga0307517_10005635 | Ga0307517_1000563510 | 253 |
| 219 | 3300028794 | Ga0307515_10000382 | Ga0307515_1000038211 | 253 |
| 220 | 3300031730 | Ga0307516_10031563 | Ga0307516_100315636 | 253 |
| 221 | 3300031730 | Ga0307516_10179339 | Ga0307516_101793392 | 253 |
| 222 | 3300033180 | Ga0307510_10017213 | Ga0307510_100172132 | 253 |
| 223 | 3300037471 | Ga0395905_0458190 | Ga0395905_0458190_245_1006 | 253 |
| 224 | 3300042876 | Ga0451577_0008906 | Ga0451577_0008906_7707_8480 | 253 |
| 225 | 3300044712 | Ga0453684_0366101 | Ga0453684_0366101_116_883 | 253 |
| 226 | 3300049579 | Ga0501043_0000002 | Ga0501043_0000002_217132_217911 | 253 |
| 227 | 3300049580 | Ga0501046_0000008 | Ga0501046_0000008_217215_217994 | 253 |
| 228 | 3300049581 | Ga0501047_0000003 | Ga0501047_0000003_240397_241176 | 253 |
| 229 | 3300049582 | Ga0501048_0001479 | Ga0501048_0001479_2518_3297 | 253 |
| 230 | 3300049824 | Ga0501045_0003417 | Ga0501045_0003417_7691_8470 | 253 |
| 231 | 3300050493 | nmdc:mga0k408_20607_c1 | nmdc:mga0k408_20607_c1_2023_2793 | 253 |
| 232 | 3300050493 | nmdc:mga0k408_31894_c1 | nmdc:mga0k408_31894_c1_2226_2996 | 253 |
| 233 | 3300050493 | nmdc:mga0k408_64479_c1 | nmdc:mga0k408_64479_c1_245_1024 | 253 |
| 234 | 3300050496 | nmdc:mga07m45_5336_c1 | nmdc:mga07m45_5336_c1_1723_2493 | 253 |
| 235 | 3300050496 | nmdc:mga07m45_847_c1 | nmdc:mga07m45_847_c1_3334_4104 | 253 |
| 236 | 3300053088 | Ga0500644_0003424 | Ga0500644_0003424_356_1126 | 253 |
| 237 | 3300053093 | Ga0500651_0135077 | Ga0500651_0135077_441_1211 | 253 |
| 238 | 3300053136 | Ga0500559_0000013 | Ga0500559_0000013_101695_102465 | 253 |
| 239 | 3300053156 | Ga0500622_0019490 | Ga0500622_0019490_173_943 | 253 |
| 240 | 3300053739 | Ga0500587_005845 | Ga0500587_005845_521_1291 | 253 |
| 241 | iso_pu_bacteria | 2739367655 | 2739611316 | 253 |
| 242 | iso_pu_bacteria | 2881927736 | 2881929868 | 253 |
| 243 | iso_pu_bacteria | 2887375801 | 2887376220 | 253 |
| 244 | 3300002773 | JGI25152J39213_1000516 | JGI25152J39213_10005166 | 254 |
| 245 | 3300002774 | JGI25150J39212_1009378 | JGI25150J39212_10093782 | 254 |
| 246 | 3300003215 | JGI25153J46596_10000543 | JGI25153J46596_1000054319 | 254 |
| 247 | 3300003215 | JGI25153J46596_10005712 | JGI25153J46596_100057123 | 254 |
| 248 | 3300003320 | rootH2_10002268 | rootH2_100022683 | 254 |
| 249 | 3300003771 | Ga0055526_1007216 | Ga0055526_10072164 | 254 |
| 250 | 3300005262 | Ga0065165_1000521 | Ga0065165_10005215 | 254 |
| 251 | 3300005262 | Ga0065165_1002331 | Ga0065165_100233111 | 254 |
| 252 | 3300005331 | Ga0070670_100010621 | Ga0070670_1000106215 | 254 |
| 253 | 3300005333 | Ga0070677_10000741 | Ga0070677_100007413 | 254 |
| 254 | 3300005338 | Ga0068868_100022204 | Ga0068868_1000222043 | 254 |
| 255 | 3300005344 | Ga0070661_100000361 | Ga0070661_10000036119 | 254 |
| 256 | 3300005354 | Ga0070675_100000345 | Ga0070675_10000034515 | 254 |
| 257 | 3300005354 | Ga0070675_100607702 | Ga0070675_1006077021 | 254 |
| 258 | 3300005355 | Ga0070671_100037374 | Ga0070671_1000373745 | 254 |
| 259 | 3300005355 | Ga0070671_100062581 | Ga0070671_1000625813 | 254 |
| 260 | 3300005356 | Ga0070674_100003690 | Ga0070674_1000036904 | 254 |
| 261 | 3300005356 | Ga0070674_100026418 | Ga0070674_1000264182 | 254 |
| 262 | 3300005364 | Ga0070673_100048015 | Ga0070673_1000480151 | 254 |
| 263 | 3300005366 | Ga0070659_100001606 | Ga0070659_10000160618 | 254 |
| 264 | 3300005455 | Ga0070663_100141706 | Ga0070663_1001417061 | 254 |
| 265 | 3300005455 | Ga0070663_100362828 | Ga0070663_1003628282 | 254 |
| 266 | 3300005456 | Ga0070678_100045152 | Ga0070678_1000451523 | 254 |
| 267 | 3300005456 | Ga0070678_100206299 | Ga0070678_1002062992 | 254 |
| 268 | 3300005459 | Ga0068867_100042155 | Ga0068867_1000421552 | 254 |
| 269 | 3300005459 | Ga0068867_100152324 | Ga0068867_1001523243 | 254 |
| 270 | 3300005539 | Ga0068853_100296793 | Ga0068853_1002967932 | 254 |
| 271 | 3300005543 | Ga0070672_100000229 | Ga0070672_10000022928 | 254 |
| 272 | 3300005548 | Ga0070665_100008299 | Ga0070665_10000829910 | 254 |
| 273 | 3300005548 | Ga0070665_100110937 | Ga0070665_1001109373 | 254 |
| 274 | 3300005563 | Ga0068855_100074829 | Ga0068855_1000748294 | 254 |
| 275 | 3300005564 | Ga0070664_100001095 | Ga0070664_10000109516 | 254 |
| 276 | 3300005618 | Ga0068864_100085934 | Ga0068864_1000859342 | 254 |
| 277 | 3300005834 | Ga0068851_10089650 | Ga0068851_100896502 | 254 |
| 278 | 3300005840 | Ga0068870_10024913 | Ga0068870_100249133 | 254 |
| 279 | 3300005841 | Ga0068863_100343394 | Ga0068863_1003433941 | 254 |
| 280 | 3300006048 | Ga0075363_100007907 | Ga0075363_1000079077 | 254 |
| 281 | 3300006195 | Ga0075366_10005804 | Ga0075366_100058047 | 254 |
| 282 | 3300006195 | Ga0075366_10016366 | Ga0075366_100163664 | 254 |
| 283 | 3300006195 | Ga0075366_10034296 | Ga0075366_100342962 | 254 |
| 284 | 3300006237 | Ga0097621_100264535 | Ga0097621_1002645352 | 254 |
| 285 | 3300006353 | Ga0075370_10010590 | Ga0075370_100105903 | 254 |
| 286 | 3300006353 | Ga0075370_10061761 | Ga0075370_100617613 | 254 |
| 287 | 3300006353 | Ga0075370_10167909 | Ga0075370_101679092 | 254 |
| 288 | 3300006881 | Ga0068865_100078479 | Ga0068865_1000784793 | 254 |
| 289 | 3300009098 | Ga0105245_10376253 | Ga0105245_103762532 | 254 |
| 290 | 3300009148 | Ga0105243_10041618 | Ga0105243_100416183 | 254 |
| 291 | 3300009176 | Ga0105242_10470836 | Ga0105242_104708363 | 254 |
| 292 | 3300013296 | Ga0157374_10077294 | Ga0157374_100772943 | 254 |
| 293 | 3300013297 | Ga0157378_10174826 | Ga0157378_101748262 | 254 |
| 294 | 3300013308 | Ga0157375_10161725 | Ga0157375_101617253 | 254 |
| 295 | 3300014497 | Ga0182008_10001633 | Ga0182008_100016338 | 254 |
| 296 | 3300014969 | Ga0157376_10210490 | Ga0157376_102104903 | 254 |
| 297 | 3300017792 | Ga0163161_10001851 | Ga0163161_1000185110 | 254 |
| 298 | 3300025245 | Ga0207425_1000426 | Ga0207425_10004263 | 254 |
| 299 | 3300025258 | Ga0209129_1000269 | Ga0209129_100026949 | 254 |
| 300 | 3300025273 | Ga0209673_1002449 | Ga0209673_10024498 | 254 |
| 301 | 3300025273 | Ga0209673_1006112 | Ga0209673_10061124 | 254 |
| 302 | 3300025295 | Ga0209564_1000300 | Ga0209564_100030049 | 254 |
| 303 | 3300025297 | Ga0209758_1000453 | Ga0209758_100045344 | 254 |
| 304 | 3300025297 | Ga0209758_1000605 | Ga0209758_100060530 | 254 |
| 305 | 3300025298 | Ga0209050_1000770 | Ga0209050_100077022 | 254 |
| 306 | 3300025321 | Ga0207656_10054319 | Ga0207656_100543193 | 254 |
| 307 | 3300025893 | Ga0207682_10001493 | Ga0207682_100014935 | 254 |
| 308 | 3300025907 | Ga0207645_10147664 | Ga0207645_101476642 | 254 |
| 309 | 3300025908 | Ga0207643_10013289 | Ga0207643_100132894 | 254 |
| 310 | 3300025919 | Ga0207657_10082993 | Ga0207657_100829932 | 254 |
| 311 | 3300025920 | Ga0207649_10000335 | Ga0207649_1000033514 | 254 |
| 312 | 3300025925 | Ga0207650_10000230 | Ga0207650_1000023030 | 254 |
| 313 | 3300025926 | Ga0207659_10562769 | Ga0207659_105627692 | 254 |
| 314 | 3300025927 | Ga0207687_10014332 | Ga0207687_100143323 | 254 |
| 315 | 3300025931 | Ga0207644_10012592 | Ga0207644_100125926 | 254 |
| 316 | 3300025931 | Ga0207644_10166785 | Ga0207644_101667852 | 254 |
| 317 | 3300025932 | Ga0207690_10000176 | Ga0207690_1000017623 | 254 |
| 318 | 3300025937 | Ga0207669_10008524 | Ga0207669_100085242 | 254 |
| 319 | 3300025940 | Ga0207691_10000681 | Ga0207691_1000068120 | 254 |
| 320 | 3300025945 | Ga0207679_10000168 | Ga0207679_100001689 | 254 |
| 321 | 3300025949 | Ga0207667_10061276 | Ga0207667_100612764 | 254 |
| 322 | 3300026023 | Ga0207677_10015578 | Ga0207677_100155785 | 254 |
| 323 | 3300026023 | Ga0207677_10103338 | Ga0207677_101033381 | 254 |
| 324 | 3300026041 | Ga0207639_10269695 | Ga0207639_102696952 | 254 |
| 325 | 3300026088 | Ga0207641_10380090 | Ga0207641_103800902 | 254 |
| 326 | 3300026088 | Ga0207641_10603217 | Ga0207641_106032171 | 254 |
| 327 | 3300026095 | Ga0207676_10119757 | Ga0207676_101197572 | 254 |
| 328 | 3300027866 | Ga0209813_10050727 | Ga0209813_100507271 | 254 |
| 329 | 3300028379 | Ga0268266_10656411 | Ga0268266_106564111 | 254 |
| 330 | 3300028379 | Ga0268266_10769069 | Ga0268266_107690691 | 254 |
| 331 | 3300028786 | Ga0307517_10098192 | Ga0307517_100981922 | 254 |
| 332 | 3300028794 | Ga0307515_10030153 | Ga0307515_100301537 | 254 |
| 333 | 3300031456 | Ga0307513_10071479 | Ga0307513_100714794 | 254 |
| 334 | 3300031507 | Ga0307509_10000063 | Ga0307509_10000063112 | 254 |
| 335 | 3300031548 | Ga0307408_100226249 | Ga0307408_1002262492 | 254 |
| 336 | 3300031616 | Ga0307508_10000109 | Ga0307508_1000010931 | 254 |
| 337 | 3300031616 | Ga0307508_10005254 | Ga0307508_100052549 | 254 |
| 338 | 3300031649 | Ga0307514_10029981 | Ga0307514_100299815 | 254 |
| 339 | 3300031649 | Ga0307514_10077236 | Ga0307514_100772362 | 254 |
| 340 | 3300031730 | Ga0307516_10001245 | Ga0307516_1000124523 | 254 |
| 341 | 3300031824 | Ga0307413_10083624 | Ga0307413_100836242 | 254 |
| 342 | 3300031852 | Ga0307410_10022243 | Ga0307410_100222432 | 254 |
| 343 | 3300031901 | Ga0307406_10007608 | Ga0307406_100076085 | 254 |
| 344 | 3300031911 | Ga0307412_10036594 | Ga0307412_100365943 | 254 |
| 345 | 3300032002 | Ga0307416_100059775 | Ga0307416_1000597752 | 254 |
| 346 | 3300032005 | Ga0307411_10144890 | Ga0307411_101448902 | 254 |
| 347 | 3300032126 | Ga0307415_100112331 | Ga0307415_1001123312 | 254 |
| 348 | 3300033179 | Ga0307507_10209700 | Ga0307507_102097002 | 254 |
| 349 | 3300033180 | Ga0307510_10004418 | Ga0307510_1000441816 | 254 |
| 350 | 3300041459 | Ga0451800_1581513 | Ga0451800_1581513_933_1709 | 254 |
| 351 | 3300042876 | Ga0451577_0394457 | Ga0451577_0394457_324_1088 | 254 |
| 352 | 3300044656 | Ga0466969_0000020 | Ga0466969_0000020_35503_36279 | 254 |
| 353 | 3300044656 | Ga0466969_0189657 | Ga0466969_0189657_39_818 | 254 |
| 354 | 3300044683 | Ga0466965_0043431 | Ga0466965_0043431_719_1498 | 254 |
| 355 | 3300044684 | Ga0466966_0013049 | Ga0466966_0013049_762_1541 | 254 |
| 356 | 3300044684 | Ga0466966_0145052 | Ga0466966_0145052_38_814 | 254 |
| 357 | 3300044693 | Ga0466961_0029661 | Ga0466961_0029661_93_872 | 254 |
| 358 | 3300044694 | Ga0466963_0301687 | Ga0466963_0301687_249_1028 | 254 |
| 359 | 3300044706 | Ga0466964_0021846 | Ga0466964_0021846_93_872 | 254 |
| 360 | 3300044765 | Ga0466970_0030545 | Ga0466970_0030545_190_969 | 254 |
| 361 | 3300044842 | Ga0466957_0142010 | Ga0466957_0142010_272_1051 | 254 |
| 362 | 3300045049 | Ga0466959_0000210 | Ga0466959_0000210_31700_32479 | 254 |
| 363 | 3300045049 | Ga0466959_0163203 | Ga0466959_0163203_703_1479 | 254 |
| 364 | 3300045051 | Ga0451576_0047445 | Ga0451576_0047445_2624_3388 | 254 |
| 365 | 3300046454 | Ga0495592_0006972 | Ga0495592_0006972_6397_7170 | 254 |
| 366 | 3300046507 | Ga0495606_0121912 | Ga0495606_0121912_741_1517 | 254 |
| 367 | 3300046517 | Ga0495630_0364834 | Ga0495630_0364834_220_987 | 254 |
| 368 | 3300046680 | Ga0495646_0047667 | Ga0495646_0047667_209_982 | 254 |
| 369 | 3300047321 | Ga0495676_0007213 | Ga0495676_0007213_8647_9414 | 254 |
| 370 | 3300048905 | Ga0496102_0006127 | Ga0496102_0006127_1287_2051 | 254 |
| 371 | 3300048909 | Ga0496106_0007087 | Ga0496106_0007087_4384_5157 | 254 |
| 372 | 3300048925 | Ga0496122_0000612 | Ga0496122_0000612_51032_51796 | 254 |
| 373 | 3300048926 | Ga0496123_0000274 | Ga0496123_0000274_50000_50764 | 254 |
| 374 | 3300048927 | Ga0496124_0000108 | Ga0496124_0000108_134684_135460 | 254 |
| 375 | 3300048928 | Ga0496125_0014355 | Ga0496125_0014355_5267_6043 | 254 |
| 376 | 3300049649 | Ga0501198_000024 | Ga0501198_000024_23027_23839 | 254 |
| 377 | 3300049662 | Ga0501222_000020 | Ga0501222_000020_43351_44163 | 254 |
| 378 | 3300049822 | Ga0501035_0325646 | Ga0501035_0325646_362_1150 | 254 |
| 379 | 3300050489 | nmdc:mga03683_68446_c1 | nmdc:mga03683_68446_c1_114_890 | 254 |
| 380 | 3300050493 | nmdc:mga0k408_22368_c1 | nmdc:mga0k408_22368_c1_77_847 | 254 |
| 381 | 3300050493 | nmdc:mga0k408_26608_c1 | nmdc:mga0k408_26608_c1_943_1719 | 254 |
| 382 | 3300050493 | nmdc:mga0k408_6011_c1 | nmdc:mga0k408_6011_c1_5038_5802 | 254 |
| 383 | 3300050496 | nmdc:mga07m45_4966_c2 | nmdc:mga07m45_4966_c2_1779_2561 | 254 |
| 384 | 3300050496 | nmdc:mga07m45_5339_c1 | nmdc:mga07m45_5339_c1_277_1041 | 254 |
| 385 | 3300050511 | nmdc:mga08y16_608942_c1 | nmdc:mga08y16_608942_c1_291_1061 | 254 |
| 386 | 3300053086 | Ga0500578_0110065 | Ga0500578_0110065_429_1202 | 254 |
| 387 | 3300053093 | Ga0500651_0080058 | Ga0500651_0080058_469_1245 | 254 |
| 388 | 3300053131 | Ga0500652_000177 | Ga0500652_000177_14393_15169 | 254 |
| 389 | 3300053156 | Ga0500622_0004247 | Ga0500622_0004247_3128_3904 | 254 |
| 390 | 3300053724 | Ga0500570_103326 | Ga0500570_103326_309_1085 | 254 |
| 391 | 3300005328 | Ga0070676_10297556 | Ga0070676_102975562 | 255 |
| 392 | 3300005354 | Ga0070675_100066125 | Ga0070675_1000661252 | 255 |
| 393 | 3300005356 | Ga0070674_100181127 | Ga0070674_1001811272 | 255 |
| 394 | 3300005456 | Ga0070678_100243295 | Ga0070678_1002432952 | 255 |
| 395 | 3300005543 | Ga0070672_100083064 | Ga0070672_1000830643 | 255 |
| 396 | 3300005578 | Ga0068854_100246202 | Ga0068854_1002462021 | 255 |
| 397 | 3300005844 | Ga0068862_100015164 | Ga0068862_1000151646 | 255 |
| 398 | 3300006237 | Ga0097621_100619378 | Ga0097621_1006193782 | 255 |
| 399 | 3300009148 | Ga0105243_10064760 | Ga0105243_100647602 | 255 |
| 400 | 3300013306 | Ga0163162_10198545 | Ga0163162_101985452 | 255 |
| 401 | 3300014968 | Ga0157379_10016771 | Ga0157379_100167712 | 255 |
| 402 | 3300015262 | Ga0182007_10003809 | Ga0182007_100038094 | 255 |
| 403 | 3300017792 | Ga0163161_10126584 | Ga0163161_101265841 | 255 |
| 404 | 3300025907 | Ga0207645_10045823 | Ga0207645_100458233 | 255 |
| 405 | 3300025927 | Ga0207687_10051884 | Ga0207687_100518843 | 255 |
| 406 | 3300025940 | Ga0207691_10012349 | Ga0207691_100123493 | 255 |
| 407 | 3300025981 | Ga0207640_10134770 | Ga0207640_101347702 | 255 |
| 408 | 3300025986 | Ga0207658_10142722 | Ga0207658_101427223 | 255 |
| 409 | 3300026089 | Ga0207648_10024898 | Ga0207648_100248983 | 255 |
| 410 | 3300026116 | Ga0207674_10010750 | Ga0207674_100107504 | 255 |
| 411 | 3300031251 | Ga0265327_10000789 | Ga0265327_1000078923 | 255 |
| 412 | 3300031507 | Ga0307509_10040214 | Ga0307509_100402143 | 255 |
| 413 | 3300037068 | Ga0373925_0155437 | Ga0373925_0155437_92_880 | 255 |
| 414 | 3300041404 | Ga0439436_0001048 | Ga0439436_0001048_5122_5889 | 255 |
| 415 | 3300041407 | Ga0439447_023051 | Ga0439447_023051_320_1087 | 255 |
| 416 | 3300041411 | Ga0439466_0004086 | Ga0439466_0004086_3265_4032 | 255 |
| 417 | 3300041997 | Ga0439431_0000483 | Ga0439431_0000483_3050_3817 | 255 |
| 418 | 3300041999 | Ga0439433_0002772 | Ga0439433_0002772_1352_2119 | 255 |
| 419 | 3300042002 | Ga0439442_024130 | Ga0439442_024130_42_809 | 255 |
| 420 | 3300042004 | Ga0439445_0059399 | Ga0439445_0059399_108_875 | 255 |
| 421 | 3300042006 | Ga0439432_001040 | Ga0439432_001040_7067_7834 | 255 |
| 422 | 3300042007 | Ga0439449_0001389 | Ga0439449_0001389_5581_6348 | 255 |
| 423 | 3300042007 | Ga0439449_0032823 | Ga0439449_0032823_244_1011 | 255 |
| 424 | 3300042435 | Ga0439434_0024175 | Ga0439434_0024175_832_1599 | 255 |
| 425 | 3300046457 | Ga0495590_0042912 | Ga0495590_0042912_198_965 | 255 |
| 426 | 3300046475 | Ga0495639_0023242 | Ga0495639_0023242_1024_1791 | 255 |
| 427 | 3300046663 | Ga0495635_0348180 | Ga0495635_0348180_154_921 | 255 |
| 428 | 3300046690 | Ga0495624_0036674 | Ga0495624_0036674_1553_2359 | 255 |
| 429 | 3300048903 | Ga0496100_0009165 | Ga0496100_0009165_1674_2441 | 255 |
| 430 | 3300048904 | Ga0496101_0004382 | Ga0496101_0004382_7580_8347 | 255 |
| 431 | 3300048914 | Ga0496111_0071605 | Ga0496111_0071605_980_1747 | 255 |
| 432 | 3300053136 | Ga0500559_0004164 | Ga0500559_0004164_969_1736 | 255 |
| 433 | 3300053156 | Ga0500622_0100443 | Ga0500622_0100443_544_1332 | 255 |
| 434 | iso_pu_bacteria | 2928115317 | 2928118038 | 255 |
| 435 | 3300005328 | Ga0070676_10043832 | Ga0070676_100438322 | 256 |
| 436 | 3300005330 | Ga0070690_100097048 | Ga0070690_1000970482 | 256 |
| 437 | 3300005331 | Ga0070670_100380408 | Ga0070670_1003804081 | 256 |
| 438 | 3300005333 | Ga0070677_10131373 | Ga0070677_101313732 | 256 |
| 439 | 3300005335 | Ga0070666_10375841 | Ga0070666_103758411 | 256 |
| 440 | 3300005338 | Ga0068868_100002184 | Ga0068868_1000021845 | 256 |
| 441 | 3300005338 | Ga0068868_100077659 | Ga0068868_1000776594 | 256 |
| 442 | 3300005338 | Ga0068868_100257875 | Ga0068868_1002578751 | 256 |
| 443 | 3300005340 | Ga0070689_100154089 | Ga0070689_1001540892 | 256 |
| 444 | 3300005343 | Ga0070687_100087950 | Ga0070687_1000879502 | 256 |
| 445 | 3300005344 | Ga0070661_100045911 | Ga0070661_1000459114 | 256 |
| 446 | 3300005347 | Ga0070668_100232233 | Ga0070668_1002322331 | 256 |
| 447 | 3300005354 | Ga0070675_100005881 | Ga0070675_10000588110 | 256 |
| 448 | 3300005354 | Ga0070675_100160050 | Ga0070675_1001600502 | 256 |
| 449 | 3300005354 | Ga0070675_100352375 | Ga0070675_1003523751 | 256 |
| 450 | 3300005355 | Ga0070671_100001168 | Ga0070671_1000011681 | 256 |
| 451 | 3300005355 | Ga0070671_100006977 | Ga0070671_1000069774 | 256 |
| 452 | 3300005355 | Ga0070671_100255293 | Ga0070671_1002552932 | 256 |
| 453 | 3300005355 | Ga0070671_100427027 | Ga0070671_1004270271 | 256 |
| 454 | 3300005356 | Ga0070674_100029445 | Ga0070674_1000294451 | 256 |
| 455 | 3300005356 | Ga0070674_100313785 | Ga0070674_1003137852 | 256 |
| 456 | 3300005364 | Ga0070673_100011217 | Ga0070673_1000112173 | 256 |
| 457 | 3300005364 | Ga0070673_100465855 | Ga0070673_1004658551 | 256 |
| 458 | 3300005365 | Ga0070688_100104820 | Ga0070688_1001048202 | 256 |
| 459 | 3300005367 | Ga0070667_100515932 | Ga0070667_1005159321 | 256 |
| 460 | 3300005438 | Ga0070701_10301101 | Ga0070701_103011011 | 256 |
| 461 | 3300005441 | Ga0070700_100015225 | Ga0070700_1000152251 | 256 |
| 462 | 3300005456 | Ga0070678_100061182 | Ga0070678_1000611822 | 256 |
| 463 | 3300005456 | Ga0070678_100293416 | Ga0070678_1002934162 | 256 |
| 464 | 3300005456 | Ga0070678_100505917 | Ga0070678_1005059171 | 256 |
| 465 | 3300005457 | Ga0070662_100092313 | Ga0070662_1000923132 | 256 |
| 466 | 3300005459 | Ga0068867_100051624 | Ga0068867_1000516242 | 256 |
| 467 | 3300005459 | Ga0068867_100464269 | Ga0068867_1004642691 | 256 |
| 468 | 3300005543 | Ga0070672_100033131 | Ga0070672_1000331315 | 256 |
| 469 | 3300005543 | Ga0070672_100127409 | Ga0070672_1001274092 | 256 |
| 470 | 3300005543 | Ga0070672_100178702 | Ga0070672_1001787022 | 256 |
| 471 | 3300005543 | Ga0070672_100461019 | Ga0070672_1004610192 | 256 |
| 472 | 3300005564 | Ga0070664_100468852 | Ga0070664_1004688522 | 256 |
| 473 | 3300005616 | Ga0068852_100130740 | Ga0068852_1001307402 | 256 |
| 474 | 3300005617 | Ga0068859_100016893 | Ga0068859_1000168934 | 256 |
| 475 | 3300005618 | Ga0068864_100003420 | Ga0068864_1000034206 | 256 |
| 476 | 3300005618 | Ga0068864_100084362 | Ga0068864_1000843623 | 256 |
| 477 | 3300005618 | Ga0068864_100095719 | Ga0068864_1000957192 | 256 |
| 478 | 3300005719 | Ga0068861_100184381 | Ga0068861_1001843812 | 256 |
| 479 | 3300005841 | Ga0068863_100002555 | Ga0068863_10000255511 | 256 |
| 480 | 3300005842 | Ga0068858_100003018 | Ga0068858_10000301819 | 256 |
| 481 | 3300005842 | Ga0068858_100221385 | Ga0068858_1002213852 | 256 |
| 482 | 3300005844 | Ga0068862_100072879 | Ga0068862_1000728793 | 256 |
| 483 | 3300006051 | Ga0075364_10000064 | Ga0075364_1000006417 | 256 |
| 484 | 3300006051 | Ga0075364_10020412 | Ga0075364_100204123 | 256 |
| 485 | 3300006881 | Ga0068865_100197302 | Ga0068865_1001973022 | 256 |
| 486 | 3300006931 | Ga0097620_100016893 | Ga0097620_1000168936 | 256 |
| 487 | 3300009098 | Ga0105245_10295752 | Ga0105245_102957522 | 256 |
| 488 | 3300009177 | Ga0105248_10166922 | Ga0105248_101669223 | 256 |
| 489 | 3300009177 | Ga0105248_10899838 | Ga0105248_108998381 | 256 |
| 490 | 3300009177 | Ga0105248_10979104 | Ga0105248_109791042 | 256 |
| 491 | 3300009553 | Ga0105249_10033740 | Ga0105249_100337402 | 256 |
| 492 | 3300009553 | Ga0105249_10468261 | Ga0105249_104682611 | 256 |
| 493 | 3300013296 | Ga0157374_10060726 | Ga0157374_100607262 | 256 |
| 494 | 3300013296 | Ga0157374_10544521 | Ga0157374_105445211 | 256 |
| 495 | 3300013306 | Ga0163162_10059242 | Ga0163162_100592425 | 256 |
| 496 | 3300013308 | Ga0157375_10009144 | Ga0157375_100091443 | 256 |
| 497 | 3300014325 | Ga0163163_10039345 | Ga0163163_100393454 | 256 |
| 498 | 3300014325 | Ga0163163_10331363 | Ga0163163_103313632 | 256 |
| 499 | 3300014326 | Ga0157380_10065129 | Ga0157380_100651293 | 256 |
| 500 | 3300017792 | Ga0163161_10471997 | Ga0163161_104719972 | 256 |
| 501 | 3300025315 | Ga0207697_10020000 | Ga0207697_100200001 | 256 |
| 502 | 3300025893 | Ga0207682_10018894 | Ga0207682_100188941 | 256 |
| 503 | 3300025893 | Ga0207682_10026689 | Ga0207682_100266892 | 256 |
| 504 | 3300025899 | Ga0207642_10185226 | Ga0207642_101852261 | 256 |
| 505 | 3300025907 | Ga0207645_10018015 | Ga0207645_100180155 | 256 |
| 506 | 3300025918 | Ga0207662_10042029 | Ga0207662_100420292 | 256 |
| 507 | 3300025923 | Ga0207681_10031313 | Ga0207681_100313135 | 256 |
| 508 | 3300025923 | Ga0207681_10149690 | Ga0207681_101496902 | 256 |
| 509 | 3300025925 | Ga0207650_10009807 | Ga0207650_100098071 | 256 |
| 510 | 3300025925 | Ga0207650_10109025 | Ga0207650_101090252 | 256 |
| 511 | 3300025926 | Ga0207659_10006351 | Ga0207659_100063513 | 256 |
| 512 | 3300025926 | Ga0207659_10039115 | Ga0207659_100391153 | 256 |
| 513 | 3300025931 | Ga0207644_10006307 | Ga0207644_100063076 | 256 |
| 514 | 3300025931 | Ga0207644_10051464 | Ga0207644_100514643 | 256 |
| 515 | 3300025933 | Ga0207706_10227064 | Ga0207706_102270642 | 256 |
| 516 | 3300025935 | Ga0207709_10315696 | Ga0207709_103156962 | 256 |
| 517 | 3300025936 | Ga0207670_10015720 | Ga0207670_100157202 | 256 |
| 518 | 3300025937 | Ga0207669_10109822 | Ga0207669_101098222 | 256 |
| 519 | 3300025937 | Ga0207669_10129968 | Ga0207669_101299681 | 256 |
| 520 | 3300025938 | Ga0207704_10061517 | Ga0207704_100615173 | 256 |
| 521 | 3300025940 | Ga0207691_10300713 | Ga0207691_103007132 | 256 |
| 522 | 3300025941 | Ga0207711_10016311 | Ga0207711_100163112 | 256 |
| 523 | 3300025941 | Ga0207711_10090689 | Ga0207711_100906894 | 256 |
| 524 | 3300025941 | Ga0207711_10134673 | Ga0207711_101346731 | 256 |
| 525 | 3300025960 | Ga0207651_10136651 | Ga0207651_101366512 | 256 |
| 526 | 3300025961 | Ga0207712_10031683 | Ga0207712_100316835 | 256 |
| 527 | 3300025961 | Ga0207712_10212147 | Ga0207712_102121472 | 256 |
| 528 | 3300025972 | Ga0207668_10221587 | Ga0207668_102215872 | 256 |
| 529 | 3300025986 | Ga0207658_10025833 | Ga0207658_100258334 | 256 |
| 530 | 3300025986 | Ga0207658_10031284 | Ga0207658_100312844 | 256 |
| 531 | 3300026035 | Ga0207703_10012819 | Ga0207703_100128194 | 256 |
| 532 | 3300026035 | Ga0207703_10624673 | Ga0207703_106246731 | 256 |
| 533 | 3300026075 | Ga0207708_10022695 | Ga0207708_100226952 | 256 |
| 534 | 3300026088 | Ga0207641_10083955 | Ga0207641_100839552 | 256 |
| 535 | 3300026088 | Ga0207641_10113960 | Ga0207641_101139602 | 256 |
| 536 | 3300026095 | Ga0207676_10001953 | Ga0207676_1000195319 | 256 |
| 537 | 3300026095 | Ga0207676_10126745 | Ga0207676_101267452 | 256 |
| 538 | 3300026095 | Ga0207676_10315668 | Ga0207676_103156682 | 256 |
| 539 | 3300026118 | Ga0207675_100008514 | Ga0207675_1000085149 | 256 |
| 540 | 3300026121 | Ga0207683_10006633 | Ga0207683_1000663311 | 256 |
| 541 | 3300026121 | Ga0207683_10409194 | Ga0207683_104091942 | 256 |
| 542 | 3300026142 | Ga0207698_10076176 | Ga0207698_100761763 | 256 |
| 543 | 3300026142 | Ga0207698_10125036 | Ga0207698_101250362 | 256 |
| 544 | 3300026142 | Ga0207698_10368060 | Ga0207698_103680601 | 256 |
| 545 | 3300028380 | Ga0268265_10222213 | Ga0268265_102222131 | 256 |
| 546 | 3300036401 | Ga0373937_0630638 | Ga0373937_0630638_175_981 | 256 |
| 547 | 3300046543 | Ga0495645_0133854 | Ga0495645_0133854_299_1105 | 256 |
| 548 | 3300046683 | Ga0495658_0075719 | Ga0495658_0075719_641_1447 | 256 |
| 549 | 3300047319 | Ga0495674_0290321 | Ga0495674_0290321_188_994 | 256 |
| 550 | 3300048907 | Ga0496104_0269833 | Ga0496104_0269833_150_956 | 256 |
| 551 | 3300048911 | Ga0496108_0036590 | Ga0496108_0036590_664_1467 | 256 |
| 552 | 3300048911 | Ga0496108_0317044 | Ga0496108_0317044_184_990 | 256 |
| 553 | 3300048917 | Ga0496114_0194525 | Ga0496114_0194525_148_951 | 256 |
| 554 | 3300049570 | Ga0501033_0111228 | Ga0501033_0111228_804_1613 | 256 |
| 555 | 3300049574 | Ga0501038_0114468 | Ga0501038_0114468_227_1036 | 256 |
| 556 | 3300049581 | Ga0501047_0076103 | Ga0501047_0076103_1319_2128 | 256 |
| 557 | 3300049822 | Ga0501035_0141426 | Ga0501035_0141426_1280_2071 | 256 |
| 558 | 3300049823 | Ga0501044_0004069 | Ga0501044_0004069_14093_14902 | 256 |
| 559 | 3300049823 | Ga0501044_0089818 | Ga0501044_0089818_1633_2424 | 256 |
| 560 | 3300049823 | Ga0501044_0227929 | Ga0501044_0227929_902_1693 | 256 |
| 561 | 3300050491 | nmdc:mga00v17_18021_c1 | nmdc:mga00v17_18021_c1_2872_3705 | 256 |
| 562 | 3300050491 | nmdc:mga00v17_29017_c1 | nmdc:mga00v17_29017_c1_682_1557 | 256 |
| 563 | 3300050491 | nmdc:mga00v17_69137_c1 | nmdc:mga00v17_69137_c1_733_1608 | 256 |
| 564 | 3300053148 | Ga0500590_077134 | Ga0500590_077134_106_876 | 256 |
| 565 | iso_pu_bacteria | 8002392321 | 8002395896 | 256 |
| 566 | iso_pu_bacteria | 8055225921 | 8055228459 | 256 |
| 567 | 3300003187 | JGI25151J46595_10000121 | JGI25151J46595_1000012151 | 257 |
| 568 | 3300003763 | Ga0055529_1001095 | Ga0055529_10010959 | 257 |
| 569 | 3300005327 | Ga0070658_10293216 | Ga0070658_102932161 | 257 |
| 570 | 3300005355 | Ga0070671_100137745 | Ga0070671_1001377452 | 257 |
| 571 | 3300005364 | Ga0070673_100092831 | Ga0070673_1000928312 | 257 |
| 572 | 3300005456 | Ga0070678_100103672 | Ga0070678_1001036722 | 257 |
| 573 | 3300005543 | Ga0070672_100007945 | Ga0070672_1000079453 | 257 |
| 574 | 3300005543 | Ga0070672_100077310 | Ga0070672_1000773104 | 257 |
| 575 | 3300005563 | Ga0068855_100257578 | Ga0068855_1002575782 | 257 |
| 576 | 3300005614 | Ga0068856_100846951 | Ga0068856_1008469511 | 257 |
| 577 | 3300005616 | Ga0068852_100418408 | Ga0068852_1004184082 | 257 |
| 578 | 3300005618 | Ga0068864_100001954 | Ga0068864_10000195414 | 257 |
| 579 | 3300005618 | Ga0068864_100266993 | Ga0068864_1002669932 | 257 |
| 580 | 3300006237 | Ga0097621_100082815 | Ga0097621_1000828154 | 257 |
| 581 | 3300006358 | Ga0068871_100051059 | Ga0068871_1000510593 | 257 |
| 582 | 3300006358 | Ga0068871_100191824 | Ga0068871_1001918242 | 257 |
| 583 | 3300009036 | Ga0105244_10038976 | Ga0105244_100389763 | 257 |
| 584 | 3300009176 | Ga0105242_10040441 | Ga0105242_100404413 | 257 |
| 585 | 3300009177 | Ga0105248_10004052 | Ga0105248_1000405218 | 257 |
| 586 | 3300013296 | Ga0157374_10071555 | Ga0157374_100715552 | 257 |
| 587 | 3300013297 | Ga0157378_10097588 | Ga0157378_100975882 | 257 |
| 588 | 3300013308 | Ga0157375_10264666 | Ga0157375_102646662 | 257 |
| 589 | 3300025272 | Ga0209455_1000447 | Ga0209455_10004475 | 257 |
| 590 | 3300025292 | Ga0209676_1006101 | Ga0209676_10061012 | 257 |
| 591 | 3300025294 | Ga0209025_1000019 | Ga0209025_1000019115 | 257 |
| 592 | 3300025303 | Ga0209051_1034612 | Ga0209051_10346122 | 257 |
| 593 | 3300025321 | Ga0207656_10053271 | Ga0207656_100532712 | 257 |
| 594 | 3300025909 | Ga0207705_10195193 | Ga0207705_101951933 | 257 |
| 595 | 3300025920 | Ga0207649_10360688 | Ga0207649_103606881 | 257 |
| 596 | 3300025925 | Ga0207650_10007627 | Ga0207650_100076275 | 257 |
| 597 | 3300025927 | Ga0207687_10188673 | Ga0207687_101886732 | 257 |
| 598 | 3300025931 | Ga0207644_10071322 | Ga0207644_100713222 | 257 |
| 599 | 3300025931 | Ga0207644_10345904 | Ga0207644_103459041 | 257 |
| 600 | 3300025934 | Ga0207686_10038520 | Ga0207686_100385203 | 257 |
| 601 | 3300025940 | Ga0207691_10059728 | Ga0207691_100597282 | 257 |
| 602 | 3300025945 | Ga0207679_10117672 | Ga0207679_101176723 | 257 |
| 603 | 3300025949 | Ga0207667_10057815 | Ga0207667_100578155 | 257 |
| 604 | 3300025960 | Ga0207651_10037610 | Ga0207651_100376103 | 257 |
| 605 | 3300026067 | Ga0207678_10034429 | Ga0207678_100344291 | 257 |
| 606 | 3300026089 | Ga0207648_10077174 | Ga0207648_100771743 | 257 |
| 607 | 3300026095 | Ga0207676_10112721 | Ga0207676_101127213 | 257 |
| 608 | 3300026142 | Ga0207698_10106125 | Ga0207698_101061253 | 257 |
| 609 | 3300028666 | Ga0265336_10000024 | Ga0265336_10000024122 | 257 |
| 610 | 3300029957 | Ga0265324_10001883 | Ga0265324_1000188313 | 257 |
| 611 | 3300030500 | Ga0268256_1026036 | Ga0268256_10260362 | 257 |
| 612 | 3300030521 | Ga0307511_10155354 | Ga0307511_101553542 | 257 |
| 613 | 3300031616 | Ga0307508_10201116 | Ga0307508_102011162 | 257 |
| 614 | 3300031730 | Ga0307516_10000676 | Ga0307516_1000067648 | 257 |
| 615 | 3300031911 | Ga0307412_10000061 | Ga0307412_1000006133 | 257 |
| 616 | 3300035692 | Ga0373935_0492792 | Ga0373935_0492792_67_876 | 257 |
| 617 | 3300041452 | Ga0451793_0140833 | Ga0451793_0140833_583_1356 | 257 |
| 618 | 3300044735 | Ga0466968_0006113 | Ga0466968_0006113_2288_3106 | 257 |
| 619 | 3300046471 | Ga0495650_0024628 | Ga0495650_0024628_62_835 | 257 |
| 620 | 3300046543 | Ga0495645_0073438 | Ga0495645_0073438_1067_1879 | 257 |
| 621 | 3300046660 | Ga0495625_0004651 | Ga0495625_0004651_8936_9709 | 257 |
| 622 | 3300047472 | Ga0495686_0023580 | Ga0495686_0023580_2863_3636 | 257 |
| 623 | 3300048912 | Ga0496109_0009016 | Ga0496109_0009016_4949_5731 | 257 |
| 624 | 3300048913 | Ga0496110_0057567 | Ga0496110_0057567_2191_2973 | 257 |
| 625 | 3300048915 | Ga0496112_0004885 | Ga0496112_0004885_4795_5592 | 257 |
| 626 | 3300048919 | Ga0496116_0022632 | Ga0496116_0022632_2317_3129 | 257 |
| 627 | 3300048919 | Ga0496116_0024092 | Ga0496116_0024092_1168_1980 | 257 |
| 628 | 3300048920 | Ga0496117_0009792 | Ga0496117_0009792_2192_3004 | 257 |
| 629 | 3300048920 | Ga0496117_0069549 | Ga0496117_0069549_391_1203 | 257 |
| 630 | 3300048921 | Ga0496118_0011294 | Ga0496118_0011294_6585_7397 | 257 |
| 631 | 3300048921 | Ga0496118_0018649 | Ga0496118_0018649_3972_4784 | 257 |
| 632 | 3300048922 | Ga0496119_0028700 | Ga0496119_0028700_1229_2041 | 257 |
| 633 | 3300048923 | Ga0496120_0004304 | Ga0496120_0004304_2697_3509 | 257 |
| 634 | 3300048924 | Ga0496121_0000647 | Ga0496121_0000647_43642_44454 | 257 |
| 635 | 3300048925 | Ga0496122_0003062 | Ga0496122_0003062_8674_9486 | 257 |
| 636 | 3300048925 | Ga0496122_0022055 | Ga0496122_0022055_4395_5207 | 257 |
| 637 | 3300048926 | Ga0496123_0002506 | Ga0496123_0002506_8860_9672 | 257 |
| 638 | 3300048927 | Ga0496124_0048778 | Ga0496124_0048778_2281_3093 | 257 |
| 639 | 3300048927 | Ga0496124_0196702 | Ga0496124_0196702_68_880 | 257 |
| 640 | 3300048928 | Ga0496125_0000051 | Ga0496125_0000051_157237_158049 | 257 |
| 641 | 3300048928 | Ga0496125_0004939 | Ga0496125_0004939_5793_6605 | 257 |
| 642 | 3300048928 | Ga0496125_0272563 | Ga0496125_0272563_118_930 | 257 |
| 643 | 3300048929 | Ga0496126_0008185 | Ga0496126_0008185_4470_5282 | 257 |
| 644 | 3300048929 | Ga0496126_0015870 | Ga0496126_0015870_4423_5235 | 257 |
| 645 | 3300049570 | Ga0501033_0098599 | Ga0501033_0098599_281_1096 | 257 |
| 646 | 3300049662 | Ga0501222_001766 | Ga0501222_001766_1851_2651 | 257 |
| 647 | 3300049822 | Ga0501035_0026335 | Ga0501035_0026335_2563_3354 | 257 |
| 648 | 3300049823 | Ga0501044_0000316 | Ga0501044_0000316_17024_17815 | 257 |
| 649 | 3300050496 | nmdc:mga07m45_2735_c1 | nmdc:mga07m45_2735_c1_4982_5755 | 257 |
| 650 | 3300053077 | Ga0495601_0032309 | Ga0495601_0032309_912_1721 | 257 |
| 651 | 3300053080 | Ga0500635_0000008 | Ga0500635_0000008_68993_69766 | 257 |
| 652 | 3300053149 | Ga0500600_0009254 | Ga0500600_0009254_3762_4574 | 257 |
| 653 | iso_pu_bacteria | 2599185292 | 2599902783 | 257 |
| 654 | iso_pu_bacteria | 2643221569 | 2643861620 | 257 |
| 655 | iso_pu_bacteria | 2643221594 | 2643980040 | 257 |
| 656 | iso_pu_bacteria | 2643221621 | 2644123614 | 257 |
| 657 | iso_pu_bacteria | 2808606395 | 2809033123 | 257 |
| 658 | iso_pu_bacteria | 2855730933 | 2855732820 | 257 |
| 659 | iso_pu_bacteria | 2855767633 | 2855771572 | 257 |
| 660 | iso_pu_bacteria | 2857537821 | 2857542501 | 257 |
| 661 | iso_pu_bacteria | 2857542790 | 2857543360 | 257 |
| 662 | iso_pu_bacteria | 2858950400 | 2858952208 | 257 |
| 663 | iso_pu_bacteria | 2881412998 | 2881415624 | 257 |
| 664 | iso_pu_bacteria | 2941479691 | 2941482635 | 257 |
| 665 | iso_pu_bacteria | 8048746797 | 8048747535 | 257 |
| 666 | 3300002705 | JGI25156J39149_1016063 | JGI25156J39149_10160631 | 258 |
| 667 | 3300003761 | Ga0055535_1000618 | Ga0055535_10006185 | 258 |
| 668 | 3300003763 | Ga0055529_1000053 | Ga0055529_1000053142 | 258 |
| 669 | 3300003792 | Ga0055540_1005560 | Ga0055540_10055603 | 258 |
| 670 | 3300014325 | Ga0163163_10986658 | Ga0163163_109866581 | 258 |
| 671 | 3300021361 | Ga0213872_10017110 | Ga0213872_100171103 | 258 |
| 672 | 3300025242 | Ga0209258_100074 | Ga0209258_100074104 | 258 |
| 673 | 3300025256 | Ga0209759_1000909 | Ga0209759_100090919 | 258 |
| 674 | 3300025272 | Ga0209455_1000066 | Ga0209455_1000066144 | 258 |
| 675 | 3300025303 | Ga0209051_1014684 | Ga0209051_10146843 | 258 |
| 676 | 3300031251 | Ga0265327_10019962 | Ga0265327_100199624 | 258 |
| 677 | 3300031507 | Ga0307509_10177792 | Ga0307509_101777922 | 258 |
| 678 | 3300037418 | Ga0395900_0027656 | Ga0395900_0027656_1715_2572 | 258 |
| 679 | 3300037466 | Ga0395898_0152268 | Ga0395898_0152268_595_1452 | 258 |
| 680 | 3300039447 | Ga0436361_0039667 | Ga0436361_0039667_711_1538 | 258 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7jr7-assembly1.cif.gz_B | cryo-em structure of abcg5/g8 in complex with fab 2e10 and 11f4 | 0.7003 | 20 | 254 |
| 5do7-assembly2.cif.gz_D | crystal structure of the human sterol transporter abcg5/abcg8 | 0.686 | 17 | 252 |
| 8wbx-assembly1.cif.gz_B | cryo-em structure of the abcg25 bound to aba | 0.6837 | 27 | 252 |
| 6oih-assembly2.cif.gz_C | crystal structure of o-antigen polysaccharide abc-transporter | 0.6809 | 8 | 256 |
| 8wd6-assembly1.cif.gz_A | cryo-em structure of the abcg25 | 0.6796 | 26 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.8488 | 55 | 250 | 3.40.1710.10 |
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.8086 | 56 | 248 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.7625 | 34 | 249 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6598 | 55 | 250 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6472 | 34 | 249 | 3.40.1710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A176S4K3-F1-model_v4 | Abc-type multidrug transport system, permease component | 0.9642 | 59 | 258 |
GO:0005886
GO:0140359 |
| AF-A0A4Q3TZG4-F1-model_v4 | Transport permease protein | 0.9608 | 62 | 258 |
GO:0043190
GO:0140359 |
| AF-A0A381YL02-F1-model_v4 | ABC transmembrane type-2 domain-containing protein | 0.9555 | 67 | 258 |
GO:0005886
GO:0140359 |
| AF-A0A176S4K3-F1-model_v4 | Abc-type multidrug transport system, permease component | 0.9549 | 59 | 258 |
GO:0005886
GO:0140359 |
| AF-A0A1G1J6N7-F1-model_v4 | ABC-2 type transporter transmembrane domain-containing protein | 0.9523 | 108 | 258 |
GO:0005886
GO:0140359 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar