F474792

General Info

Members Datasets Scaffolds Average Seq Length
680 373 643 260

Family's Representative Sequence

Representative Sequence 3300042005|Ga0439448_0022644|Ga0439448_0022644_365_1117
Length 250
Sequence MSGNPIIRLNGARTLFYKEVLRFWKVSFQTVAAPVLTAVLYLLIFGHVLENRVKVYDNVGYTSFLIPGLVMMSVLQNAFANSSSSLIQSKITGNLVFLLVTPLSHWAWFLAYVGASLVRGLAVGLGVFAVTAWFAPPGFALLGAGMLGSLGLIAGLWAEKFDQMAAFQNFIIVPMTFLSGVFYSVHSLPPFWQGVSHLNPFFYMIDGFRRGFFGVSDVSPWLSLSVVATSFVLVSAIALRLLKTGYKLRH

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
6 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
7 2643221569 Achromobacter sp. Root565 Isolate Unclassified
8 2643221585 Pelomonas sp. Root662 Isolate Unclassified
9 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
10 2643221594 Achromobacter sp. Root170 Isolate Unclassified
11 2643221621 Achromobacter sp. Root83 Isolate Unclassified
12 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
13 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
14 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
15 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
16 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
17 2643221656 Pelomonas sp. Root405 Isolate Unclassified
18 2643221660 Methylibium sp. Root1272 Isolate Unclassified
19 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
20 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
21 2842733646 Variovorax sp. R-72446 Isolate Unclassified
22 2855730933 Achromobacter sp. HZ28 Isolate Nodule
23 2855767633 Achromobacter sp. HZ34 Isolate Nodule
24 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
25 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
26 2858950400 Achromobacter sp. K91 Isolate Unclassified
27 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
28 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
29 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
30 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
31 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
32 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
33 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
34 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
35 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
36 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
37 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
41 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
42 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
51 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
54 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
131 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
192 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
198 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
205 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
206 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
207 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
208 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
209 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
210 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
211 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
212 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
213 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
214 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
217 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
220 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
221 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
222 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
227 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
228 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
229 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
230 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
231 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
242 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
243 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
244 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
245 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
246 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
247 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
248 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
249 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
250 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
251 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
252 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
253 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
254 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
255 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
256 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
257 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
258 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
259 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
260 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
261 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
262 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
263 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
264 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
265 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
266 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
269 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
274 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
275 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
276 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
279 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
307 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
310 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
311 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
312 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
313 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
314 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
315 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
316 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
317 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
318 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
319 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
320 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
332 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
333 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
334 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
335 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
336 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
337 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
340 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
341 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
342 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
343 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
344 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
348 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
349 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
350 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
351 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
358 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
359 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
360 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
361 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
362 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
363 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
364 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
365 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
366 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
367 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
368 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
369 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
370 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
371 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
372 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
373 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.56
Metatranscriptomes 0
Isolates 5.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.71
Nodule 0.59
Rhizoplane 2.35
Rhizosphere 70.44
Stem 0
Stem Tuber 0
Unclassified 11.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1016063 3300002705 Bacteria 1472
2 JGI25152J39213_1000516 3300002773 Bacteria 21501
3 JGI25150J39212_1009378 3300002774 Bacteria 1867
4 JGI25151J46595_10000121 3300003187 Bacteria 106308
5 JGI25153J46596_10000543 3300003215 Bacteria 23510
6 JGI25153J46596_10005712 3300003215 Bacteria 6487
7 rootH2_10002268 3300003320 Bacteria 2287
8 Ga0055535_1000618 3300003761 Bacteria 28963
9 Ga0055529_1000053 3300003763 Bacteria 198996
10 Ga0055529_1001095 3300003763 Bacteria 12204
11 Ga0055526_1007216 3300003771 Bacteria 5833
12 Ga0055524_1000247 3300003775 Bacteria 56379
13 Ga0055530_10004453 3300003791 Bacteria 7195
14 Ga0055540_1000260 3300003792 Bacteria 47714
15 Ga0055540_1005560 3300003792 Bacteria 5259
16 Ga0055540_1038671 3300003792 Bacteria 1044
17 Ga0055531_10000105 3300003794 Bacteria 91871
18 Ga0055531_10011138 3300003794 Bacteria 4377
19 Ga0065165_1000521 3300005262 Bacteria 58807
20 Ga0065165_1002331 3300005262 Bacteria 16569
21 Ga0070658_10293216 3300005327 Bacteria 1386
22 Ga0070676_10043832 3300005328 Bacteria 2601
23 Ga0070676_10297556 3300005328 Bacteria 1093
24 Ga0070683_100460717 3300005329 Bacteria 1213
25 Ga0070690_100097048 3300005330 Bacteria 1949
26 Ga0070670_100010621 3300005331 Bacteria 7865
27 Ga0070670_100380408 3300005331 Bacteria 1244
28 Ga0070677_10000741 3300005333 Bacteria 10908
29 Ga0070677_10131373 3300005333 Bacteria 1143
30 Ga0068869_100190965 3300005334 Bacteria 1610
31 Ga0070666_10375841 3300005335 Bacteria 1019
32 Ga0068868_100002184 3300005338 Bacteria 13491
33 Ga0068868_100022204 3300005338 Bacteria 4788
34 Ga0068868_100077659 3300005338 Bacteria 2656
35 Ga0068868_100257875 3300005338 Bacteria 1469
36 Ga0070689_100154089 3300005340 Bacteria 1855
37 Ga0070687_100087950 3300005343 Bacteria 1712
38 Ga0070661_100000361 3300005344 Bacteria 35932
39 Ga0070661_100045911 3300005344 Bacteria 3194
40 Ga0070668_100232233 3300005347 Bacteria 1525
41 Ga0070669_100025458 3300005353 Bacteria 4250
42 Ga0070675_100000345 3300005354 Bacteria 31378
43 Ga0070675_100005881 3300005354 Bacteria 9399
44 Ga0070675_100066125 3300005354 Bacteria 2989
45 Ga0070675_100160050 3300005354 Bacteria 1935
46 Ga0070675_100352375 3300005354 Bacteria 1305
47 Ga0070675_100607702 3300005354 Bacteria 992
48 Ga0070671_100001168 3300005355 Bacteria 19603
49 Ga0070671_100006977 3300005355 Bacteria 9047
50 Ga0070671_100037374 3300005355 Bacteria 4026
51 Ga0070671_100062581 3300005355 Bacteria 3098
52 Ga0070671_100137745 3300005355 Bacteria 2058
53 Ga0070671_100255293 3300005355 Bacteria 1489
54 Ga0070671_100427027 3300005355 Bacteria 1135
55 Ga0070674_100003690 3300005356 Bacteria 8625
56 Ga0070674_100026418 3300005356 Bacteria 3792
57 Ga0070674_100029445 3300005356 Bacteria 3617
58 Ga0070674_100181127 3300005356 Bacteria 1614
59 Ga0070674_100313785 3300005356 Bacteria 1254
60 Ga0070673_100011217 3300005364 Bacteria 6111
61 Ga0070673_100048015 3300005364 Bacteria 3325
62 Ga0070673_100092831 3300005364 Bacteria 2470
63 Ga0070673_100465855 3300005364 Bacteria 1138
64 Ga0070688_100104820 3300005365 Bacteria 1871
65 Ga0070659_100001606 3300005366 Bacteria 16262
66 Ga0070667_100515932 3300005367 Bacteria 1096
67 Ga0070701_10301101 3300005438 Bacteria 986
68 Ga0070700_100015225 3300005441 Bacteria 4358
69 Ga0070694_100022166 3300005444 Bacteria 4067
70 Ga0070663_100000113 3300005455 Bacteria 37716
71 Ga0070663_100141706 3300005455 Bacteria 1836
72 Ga0070663_100362828 3300005455 Bacteria 1175
73 Ga0070678_100045152 3300005456 Bacteria 3150
74 Ga0070678_100061182 3300005456 Bacteria 2774
75 Ga0070678_100103672 3300005456 Bacteria 2210
76 Ga0070678_100206299 3300005456 Bacteria 1625
77 Ga0070678_100243295 3300005456 Bacteria 1505
78 Ga0070678_100293416 3300005456 Bacteria 1379
79 Ga0070678_100505917 3300005456 Bacteria 1066
80 Ga0070662_100092313 3300005457 Bacteria 2275
81 Ga0070662_100212958 3300005457 Bacteria 1538
82 Ga0068867_100039987 3300005459 Bacteria 3420
83 Ga0068867_100042155 3300005459 Bacteria 3337
84 Ga0068867_100051624 3300005459 Bacteria 3033
85 Ga0068867_100152324 3300005459 Bacteria 1817
86 Ga0068867_100464269 3300005459 Bacteria 1081
87 Ga0070706_100259897 3300005467 Bacteria 1621
88 Ga0068853_100066195 3300005539 Bacteria 3138
89 Ga0068853_100296793 3300005539 Bacteria 1493
90 Ga0070672_100000229 3300005543 Bacteria 31255
91 Ga0070672_100007945 3300005543 Bacteria 7248
92 Ga0070672_100033131 3300005543 Bacteria 3909
93 Ga0070672_100077310 3300005543 Bacteria 2661
94 Ga0070672_100083064 3300005543 Bacteria 2570
95 Ga0070672_100123786 3300005543 Bacteria 2119
96 Ga0070672_100127409 3300005543 Bacteria 2089
97 Ga0070672_100178702 3300005543 Bacteria 1768
98 Ga0070672_100461019 3300005543 Bacteria 1095
99 Ga0070695_100006828 3300005545 Bacteria 6757
100 Ga0070696_100470642 3300005546 Bacteria 995
101 Ga0070665_100008299 3300005548 Bacteria 10502
102 Ga0070665_100110937 3300005548 Bacteria 2745
103 Ga0068855_100037002 3300005563 Bacteria 5807
104 Ga0068855_100074829 3300005563 Bacteria 3933
105 Ga0068855_100257578 3300005563 Bacteria 1944
106 Ga0068855_100263794 3300005563 Bacteria 1918
107 Ga0070664_100001095 3300005564 Bacteria 21389
108 Ga0070664_100468852 3300005564 Bacteria 1158
109 Ga0070664_100526544 3300005564 Bacteria 1091
110 Ga0068854_100246202 3300005578 Bacteria 1425
111 Ga0068856_100846951 3300005614 Bacteria 933
112 Ga0068852_100060346 3300005616 Bacteria 3292
113 Ga0068852_100130740 3300005616 Bacteria 2312
114 Ga0068852_100418408 3300005616 Bacteria 1321
115 Ga0068852_100805575 3300005616 Bacteria 953
116 Ga0068859_100016893 3300005617 Bacteria 7325
117 Ga0068859_100193649 3300005617 Bacteria 2117
118 Ga0068864_100001954 3300005618 Bacteria 16951
119 Ga0068864_100003420 3300005618 Bacteria 13128
120 Ga0068864_100084362 3300005618 Bacteria 2791
121 Ga0068864_100085934 3300005618 Bacteria 2767
122 Ga0068864_100095719 3300005618 Bacteria 2626
123 Ga0068864_100266993 3300005618 Bacteria 1593
124 Ga0068861_100184381 3300005719 Bacteria 1739
125 Ga0068851_10089650 3300005834 Bacteria 1618
126 Ga0068870_10024913 3300005840 Bacteria 2965
127 Ga0068863_100002555 3300005841 Bacteria 18065
128 Ga0068863_100343394 3300005841 Bacteria 1452
129 Ga0068863_100389602 3300005841 Bacteria 1361
130 Ga0068863_100802714 3300005841 Bacteria 939
131 Ga0068858_100003018 3300005842 Bacteria 16882
132 Ga0068858_100221385 3300005842 Bacteria 1792
133 Ga0068860_100177313 3300005843 Bacteria 2059
134 Ga0068862_100015164 3300005844 Bacteria 6400
135 Ga0068862_100072879 3300005844 Bacteria 2967
136 Ga0075368_10002096 3300006042 Bacteria 6443
137 Ga0075363_100007907 3300006048 Bacteria 4923
138 Ga0075363_100036439 3300006048 Bacteria 2580
139 Ga0075364_10000064 3300006051 Bacteria 40534
140 Ga0075364_10020412 3300006051 Bacteria 4166
141 Ga0075362_10014630 3300006177 Bacteria 3171
142 Ga0075362_10154514 3300006177 Bacteria 1102
143 Ga0075367_10013598 3300006178 Bacteria 4381
144 Ga0075366_10005804 3300006195 Bacteria 6704
145 Ga0075366_10016366 3300006195 Bacteria 4262
146 Ga0075366_10018370 3300006195 Bacteria 4036
147 Ga0075366_10034296 3300006195 Bacteria 2988
148 Ga0075366_10034591 3300006195 Bacteria 2976
149 Ga0075366_10055744 3300006195 Bacteria 2347
150 Ga0075366_10084801 3300006195 Bacteria 1894
151 Ga0075366_10207229 3300006195 Bacteria 1193
152 Ga0075366_10218308 3300006195 Bacteria 1161
153 Ga0097621_100082815 3300006237 Bacteria 2672
154 Ga0097621_100264535 3300006237 Bacteria 1510
155 Ga0097621_100619378 3300006237 Bacteria 991
156 Ga0075370_10000133 3300006353 Bacteria 24995
157 Ga0075370_10001450 3300006353 Bacteria 10303
158 Ga0075370_10004793 3300006353 Bacteria 6624
159 Ga0075370_10010590 3300006353 Bacteria 4828
160 Ga0075370_10013745 3300006353 Bacteria 4308
161 Ga0075370_10061761 3300006353 Bacteria 2134
162 Ga0075370_10167909 3300006353 Bacteria 1289
163 Ga0068871_100051059 3300006358 Bacteria 3347
164 Ga0068871_100140339 3300006358 Bacteria 2054
165 Ga0068871_100191824 3300006358 Bacteria 1760
166 Ga0075430_100120727 3300006846 Bacteria 2185
167 Ga0075433_10333635 3300006852 Bacteria 1341
168 Ga0075429_100005760 3300006880 Bacteria 10698
169 Ga0068865_100078479 3300006881 Bacteria 2362
170 Ga0068865_100197302 3300006881 Bacteria 1560
171 Ga0097620_100016893 3300006931 Bacteria 7325
172 Ga0097620_100193659 3300006931 Bacteria 2117
173 Ga0079104_1000711 3300006946 Bacteria 30224
174 Ga0105244_10038976 3300009036 Bacteria 2476
175 Ga0105245_10295752 3300009098 Bacteria 1587
176 Ga0105245_10376253 3300009098 Bacteria 1413
177 Ga0114129_10215733 3300009147 Bacteria 2591
178 Ga0105243_10041618 3300009148 Bacteria 3593
179 Ga0105243_10064760 3300009148 Bacteria 2934
180 Ga0105243_10079507 3300009148 Bacteria 2673
181 Ga0105242_10040441 3300009176 Bacteria 3757
182 Ga0105242_10436922 3300009176 Bacteria 1230
183 Ga0105242_10470836 3300009176 Bacteria 1188
184 Ga0105248_10004052 3300009177 Bacteria 16195
185 Ga0105248_10166922 3300009177 Bacteria 2481
186 Ga0105248_10899838 3300009177 Bacteria 999
187 Ga0105248_10979104 3300009177 Bacteria 955
188 Ga0105238_10041318 3300009551 Bacteria 4670
189 Ga0105249_10033740 3300009553 Bacteria 4635
190 Ga0105249_10468261 3300009553 Bacteria 1301
191 Ga0157374_10060726 3300013296 Bacteria 3538
192 Ga0157374_10071555 3300013296 Bacteria 3270
193 Ga0157374_10077294 3300013296 Bacteria 3150
194 Ga0157374_10133827 3300013296 Bacteria 2401
195 Ga0157374_10544521 3300013296 Bacteria 1168
196 Ga0157378_10097588 3300013297 Bacteria 2678
197 Ga0157378_10174826 3300013297 Bacteria 2016
198 Ga0163162_10059242 3300013306 Bacteria 3861
199 Ga0163162_10198545 3300013306 Bacteria 2134
200 Ga0157375_10009144 3300013308 Bacteria 8683
201 Ga0157375_10161725 3300013308 Bacteria 2381
202 Ga0157375_10264666 3300013308 Bacteria 1881
203 Ga0163163_10039345 3300014325 Bacteria 4615
204 Ga0163163_10331363 3300014325 Bacteria 1577
205 Ga0163163_10986658 3300014325 Bacteria 906
206 Ga0157380_10065129 3300014326 Bacteria 2928
207 Ga0182008_10001633 3300014497 Bacteria 14849
208 Ga0157379_10016771 3300014968 Bacteria 6446
209 Ga0157376_10210490 3300014969 Bacteria 1795
210 Ga0182007_10003809 3300015262 Bacteria 7024
211 Ga0163161_10001851 3300017792 Bacteria 15456
212 Ga0163161_10126584 3300017792 Bacteria 1924
213 Ga0163161_10471997 3300017792 Bacteria 1017
214 Ga0213872_10001003 3300021361 Bacteria 19713
215 Ga0213872_10017110 3300021361 Bacteria 3356
216 Ga0213872_10083421 3300021361 Bacteria 1434
217 Ga0209258_100074 3300025242 Bacteria 271062
218 Ga0207425_1000426 3300025245 Bacteria 28024
219 Ga0209759_1000909 3300025256 Bacteria 21990
220 Ga0209129_1000269 3300025258 Bacteria 51170
221 Ga0209455_1000066 3300025272 Bacteria 316811
222 Ga0209455_1000447 3300025272 Bacteria 31733
223 Ga0209673_1002449 3300025273 Bacteria 12865
224 Ga0209673_1006112 3300025273 Bacteria 5905
225 Ga0209676_1006101 3300025292 Bacteria 6052
226 Ga0209025_1000019 3300025294 Bacteria 631548
227 Ga0209564_1000300 3300025295 Bacteria 98386
228 Ga0209758_1000453 3300025297 Bacteria 68482
229 Ga0209758_1000605 3300025297 Bacteria 55552
230 Ga0209050_1000770 3300025298 Bacteria 46024
231 Ga0209050_1003148 3300025298 Bacteria 12579
232 Ga0209050_1009610 3300025298 Bacteria 4920
233 Ga0209256_1000049 3300025299 Bacteria 310696
234 Ga0209051_1000247 3300025303 Bacteria 91122
235 Ga0209051_1003582 3300025303 Bacteria 10098
236 Ga0209051_1010607 3300025303 Bacteria 4629
237 Ga0209051_1014684 3300025303 Bacteria 3641
238 Ga0209051_1034612 3300025303 Bacteria 1891
239 Ga0209257_1000047 3300025304 Bacteria 460507
240 Ga0209257_1000141 3300025304 Bacteria 201130
241 Ga0209257_1008855 3300025304 Bacteria 5557
242 Ga0207697_10020000 3300025315 Bacteria 2742
243 Ga0207656_10053271 3300025321 Bacteria 1755
244 Ga0207656_10054319 3300025321 Bacteria 1741
245 Ga0207682_10001493 3300025893 Bacteria 10802
246 Ga0207682_10018894 3300025893 Bacteria 2697
247 Ga0207682_10026689 3300025893 Bacteria 2297
248 Ga0207642_10185226 3300025899 Bacteria 1138
249 Ga0207645_10018015 3300025907 Bacteria 4656
250 Ga0207645_10045823 3300025907 Bacteria 2794
251 Ga0207645_10147664 3300025907 Bacteria 1533
252 Ga0207643_10013289 3300025908 Bacteria 4455
253 Ga0207705_10195193 3300025909 Bacteria 1532
254 Ga0207684_10401818 3300025910 Bacteria 1178
255 Ga0207662_10042029 3300025918 Bacteria 2693
256 Ga0207657_10082993 3300025919 Bacteria 2689
257 Ga0207649_10000335 3300025920 Bacteria 35710
258 Ga0207649_10360688 3300025920 Bacteria 1078
259 Ga0207681_10031313 3300025923 Bacteria 3473
260 Ga0207681_10149690 3300025923 Bacteria 1747
261 Ga0207681_10527783 3300025923 Bacteria 969
262 Ga0207694_10023193 3300025924 Bacteria 4712
263 Ga0207650_10000230 3300025925 Bacteria 62576
264 Ga0207650_10007627 3300025925 Bacteria 7370
265 Ga0207650_10009807 3300025925 Bacteria 6548
266 Ga0207650_10109025 3300025925 Bacteria 2141
267 Ga0207650_10233462 3300025925 Bacteria 1484
268 Ga0207659_10006351 3300025926 Bacteria 7237
269 Ga0207659_10039115 3300025926 Bacteria 3304
270 Ga0207659_10562769 3300025926 Bacteria 970
271 Ga0207687_10014332 3300025927 Bacteria 5187
272 Ga0207687_10051884 3300025927 Bacteria 2860
273 Ga0207687_10188673 3300025927 Bacteria 1603
274 Ga0207644_10006307 3300025931 Bacteria 7723
275 Ga0207644_10012592 3300025931 Bacteria 5622
276 Ga0207644_10051464 3300025931 Bacteria 2956
277 Ga0207644_10071322 3300025931 Bacteria 2541
278 Ga0207644_10166785 3300025931 Bacteria 1716
279 Ga0207644_10345904 3300025931 Bacteria 1206
280 Ga0207690_10000176 3300025932 Bacteria 49560
281 Ga0207706_10004610 3300025933 Bacteria 12933
282 Ga0207706_10227064 3300025933 Bacteria 1634
283 Ga0207706_10369066 3300025933 Bacteria 1246
284 Ga0207686_10038520 3300025934 Bacteria 2893
285 Ga0207709_10042931 3300025935 Bacteria 2723
286 Ga0207709_10315696 3300025935 Bacteria 1168
287 Ga0207670_10015720 3300025936 Bacteria 4529
288 Ga0207669_10008524 3300025937 Bacteria 4819
289 Ga0207669_10109822 3300025937 Bacteria 1845
290 Ga0207669_10129968 3300025937 Bacteria 1728
291 Ga0207704_10050520 3300025938 Bacteria 2509
292 Ga0207704_10061517 3300025938 Bacteria 2329
293 Ga0207691_10000681 3300025940 Bacteria 33590
294 Ga0207691_10012349 3300025940 Bacteria 8186
295 Ga0207691_10059728 3300025940 Bacteria 3466
296 Ga0207691_10300713 3300025940 Bacteria 1379
297 Ga0207711_10016311 3300025941 Bacteria 6171
298 Ga0207711_10090689 3300025941 Bacteria 2687
299 Ga0207711_10134673 3300025941 Bacteria 2218
300 Ga0207689_10006365 3300025942 Bacteria 10455
301 Ga0207679_10000168 3300025945 Bacteria 54187
302 Ga0207679_10117672 3300025945 Bacteria 2109
303 Ga0207679_10224739 3300025945 Bacteria 1581
304 Ga0207667_10057815 3300025949 Bacteria 4069
305 Ga0207667_10061276 3300025949 Bacteria 3936
306 Ga0207667_10329679 3300025949 Bacteria 1558
307 Ga0207667_10395546 3300025949 Bacteria 1407
308 Ga0207651_10037610 3300025960 Bacteria 3172
309 Ga0207651_10136651 3300025960 Bacteria 1886
310 Ga0207651_10280827 3300025960 Bacteria 1376
311 Ga0207712_10031683 3300025961 Bacteria 3563
312 Ga0207712_10212147 3300025961 Bacteria 1543
313 Ga0207668_10221587 3300025972 Bacteria 1519
314 Ga0207640_10134770 3300025981 Bacteria 1791
315 Ga0207658_10025833 3300025986 Bacteria 4113
316 Ga0207658_10031284 3300025986 Bacteria 3777
317 Ga0207658_10142722 3300025986 Bacteria 1940
318 Ga0207677_10015578 3300026023 Bacteria 4477
319 Ga0207677_10103338 3300026023 Bacteria 2103
320 Ga0207703_10012819 3300026035 Bacteria 6536
321 Ga0207703_10624673 3300026035 Bacteria 1020
322 Ga0207639_10024959 3300026041 Bacteria 4331
323 Ga0207639_10269695 3300026041 Bacteria 1492
324 Ga0207678_10034429 3300026067 Bacteria 4411
325 Ga0207708_10022695 3300026075 Bacteria 4739
326 Ga0207641_10083955 3300026088 Bacteria 2771
327 Ga0207641_10113960 3300026088 Bacteria 2401
328 Ga0207641_10380090 3300026088 Bacteria 1352
329 Ga0207641_10603217 3300026088 Bacteria 1075
330 Ga0207648_10024898 3300026089 Bacteria 5337
331 Ga0207648_10050744 3300026089 Bacteria 3627
332 Ga0207648_10077174 3300026089 Bacteria 2904
333 Ga0207676_10001953 3300026095 Bacteria 15029
334 Ga0207676_10112721 3300026095 Bacteria 2279
335 Ga0207676_10119757 3300026095 Bacteria 2217
336 Ga0207676_10126745 3300026095 Bacteria 2163
337 Ga0207676_10315668 3300026095 Bacteria 1432
338 Ga0207674_10010750 3300026116 Bacteria 10333
339 Ga0207675_100008514 3300026118 Bacteria 9650
340 Ga0207683_10006633 3300026121 Bacteria 9904
341 Ga0207683_10409194 3300026121 Bacteria 1248
342 Ga0207698_10043913 3300026142 Bacteria 3353
343 Ga0207698_10076176 3300026142 Bacteria 2684
344 Ga0207698_10106125 3300026142 Bacteria 2342
345 Ga0207698_10125036 3300026142 Bacteria 2185
346 Ga0207698_10353264 3300026142 Bacteria 1389
347 Ga0207698_10368060 3300026142 Bacteria 1363
348 Ga0209281_1000395 3300027111 Bacteria 67983
349 Ga0209996_1001152 3300027395 Bacteria 3169
350 Ga0209995_1004071 3300027471 Bacteria 2334
351 Ga0209968_1000428 3300027526 Bacteria 6838
352 Ga0209966_1000008 3300027695 Bacteria 88938
353 Ga0209998_10005832 3300027717 Bacteria 2564
354 Ga0209813_10050727 3300027866 Bacteria 1296
355 Ga0209974_10114282 3300027876 Bacteria 952
356 Ga0268266_10656411 3300028379 Bacteria 1010
357 Ga0268266_10769069 3300028379 Bacteria 930
358 Ga0268265_10222213 3300028380 Bacteria 1653
359 Ga0265336_10000024 3300028666 Bacteria 188787
360 Ga0307517_10005635 3300028786 Bacteria 18785
361 Ga0307517_10098192 3300028786 Bacteria 2332
362 Ga0307515_10000011 3300028794 Bacteria 633903
363 Ga0307515_10000084 3300028794 Bacteria 221434
364 Ga0307515_10000382 3300028794 Bacteria 107907
365 Ga0307515_10020861 3300028794 Bacteria 11649
366 Ga0307515_10030153 3300028794 Bacteria 9126
367 Ga0307515_10073520 3300028794 Bacteria 4593
368 Ga0265324_10001883 3300029957 Bacteria 11301
369 Ga0268256_1026036 3300030500 Bacteria 1477
370 Ga0307511_10155354 3300030521 Bacteria 1300
371 Ga0307512_10209709 3300030522 Bacteria 1038
372 Ga0265332_10082005 3300031238 Bacteria 1368
373 Ga0265328_10000252 3300031239 Bacteria 24700
374 Ga0265329_10026703 3300031242 Bacteria 1901
375 Ga0265331_10000050 3300031250 Bacteria 181286
376 Ga0265327_10000109 3300031251 Bacteria 181275
377 Ga0265327_10000789 3300031251 Bacteria 48791
378 Ga0265327_10019962 3300031251 Bacteria 4101
379 Ga0307513_10002473 3300031456 Bacteria 25565
380 Ga0307513_10026225 3300031456 Bacteria 6725
381 Ga0307513_10071479 3300031456 Bacteria 3621
382 Ga0307509_10000063 3300031507 Bacteria 143708
383 Ga0307509_10040214 3300031507 Bacteria 5086
384 Ga0307509_10177792 3300031507 Bacteria 1998
385 Ga0307408_100000029 3300031548 Bacteria 227806
386 Ga0307408_100226249 3300031548 Bacteria 1529
387 Ga0307508_10000109 3300031616 Bacteria 97316
388 Ga0307508_10005254 3300031616 Bacteria 12357
389 Ga0307508_10201116 3300031616 Bacteria 1593
390 Ga0307514_10000954 3300031649 Bacteria 43472
391 Ga0307514_10010207 3300031649 Bacteria 7861
392 Ga0307514_10029981 3300031649 Bacteria 4369
393 Ga0307514_10077236 3300031649 Bacteria 2477
394 Ga0265314_10017068 3300031711 Bacteria 5707
395 Ga0307516_10000676 3300031730 Bacteria 46208
396 Ga0307516_10001245 3300031730 Bacteria 35441
397 Ga0307516_10031563 3300031730 Bacteria 5340
398 Ga0307516_10095680 3300031730 Bacteria 2792
399 Ga0307516_10179339 3300031730 Bacteria 1853
400 Ga0307413_10083624 3300031824 Bacteria 2054
401 Ga0307410_10022243 3300031852 Bacteria 3915
402 Ga0307406_10007608 3300031901 Bacteria 6016
403 Ga0307406_10183872 3300031901 Bacteria 1524
404 Ga0307412_10000061 3300031911 Bacteria 126274
405 Ga0307412_10036594 3300031911 Bacteria 3146
406 Ga0307412_10239149 3300031911 Bacteria 1403
407 Ga0307412_10551713 3300031911 Bacteria 968
408 Ga0307416_100059775 3300032002 Bacteria 3099
409 Ga0307416_100537383 3300032002 Bacteria 1240
410 Ga0307411_10144890 3300032005 Bacteria 1757
411 Ga0307415_100112331 3300032126 Bacteria 2024
412 Ga0307507_10209700 3300033179 Bacteria 1331
413 Ga0307510_10004418 3300033180 Bacteria 16555
414 Ga0307510_10017213 3300033180 Bacteria 8527
415 Ga0373940_0016864 3300035088 Bacteria 1814
416 Ga0373939_0000012 3300035114 Bacteria 67223
417 Ga0373960_0000218 3300035121 Bacteria 10541
418 Ga0373961_0004072 3300035241 Bacteria 3559
419 Ga0373931_0002689 3300035691 Bacteria 7910
420 Ga0373935_0492792 3300035692 Bacteria 889
421 Ga0373937_0630638 3300036401 Bacteria 1017
422 Ga0373925_0155437 3300037068 Bacteria 1798
423 Ga0395900_0000183 3300037418 Bacteria 100749
424 Ga0395900_0027656 3300037418 Bacteria 5809
425 Ga0395900_0079101 3300037418 Bacteria 3378
426 Ga0395898_0001293 3300037466 Bacteria 36684
427 Ga0395898_0112304 3300037466 Bacteria 2612
428 Ga0395898_0152268 3300037466 Bacteria 2212
429 Ga0395905_0000027 3300037471 Bacteria 297239
430 Ga0395905_0002201 3300037471 Bacteria 22018
431 Ga0395905_0027641 3300037471 Bacteria 5350
432 Ga0395905_0074018 3300037471 Bacteria 3192
433 Ga0395905_0250170 3300037471 Bacteria 1655
434 Ga0395905_0458190 3300037471 Bacteria 1173
435 Ga0436361_0039667 3300039447 Bacteria 5314
436 Ga0436361_0110525 3300039447 Bacteria 45343
437 Ga0439436_0001048 3300041404 Bacteria 7765
438 Ga0439447_023051 3300041407 Bacteria 1625
439 Ga0439466_0004086 3300041411 Bacteria 5638
440 Ga0439465_0040301 3300041413 Bacteria 1509
441 Ga0451793_0140833 3300041452 Bacteria 1415
442 Ga0451800_1581513 3300041459 Bacteria 2092
443 Ga0439431_0000483 3300041997 Bacteria 8459
444 Ga0439431_0005469 3300041997 Bacteria 2805
445 Ga0439433_0002772 3300041999 Bacteria 3733
446 Ga0439442_024130 3300042002 Bacteria 1264
447 Ga0439445_0059399 3300042004 Bacteria 1043
448 Ga0439448_0022644 3300042005 Bacteria 1955
449 Ga0439432_001040 3300042006 Bacteria 10528
450 Ga0439449_0001389 3300042007 Bacteria 9472
451 Ga0439449_0032823 3300042007 Bacteria 1934
452 Ga0450888_001081 3300042126 Bacteria 2579
453 Ga0450891_002454 3300042129 Bacteria 1867
454 Ga0450892_003377 3300042130 Bacteria 1311
455 Ga0450889_002584 3300042144 Bacteria 1796
456 Ga0439434_0024175 3300042435 Bacteria 1832
457 Ga0450893_0032148 3300042532 Bacteria 939
458 Ga0451577_0000270 3300042876 Bacteria 101581
459 Ga0451577_0003233 3300042876 Bacteria 18316
460 Ga0451577_0008906 3300042876 Bacteria 9714
461 Ga0451577_0076840 3300042876 Bacteria 2977
462 Ga0451577_0394457 3300042876 Bacteria 1256
463 Ga0466969_0000020 3300044656 Bacteria 101861
464 Ga0466969_0189657 3300044656 Bacteria 939
465 Ga0466965_0043431 3300044683 Bacteria 2219
466 Ga0466965_0145957 3300044683 Bacteria 1234
467 Ga0466966_0007572 3300044684 Bacteria 7193
468 Ga0466966_0013049 3300044684 Bacteria 5500
469 Ga0466966_0145052 3300044684 Bacteria 1449
470 Ga0466961_0027938 3300044693 Bacteria 3627
471 Ga0466961_0029661 3300044693 Bacteria 3514
472 Ga0466963_0301687 3300044694 Bacteria 1126
473 Ga0466964_0021846 3300044706 Bacteria 2477
474 Ga0453684_0000868 3300044712 Bacteria 101512
475 Ga0453684_0018604 3300044712 Bacteria 10651
476 Ga0453684_0133946 3300044712 Bacteria 2970
477 Ga0453684_0214160 3300044712 Bacteria 2237
478 Ga0453684_0366101 3300044712 Bacteria 1622
479 Ga0466968_0006113 3300044735 Bacteria 4523
480 Ga0466970_0030545 3300044765 Bacteria 2841
481 Ga0466970_0031448 3300044765 Bacteria 2803
482 Ga0466957_0142010 3300044842 Bacteria 1547
483 Ga0466960_0012273 3300044901 Bacteria 3611
484 Ga0466960_0078188 3300044901 Bacteria 1660
485 Ga0466959_0000210 3300045049 Bacteria 37745
486 Ga0466959_0068705 3300045049 Bacteria 2567
487 Ga0466959_0163203 3300045049 Bacteria 1565
488 Ga0451576_0004748 3300045051 Bacteria 17449
489 Ga0451576_0047445 3300045051 Bacteria 4516
490 Ga0451576_0100852 3300045051 Bacteria 3002
491 Ga0451576_0240622 3300045051 Bacteria 1891
492 Ga0451576_0877205 3300045051 Bacteria 942
493 Ga0495592_0006972 3300046454 Bacteria 8442
494 Ga0495590_0042912 3300046457 Bacteria 1577
495 Ga0495650_0024628 3300046471 Bacteria 2839
496 Ga0495639_0023242 3300046475 Bacteria 2723
497 Ga0495583_0000034 3300046506 Bacteria 246856
498 Ga0495606_0001225 3300046507 Bacteria 35933
499 Ga0495606_0121912 3300046507 Bacteria 1560
500 Ga0495630_0364834 3300046517 Bacteria 1106
501 Ga0495621_0013028 3300046539 Bacteria 2606
502 Ga0495645_0073438 3300046543 Bacteria 2464
503 Ga0495645_0133854 3300046543 Bacteria 1735
504 Ga0495625_0004651 3300046660 Bacteria 12890
505 Ga0495625_0015665 3300046660 Bacteria 5995
506 Ga0495635_0348180 3300046663 Bacteria 989
507 Ga0495588_0280673 3300046674 Bacteria 878
508 Ga0495646_0047667 3300046680 Bacteria 2607
509 Ga0495658_0075719 3300046683 Bacteria 1965
510 Ga0495669_0022325 3300046684 Bacteria 2749
511 Ga0495624_0036674 3300046690 Bacteria 3159
512 Ga0495649_0000428 3300046694 Bacteria 36408
513 Ga0495589_0002853 3300046794 Bacteria 9567
514 Ga0495674_0290321 3300047319 Bacteria 1338
515 Ga0495676_0007213 3300047321 Bacteria 10196
516 Ga0495686_0023580 3300047472 Bacteria 4057
517 Ga0496100_0009165 3300048903 Bacteria 5553
518 Ga0496101_0004382 3300048904 Bacteria 8872
519 Ga0496102_0006127 3300048905 Bacteria 10246
520 Ga0496104_0269833 3300048907 Bacteria 1614
521 Ga0496106_0007087 3300048909 Bacteria 8285
522 Ga0496108_0036590 3300048911 Bacteria 4085
523 Ga0496108_0125637 3300048911 Bacteria 2202
524 Ga0496108_0317044 3300048911 Bacteria 1359
525 Ga0496109_0009016 3300048912 Bacteria 8498
526 Ga0496110_0057567 3300048913 Bacteria 3422
527 Ga0496111_0071605 3300048914 Bacteria 2523
528 Ga0496112_0004885 3300048915 Bacteria 11462
529 Ga0496114_0194525 3300048917 Bacteria 1775
530 Ga0496116_0022632 3300048919 Bacteria 4704
531 Ga0496116_0024092 3300048919 Bacteria 4510
532 Ga0496117_0009792 3300048920 Bacteria 8836
533 Ga0496117_0069549 3300048920 Bacteria 2370
534 Ga0496118_0011294 3300048921 Bacteria 8735
535 Ga0496118_0018649 3300048921 Bacteria 6241
536 Ga0496119_0028700 3300048922 Bacteria 3790
537 Ga0496120_0004304 3300048923 Bacteria 12065
538 Ga0496121_0000647 3300048924 Bacteria 65033
539 Ga0496121_0010291 3300048924 Bacteria 10581
540 Ga0496122_0000612 3300048925 Bacteria 73307
541 Ga0496122_0003062 3300048925 Bacteria 22564
542 Ga0496122_0022055 3300048925 Bacteria 5673
543 Ga0496123_0000274 3300048926 Bacteria 101783
544 Ga0496123_0002506 3300048926 Bacteria 22588
545 Ga0496124_0000013 3300048927 Bacteria 484884
546 Ga0496124_0000108 3300048927 Bacteria 167473
547 Ga0496124_0048778 3300048927 Bacteria 3615
548 Ga0496124_0196702 3300048927 Bacteria 1537
549 Ga0496125_0000051 3300048928 Bacteria 285754
550 Ga0496125_0004939 3300048928 Bacteria 15088
551 Ga0496125_0014355 3300048928 Bacteria 7717
552 Ga0496125_0272563 3300048928 Bacteria 1053
553 Ga0496126_0008185 3300048929 Bacteria 11309
554 Ga0496126_0015870 3300048929 Bacteria 7563
555 Ga0501297_006242 3300049520 Bacteria 1268
556 Ga0501300_001506 3300049523 Bacteria 3498
557 Ga0501301_002968 3300049524 Bacteria 1148
558 Ga0501031_0055745 3300049568 Bacteria 2575
559 Ga0501032_0010987 3300049569 Bacteria 6509
560 Ga0501033_0000668 3300049570 Bacteria 31668
561 Ga0501033_0069374 3300049570 Bacteria 2591
562 Ga0501033_0098599 3300049570 Bacteria 2134
563 Ga0501033_0111228 3300049570 Bacteria 1993
564 Ga0501034_0005349 3300049571 Bacteria 14062
565 Ga0501034_0061854 3300049571 Bacteria 3759
566 Ga0501036_0001501 3300049572 Bacteria 17997
567 Ga0501037_0004363 3300049573 Bacteria 10269
568 Ga0501037_0192545 3300049573 Bacteria 1443
569 Ga0501038_0058343 3300049574 Bacteria 3309
570 Ga0501038_0114468 3300049574 Bacteria 2231
571 Ga0501043_0000002 3300049579 Bacteria 351081
572 Ga0501046_0000008 3300049580 Bacteria 351167
573 Ga0501046_0001989 3300049580 Bacteria 19418
574 Ga0501047_0000003 3300049581 Bacteria 508375
575 Ga0501047_0018975 3300049581 Bacteria 6596
576 Ga0501047_0076103 3300049581 Bacteria 3230
577 Ga0501048_0001479 3300049582 Bacteria 17811
578 Ga0501048_0106826 3300049582 Bacteria 1976
579 Ga0501198_000024 3300049649 Bacteria 67171
580 Ga0501211_000808 3300049658 Bacteria 3239
581 Ga0501222_000020 3300049662 Bacteria 67164
582 Ga0501222_001766 3300049662 Bacteria 2997
583 Ga0501223_024329 3300049663 Bacteria 1179
584 Ga0501242_010433 3300049674 Bacteria 1109
585 Ga0501221_002605 3300049704 Bacteria 2974
586 Ga0501229_000206 3300049706 Bacteria 6441
587 Ga0501080_0053880 3300049742 Bacteria 3746
588 Ga0501232_000662 3300049757 Bacteria 2413
589 Ga0501262_005503 3300049759 Bacteria 1495
590 Ga0501267_002247 3300049764 Bacteria 1719
591 Ga0501269_001983 3300049766 Bacteria 2581
592 Ga0501274_003754 3300049771 Bacteria 1235
593 Ga0501283_003257 3300049779 Bacteria 2141
594 Ga0501035_0006298 3300049822 Bacteria 11155
595 Ga0501035_0026335 3300049822 Bacteria 5321
596 Ga0501035_0141426 3300049822 Bacteria 2092
597 Ga0501035_0325646 3300049822 Bacteria 1290
598 Ga0501044_0000316 3300049823 Bacteria 61151
599 Ga0501044_0004069 3300049823 Bacteria 16400
600 Ga0501044_0038183 3300049823 Bacteria 5016
601 Ga0501044_0089818 3300049823 Bacteria 3100
602 Ga0501044_0227929 3300049823 Bacteria 1812
603 Ga0501045_0003417 3300049824 Bacteria 10864
604 nmdc:mga03683_68446_c1 3300050489 Bacteria 1513
605 nmdc:mga00v17_18021_c1 3300050491 Bacteria 4007
606 nmdc:mga00v17_29017_c1 3300050491 Bacteria 3244
607 nmdc:mga00v17_69137_c1 3300050491 Bacteria 2185
608 nmdc:mga0k408_20607_c1 3300050493 Bacteria 3696
609 nmdc:mga0k408_22368_c1 3300050493 Bacteria 3560
610 nmdc:mga0k408_26608_c1 3300050493 Bacteria 3281
611 nmdc:mga0k408_31894_c1 3300050493 Bacteria 3011
612 nmdc:mga0k408_6011_c1 3300050493 Bacteria 6476
613 nmdc:mga0k408_64479_c1 3300050493 Bacteria 2132
614 nmdc:mga07m45_154696_c1 3300050496 Bacteria 1330
615 nmdc:mga07m45_2735_c1 3300050496 Bacteria 8313
616 nmdc:mga07m45_4966_c2 3300050496 Bacteria 6170
617 nmdc:mga07m45_5336_c1 3300050496 Bacteria 6395
618 nmdc:mga07m45_5339_c1 3300050496 Bacteria 6394
619 nmdc:mga07m45_69460_c1 3300050496 Bacteria 2003
620 nmdc:mga07m45_847_c1 3300050496 Bacteria 13276
621 nmdc:mga05p37_29102_c1 3300050507 Bacteria 6742
622 nmdc:mga09592_1310_c1 3300050508 Bacteria 19982
623 nmdc:mga0qj67_19500_c1 3300050509 Bacteria 5181
624 nmdc:mga08y16_608942_c1 3300050511 Bacteria 1100
625 nmdc:mga0n895_80145_c1 3300050512 Bacteria 3252
626 nmdc:mga0a205_25032_c1 3300050515 Bacteria 5682
627 Ga0495601_0032309 3300053077 Bacteria 3258
628 Ga0500635_0000008 3300053080 Bacteria 167327
629 Ga0500578_0110065 3300053086 Bacteria 1737
630 Ga0500644_0003424 3300053088 Bacteria 3925
631 Ga0500651_0080058 3300053093 Bacteria 2023
632 Ga0500651_0135077 3300053093 Bacteria 1490
633 Ga0500652_000177 3300053131 Bacteria 24784
634 Ga0500559_0000013 3300053136 Bacteria 163436
635 Ga0500559_0004164 3300053136 Bacteria 6938
636 Ga0500561_0009960 3300053137 Bacteria 1948
637 Ga0500590_077134 3300053148 Bacteria 1644
638 Ga0500600_0009254 3300053149 Bacteria 5942
639 Ga0500622_0004247 3300053156 Bacteria 9113
640 Ga0500622_0019490 3300053156 Bacteria 3602
641 Ga0500622_0100443 3300053156 Bacteria 1425
642 Ga0500570_103326 3300053724 Bacteria 1188
643 Ga0500587_005845 3300053739 Bacteria 1645

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0145957 Ga0466965_0145957_120_902 228
2 3300044901 Ga0466960_0012273 Ga0466960_0012273_2418_3200 228
3 3300005616 Ga0068852_100060346 Ga0068852_1000603464 229
4 3300026142 Ga0207698_10043913 Ga0207698_100439134 229
5 3300005329 Ga0070683_100460717 Ga0070683_1004607171 230
6 3300005334 Ga0068869_100190965 Ga0068869_1001909652 230
7 3300005563 Ga0068855_100037002 Ga0068855_1000370026 230
8 3300005564 Ga0070664_100526544 Ga0070664_1005265441 230
9 3300005841 Ga0068863_100389602 Ga0068863_1003896023 230
10 3300006358 Ga0068871_100140339 Ga0068871_1001403393 230
11 3300013296 Ga0157374_10133827 Ga0157374_101338272 230
12 3300025933 Ga0207706_10004610 Ga0207706_100046105 230
13 3300025942 Ga0207689_10006365 Ga0207689_100063659 230
14 3300025945 Ga0207679_10224739 Ga0207679_102247391 230
15 3300025949 Ga0207667_10395546 Ga0207667_103955461 230
16 3300048911 Ga0496108_0125637 Ga0496108_0125637_635_1435 230
17 3300006846 Ga0075430_100120727 Ga0075430_1001207273 231
18 3300006880 Ga0075429_100005760 Ga0075429_1000057604 231
19 3300037471 Ga0395905_0027641 Ga0395905_0027641_1840_2619 231
20 3300050508 nmdc:mga09592_1310_c1 nmdc:mga09592_1310_c1_7691_8473 231
21 3300050509 nmdc:mga0qj67_19500_c1 nmdc:mga0qj67_19500_c1_3125_3907 231
22 3300005617 Ga0068859_100193649 Ga0068859_1001936492 233
23 3300006177 Ga0075362_10014630 Ga0075362_100146303 233
24 3300006195 Ga0075366_10207229 Ga0075366_102072292 233
25 3300006353 Ga0075370_10004793 Ga0075370_100047937 233
26 3300006931 Ga0097620_100193659 Ga0097620_1001936592 233
27 3300009147 Ga0114129_10215733 Ga0114129_102157332 233
28 3300050496 nmdc:mga07m45_154696_c1 nmdc:mga07m45_154696_c1_503_1297 233
29 3300050507 nmdc:mga05p37_29102_c1 nmdc:mga05p37_29102_c1_3792_4571 233
30 3300003791 Ga0055530_10004453 Ga0055530_100044533 234
31 3300003792 Ga0055540_1000260 Ga0055540_100026039 234
32 3300003794 Ga0055531_10011138 Ga0055531_100111383 234
33 3300025298 Ga0209050_1009610 Ga0209050_10096103 234
34 3300025303 Ga0209051_1000247 Ga0209051_100024739 234
35 3300025304 Ga0209257_1000141 Ga0209257_100014139 234
36 3300003775 Ga0055524_1000247 Ga0055524_100024715 235
37 3300006946 Ga0079104_1000711 Ga0079104_100071113 235
38 3300025299 Ga0209256_1000049 Ga0209256_100004959 235
39 3300027111 Ga0209281_1000395 Ga0209281_100039556 235
40 3300046539 Ga0495621_0013028 Ga0495621_0013028_219_965 235
41 3300005455 Ga0070663_100000113 Ga0070663_1000001139 236
42 3300009551 Ga0105238_10041318 Ga0105238_100413186 236
43 3300025924 Ga0207694_10023193 Ga0207694_100231931 236
44 3300005353 Ga0070669_100025458 Ga0070669_1000254583 239
45 3300005543 Ga0070672_100123786 Ga0070672_1001237863 239
46 3300025923 Ga0207681_10527783 Ga0207681_105277831 239
47 3300025925 Ga0207650_10233462 Ga0207650_102334622 239
48 3300025933 Ga0207706_10369066 Ga0207706_103690661 239
49 3300025960 Ga0207651_10280827 Ga0207651_102808273 239
50 3300021361 Ga0213872_10083421 Ga0213872_100834212 240
51 3300046506 Ga0495583_0000034 Ga0495583_0000034_15624_16397 242
52 3300046507 Ga0495606_0001225 Ga0495606_0001225_30972_31745 242
53 3300046684 Ga0495669_0022325 Ga0495669_0022325_843_1616 242
54 3300046694 Ga0495649_0000428 Ga0495649_0000428_9066_9839 242
55 3300046794 Ga0495589_0002853 Ga0495589_0002853_686_1459 242
56 3300037471 Ga0395905_0250170 Ga0395905_0250170_558_1352 243
57 3300046674 Ga0495588_0280673 Ga0495588_0280673_129_863 244
58 3300005539 Ga0068853_100066195 Ga0068853_1000661953 246
59 3300005563 Ga0068855_100263794 Ga0068855_1002637942 246
60 3300025949 Ga0207667_10329679 Ga0207667_103296791 246
61 3300026041 Ga0207639_10024959 Ga0207639_100249594 246
62 3300037418 Ga0395900_0079101 Ga0395900_0079101_361_1152 246
63 3300037466 Ga0395898_0112304 Ga0395898_0112304_289_1080 246
64 iso_pu_bacteria 2643221544 2643743617 247
65 iso_pu_bacteria 2643221585 2643936616 247
66 iso_pu_bacteria 2643221639 2644222503 247
67 iso_pu_bacteria 2643221646 2644256651 247
68 iso_pu_bacteria 2643221656 2644317972 247
69 iso_pu_bacteria 2643221660 2644341115 247
70 iso_pu_bacteria 2895511927 2895517803 247
71 iso_pu_bacteria 2904479285 2904481547 247
72 3300042005 Ga0439448_0022644 Ga0439448_0022644_365_1117 248
73 3300045051 Ga0451576_0240622 Ga0451576_0240622_547_1317 249
74 3300005841 Ga0068863_100802714 Ga0068863_1008027141 250
75 3300003794 Ga0055531_10000105 Ga0055531_100001059 251
76 3300005444 Ga0070694_100022166 Ga0070694_1000221664 251
77 3300005457 Ga0070662_100212958 Ga0070662_1002129581 251
78 3300005545 Ga0070695_100006828 Ga0070695_1000068282 251
79 3300005546 Ga0070696_100470642 Ga0070696_1004706421 251
80 3300005616 Ga0068852_100805575 Ga0068852_1008055752 251
81 3300006177 Ga0075362_10154514 Ga0075362_101545142 251
82 3300006195 Ga0075366_10218308 Ga0075366_102183081 251
83 3300006852 Ga0075433_10333635 Ga0075433_103336352 251
84 3300021361 Ga0213872_10001003 Ga0213872_100010036 251
85 3300025298 Ga0209050_1003148 Ga0209050_100314813 251
86 3300025303 Ga0209051_1003582 Ga0209051_10035829 251
87 3300025304 Ga0209257_1000047 Ga0209257_1000047225 251
88 3300025304 Ga0209257_1008855 Ga0209257_10088556 251
89 3300025938 Ga0207704_10050520 Ga0207704_100505201 251
90 3300026142 Ga0207698_10353264 Ga0207698_103532642 251
91 3300027395 Ga0209996_1001152 Ga0209996_10011522 251
92 3300027471 Ga0209995_1004071 Ga0209995_10040713 251
93 3300027526 Ga0209968_1000428 Ga0209968_10004283 251
94 3300027695 Ga0209966_1000008 Ga0209966_100000841 251
95 3300027717 Ga0209998_10005832 Ga0209998_100058323 251
96 3300027876 Ga0209974_10114282 Ga0209974_101142821 251
97 3300028794 Ga0307515_10000011 Ga0307515_10000011158 251
98 3300028794 Ga0307515_10000084 Ga0307515_10000084179 251
99 3300028794 Ga0307515_10020861 Ga0307515_100208613 251
100 3300028794 Ga0307515_10073520 Ga0307515_100735205 251
101 3300030522 Ga0307512_10209709 Ga0307512_102097092 251
102 3300031238 Ga0265332_10082005 Ga0265332_100820052 251
103 3300031239 Ga0265328_10000252 Ga0265328_100002529 251
104 3300031242 Ga0265329_10026703 Ga0265329_100267032 251
105 3300031250 Ga0265331_10000050 Ga0265331_10000050184 251
106 3300031251 Ga0265327_10000109 Ga0265327_1000010941 251
107 3300031456 Ga0307513_10002473 Ga0307513_1000247327 251
108 3300031456 Ga0307513_10026225 Ga0307513_100262257 251
109 3300031548 Ga0307408_100000029 Ga0307408_100000029141 251
110 3300031649 Ga0307514_10000954 Ga0307514_1000095427 251
111 3300031649 Ga0307514_10010207 Ga0307514_100102072 251
112 3300031711 Ga0265314_10017068 Ga0265314_100170685 251
113 3300031730 Ga0307516_10095680 Ga0307516_100956803 251
114 3300031901 Ga0307406_10183872 Ga0307406_101838722 251
115 3300031911 Ga0307412_10239149 Ga0307412_102391493 251
116 3300031911 Ga0307412_10551713 Ga0307412_105517132 251
117 3300032002 Ga0307416_100537383 Ga0307416_1005373832 251
118 3300035088 Ga0373940_0016864 Ga0373940_0016864_838_1593 251
119 3300035114 Ga0373939_0000012 Ga0373939_0000012_18188_18943 251
120 3300035121 Ga0373960_0000218 Ga0373960_0000218_7558_8313 251
121 3300035241 Ga0373961_0004072 Ga0373961_0004072_366_1121 251
122 3300035691 Ga0373931_0002689 Ga0373931_0002689_488_1243 251
123 3300037418 Ga0395900_0000183 Ga0395900_0000183_28427_29188 251
124 3300037466 Ga0395898_0001293 Ga0395898_0001293_1956_2717 251
125 3300037471 Ga0395905_0000027 Ga0395905_0000027_121160_121915 251
126 3300037471 Ga0395905_0002201 Ga0395905_0002201_970_1725 251
127 3300037471 Ga0395905_0074018 Ga0395905_0074018_2097_2852 251
128 3300039447 Ga0436361_0110525 Ga0436361_0110525_1197_1952 251
129 3300041413 Ga0439465_0040301 Ga0439465_0040301_346_1107 251
130 3300041997 Ga0439431_0005469 Ga0439431_0005469_735_1496 251
131 3300042126 Ga0450888_001081 Ga0450888_001081_556_1311 251
132 3300042129 Ga0450891_002454 Ga0450891_002454_799_1554 251
133 3300042130 Ga0450892_003377 Ga0450892_003377_370_1125 251
134 3300042144 Ga0450889_002584 Ga0450889_002584_150_905 251
135 3300042532 Ga0450893_0032148 Ga0450893_0032148_58_828 251
136 3300042876 Ga0451577_0000270 Ga0451577_0000270_50967_51722 251
137 3300042876 Ga0451577_0003233 Ga0451577_0003233_12959_13729 251
138 3300042876 Ga0451577_0076840 Ga0451577_0076840_1825_2586 251
139 3300044684 Ga0466966_0007572 Ga0466966_0007572_799_1554 251
140 3300044693 Ga0466961_0027938 Ga0466961_0027938_1559_2314 251
141 3300044712 Ga0453684_0000868 Ga0453684_0000868_49786_50541 251
142 3300044712 Ga0453684_0018604 Ga0453684_0018604_2497_3252 251
143 3300044712 Ga0453684_0133946 Ga0453684_0133946_1114_1875 251
144 3300044712 Ga0453684_0214160 Ga0453684_0214160_251_1012 251
145 3300044765 Ga0466970_0031448 Ga0466970_0031448_1636_2391 251
146 3300044901 Ga0466960_0078188 Ga0466960_0078188_47_802 251
147 3300045049 Ga0466959_0068705 Ga0466959_0068705_808_1563 251
148 3300045051 Ga0451576_0004748 Ga0451576_0004748_8402_9157 251
149 3300045051 Ga0451576_0100852 Ga0451576_0100852_1500_2255 251
150 3300045051 Ga0451576_0877205 Ga0451576_0877205_133_894 251
151 3300046660 Ga0495625_0015665 Ga0495625_0015665_5195_5962 251
152 3300048927 Ga0496124_0000013 Ga0496124_0000013_434409_435167 251
153 3300049520 Ga0501297_006242 Ga0501297_006242_313_1068 251
154 3300049523 Ga0501300_001506 Ga0501300_001506_303_1058 251
155 3300049524 Ga0501301_002968 Ga0501301_002968_74_829 251
156 3300049568 Ga0501031_0055745 Ga0501031_0055745_1166_1924 251
157 3300049569 Ga0501032_0010987 Ga0501032_0010987_1165_1923 251
158 3300049570 Ga0501033_0000668 Ga0501033_0000668_6666_7424 251
159 3300049570 Ga0501033_0069374 Ga0501033_0069374_457_1215 251
160 3300049571 Ga0501034_0005349 Ga0501034_0005349_6888_7646 251
161 3300049571 Ga0501034_0061854 Ga0501034_0061854_2624_3382 251
162 3300049572 Ga0501036_0001501 Ga0501036_0001501_13089_13847 251
163 3300049573 Ga0501037_0004363 Ga0501037_0004363_8453_9211 251
164 3300049573 Ga0501037_0192545 Ga0501037_0192545_504_1262 251
165 3300049574 Ga0501038_0058343 Ga0501038_0058343_1815_2573 251
166 3300049580 Ga0501046_0001989 Ga0501046_0001989_9481_10239 251
167 3300049581 Ga0501047_0018975 Ga0501047_0018975_453_1211 251
168 3300049582 Ga0501048_0106826 Ga0501048_0106826_54_812 251
169 3300049658 Ga0501211_000808 Ga0501211_000808_765_1520 251
170 3300049663 Ga0501223_024329 Ga0501223_024329_102_857 251
171 3300049674 Ga0501242_010433 Ga0501242_010433_53_808 251
172 3300049704 Ga0501221_002605 Ga0501221_002605_1353_2108 251
173 3300049706 Ga0501229_000206 Ga0501229_000206_2821_3576 251
174 3300049757 Ga0501232_000662 Ga0501232_000662_1308_2063 251
175 3300049759 Ga0501262_005503 Ga0501262_005503_409_1164 251
176 3300049764 Ga0501267_002247 Ga0501267_002247_522_1277 251
177 3300049766 Ga0501269_001983 Ga0501269_001983_474_1229 251
178 3300049771 Ga0501274_003754 Ga0501274_003754_419_1174 251
179 3300049779 Ga0501283_003257 Ga0501283_003257_98_853 251
180 3300049822 Ga0501035_0006298 Ga0501035_0006298_407_1165 251
181 3300049823 Ga0501044_0038183 Ga0501044_0038183_3308_4066 251
182 3300050496 nmdc:mga07m45_69460_c1 nmdc:mga07m45_69460_c1_35_799 251
183 3300050512 nmdc:mga0n895_80145_c1 nmdc:mga0n895_80145_c1_743_1516 251
184 3300050515 nmdc:mga0a205_25032_c1 nmdc:mga0a205_25032_c1_3099_3872 251
185 3300053137 Ga0500561_0009960 Ga0500561_0009960_279_1043 251
186 iso_pu_bacteria 2585428057 2587725527 251
187 iso_pu_bacteria 2585428058 2587734995 251
188 iso_pu_bacteria 2585428062 2587758433 251
189 iso_pu_bacteria 2588253510 2588290527 251
190 iso_pu_bacteria 2643221592 2643970042 251
191 iso_pu_bacteria 2643221625 2644142984 251
192 iso_pu_bacteria 2643221648 2644271956 251
193 iso_pu_bacteria 2643221654 2644303313 251
194 iso_pu_bacteria 2842733646 2842736416 251
195 iso_pu_bacteria 2885192300 2885196990 251
196 3300048924 Ga0496121_0010291 Ga0496121_0010291_1779_2558 252
197 3300049742 Ga0501080_0053880 Ga0501080_0053880_2690_3448 252
198 3300003792 Ga0055540_1038671 Ga0055540_10386711 253
199 3300005459 Ga0068867_100039987 Ga0068867_1000399872 253
200 3300005467 Ga0070706_100259897 Ga0070706_1002598973 253
201 3300005843 Ga0068860_100177313 Ga0068860_1001773133 253
202 3300006042 Ga0075368_10002096 Ga0075368_100020966 253
203 3300006048 Ga0075363_100036439 Ga0075363_1000364392 253
204 3300006178 Ga0075367_10013598 Ga0075367_100135985 253
205 3300006195 Ga0075366_10018370 Ga0075366_100183704 253
206 3300006195 Ga0075366_10034591 Ga0075366_100345912 253
207 3300006195 Ga0075366_10055744 Ga0075366_100557443 253
208 3300006195 Ga0075366_10084801 Ga0075366_100848012 253
209 3300006353 Ga0075370_10000133 Ga0075370_1000013319 253
210 3300006353 Ga0075370_10001450 Ga0075370_100014502 253
211 3300006353 Ga0075370_10013745 Ga0075370_100137455 253
212 3300009148 Ga0105243_10079507 Ga0105243_100795072 253
213 3300009176 Ga0105242_10436922 Ga0105242_104369221 253
214 3300025303 Ga0209051_1010607 Ga0209051_10106075 253
215 3300025910 Ga0207684_10401818 Ga0207684_104018181 253
216 3300025935 Ga0207709_10042931 Ga0207709_100429312 253
217 3300026089 Ga0207648_10050744 Ga0207648_100507444 253
218 3300028786 Ga0307517_10005635 Ga0307517_1000563510 253
219 3300028794 Ga0307515_10000382 Ga0307515_1000038211 253
220 3300031730 Ga0307516_10031563 Ga0307516_100315636 253
221 3300031730 Ga0307516_10179339 Ga0307516_101793392 253
222 3300033180 Ga0307510_10017213 Ga0307510_100172132 253
223 3300037471 Ga0395905_0458190 Ga0395905_0458190_245_1006 253
224 3300042876 Ga0451577_0008906 Ga0451577_0008906_7707_8480 253
225 3300044712 Ga0453684_0366101 Ga0453684_0366101_116_883 253
226 3300049579 Ga0501043_0000002 Ga0501043_0000002_217132_217911 253
227 3300049580 Ga0501046_0000008 Ga0501046_0000008_217215_217994 253
228 3300049581 Ga0501047_0000003 Ga0501047_0000003_240397_241176 253
229 3300049582 Ga0501048_0001479 Ga0501048_0001479_2518_3297 253
230 3300049824 Ga0501045_0003417 Ga0501045_0003417_7691_8470 253
231 3300050493 nmdc:mga0k408_20607_c1 nmdc:mga0k408_20607_c1_2023_2793 253
232 3300050493 nmdc:mga0k408_31894_c1 nmdc:mga0k408_31894_c1_2226_2996 253
233 3300050493 nmdc:mga0k408_64479_c1 nmdc:mga0k408_64479_c1_245_1024 253
234 3300050496 nmdc:mga07m45_5336_c1 nmdc:mga07m45_5336_c1_1723_2493 253
235 3300050496 nmdc:mga07m45_847_c1 nmdc:mga07m45_847_c1_3334_4104 253
236 3300053088 Ga0500644_0003424 Ga0500644_0003424_356_1126 253
237 3300053093 Ga0500651_0135077 Ga0500651_0135077_441_1211 253
238 3300053136 Ga0500559_0000013 Ga0500559_0000013_101695_102465 253
239 3300053156 Ga0500622_0019490 Ga0500622_0019490_173_943 253
240 3300053739 Ga0500587_005845 Ga0500587_005845_521_1291 253
241 iso_pu_bacteria 2739367655 2739611316 253
242 iso_pu_bacteria 2881927736 2881929868 253
243 iso_pu_bacteria 2887375801 2887376220 253
244 3300002773 JGI25152J39213_1000516 JGI25152J39213_10005166 254
245 3300002774 JGI25150J39212_1009378 JGI25150J39212_10093782 254
246 3300003215 JGI25153J46596_10000543 JGI25153J46596_1000054319 254
247 3300003215 JGI25153J46596_10005712 JGI25153J46596_100057123 254
248 3300003320 rootH2_10002268 rootH2_100022683 254
249 3300003771 Ga0055526_1007216 Ga0055526_10072164 254
250 3300005262 Ga0065165_1000521 Ga0065165_10005215 254
251 3300005262 Ga0065165_1002331 Ga0065165_100233111 254
252 3300005331 Ga0070670_100010621 Ga0070670_1000106215 254
253 3300005333 Ga0070677_10000741 Ga0070677_100007413 254
254 3300005338 Ga0068868_100022204 Ga0068868_1000222043 254
255 3300005344 Ga0070661_100000361 Ga0070661_10000036119 254
256 3300005354 Ga0070675_100000345 Ga0070675_10000034515 254
257 3300005354 Ga0070675_100607702 Ga0070675_1006077021 254
258 3300005355 Ga0070671_100037374 Ga0070671_1000373745 254
259 3300005355 Ga0070671_100062581 Ga0070671_1000625813 254
260 3300005356 Ga0070674_100003690 Ga0070674_1000036904 254
261 3300005356 Ga0070674_100026418 Ga0070674_1000264182 254
262 3300005364 Ga0070673_100048015 Ga0070673_1000480151 254
263 3300005366 Ga0070659_100001606 Ga0070659_10000160618 254
264 3300005455 Ga0070663_100141706 Ga0070663_1001417061 254
265 3300005455 Ga0070663_100362828 Ga0070663_1003628282 254
266 3300005456 Ga0070678_100045152 Ga0070678_1000451523 254
267 3300005456 Ga0070678_100206299 Ga0070678_1002062992 254
268 3300005459 Ga0068867_100042155 Ga0068867_1000421552 254
269 3300005459 Ga0068867_100152324 Ga0068867_1001523243 254
270 3300005539 Ga0068853_100296793 Ga0068853_1002967932 254
271 3300005543 Ga0070672_100000229 Ga0070672_10000022928 254
272 3300005548 Ga0070665_100008299 Ga0070665_10000829910 254
273 3300005548 Ga0070665_100110937 Ga0070665_1001109373 254
274 3300005563 Ga0068855_100074829 Ga0068855_1000748294 254
275 3300005564 Ga0070664_100001095 Ga0070664_10000109516 254
276 3300005618 Ga0068864_100085934 Ga0068864_1000859342 254
277 3300005834 Ga0068851_10089650 Ga0068851_100896502 254
278 3300005840 Ga0068870_10024913 Ga0068870_100249133 254
279 3300005841 Ga0068863_100343394 Ga0068863_1003433941 254
280 3300006048 Ga0075363_100007907 Ga0075363_1000079077 254
281 3300006195 Ga0075366_10005804 Ga0075366_100058047 254
282 3300006195 Ga0075366_10016366 Ga0075366_100163664 254
283 3300006195 Ga0075366_10034296 Ga0075366_100342962 254
284 3300006237 Ga0097621_100264535 Ga0097621_1002645352 254
285 3300006353 Ga0075370_10010590 Ga0075370_100105903 254
286 3300006353 Ga0075370_10061761 Ga0075370_100617613 254
287 3300006353 Ga0075370_10167909 Ga0075370_101679092 254
288 3300006881 Ga0068865_100078479 Ga0068865_1000784793 254
289 3300009098 Ga0105245_10376253 Ga0105245_103762532 254
290 3300009148 Ga0105243_10041618 Ga0105243_100416183 254
291 3300009176 Ga0105242_10470836 Ga0105242_104708363 254
292 3300013296 Ga0157374_10077294 Ga0157374_100772943 254
293 3300013297 Ga0157378_10174826 Ga0157378_101748262 254
294 3300013308 Ga0157375_10161725 Ga0157375_101617253 254
295 3300014497 Ga0182008_10001633 Ga0182008_100016338 254
296 3300014969 Ga0157376_10210490 Ga0157376_102104903 254
297 3300017792 Ga0163161_10001851 Ga0163161_1000185110 254
298 3300025245 Ga0207425_1000426 Ga0207425_10004263 254
299 3300025258 Ga0209129_1000269 Ga0209129_100026949 254
300 3300025273 Ga0209673_1002449 Ga0209673_10024498 254
301 3300025273 Ga0209673_1006112 Ga0209673_10061124 254
302 3300025295 Ga0209564_1000300 Ga0209564_100030049 254
303 3300025297 Ga0209758_1000453 Ga0209758_100045344 254
304 3300025297 Ga0209758_1000605 Ga0209758_100060530 254
305 3300025298 Ga0209050_1000770 Ga0209050_100077022 254
306 3300025321 Ga0207656_10054319 Ga0207656_100543193 254
307 3300025893 Ga0207682_10001493 Ga0207682_100014935 254
308 3300025907 Ga0207645_10147664 Ga0207645_101476642 254
309 3300025908 Ga0207643_10013289 Ga0207643_100132894 254
310 3300025919 Ga0207657_10082993 Ga0207657_100829932 254
311 3300025920 Ga0207649_10000335 Ga0207649_1000033514 254
312 3300025925 Ga0207650_10000230 Ga0207650_1000023030 254
313 3300025926 Ga0207659_10562769 Ga0207659_105627692 254
314 3300025927 Ga0207687_10014332 Ga0207687_100143323 254
315 3300025931 Ga0207644_10012592 Ga0207644_100125926 254
316 3300025931 Ga0207644_10166785 Ga0207644_101667852 254
317 3300025932 Ga0207690_10000176 Ga0207690_1000017623 254
318 3300025937 Ga0207669_10008524 Ga0207669_100085242 254
319 3300025940 Ga0207691_10000681 Ga0207691_1000068120 254
320 3300025945 Ga0207679_10000168 Ga0207679_100001689 254
321 3300025949 Ga0207667_10061276 Ga0207667_100612764 254
322 3300026023 Ga0207677_10015578 Ga0207677_100155785 254
323 3300026023 Ga0207677_10103338 Ga0207677_101033381 254
324 3300026041 Ga0207639_10269695 Ga0207639_102696952 254
325 3300026088 Ga0207641_10380090 Ga0207641_103800902 254
326 3300026088 Ga0207641_10603217 Ga0207641_106032171 254
327 3300026095 Ga0207676_10119757 Ga0207676_101197572 254
328 3300027866 Ga0209813_10050727 Ga0209813_100507271 254
329 3300028379 Ga0268266_10656411 Ga0268266_106564111 254
330 3300028379 Ga0268266_10769069 Ga0268266_107690691 254
331 3300028786 Ga0307517_10098192 Ga0307517_100981922 254
332 3300028794 Ga0307515_10030153 Ga0307515_100301537 254
333 3300031456 Ga0307513_10071479 Ga0307513_100714794 254
334 3300031507 Ga0307509_10000063 Ga0307509_10000063112 254
335 3300031548 Ga0307408_100226249 Ga0307408_1002262492 254
336 3300031616 Ga0307508_10000109 Ga0307508_1000010931 254
337 3300031616 Ga0307508_10005254 Ga0307508_100052549 254
338 3300031649 Ga0307514_10029981 Ga0307514_100299815 254
339 3300031649 Ga0307514_10077236 Ga0307514_100772362 254
340 3300031730 Ga0307516_10001245 Ga0307516_1000124523 254
341 3300031824 Ga0307413_10083624 Ga0307413_100836242 254
342 3300031852 Ga0307410_10022243 Ga0307410_100222432 254
343 3300031901 Ga0307406_10007608 Ga0307406_100076085 254
344 3300031911 Ga0307412_10036594 Ga0307412_100365943 254
345 3300032002 Ga0307416_100059775 Ga0307416_1000597752 254
346 3300032005 Ga0307411_10144890 Ga0307411_101448902 254
347 3300032126 Ga0307415_100112331 Ga0307415_1001123312 254
348 3300033179 Ga0307507_10209700 Ga0307507_102097002 254
349 3300033180 Ga0307510_10004418 Ga0307510_1000441816 254
350 3300041459 Ga0451800_1581513 Ga0451800_1581513_933_1709 254
351 3300042876 Ga0451577_0394457 Ga0451577_0394457_324_1088 254
352 3300044656 Ga0466969_0000020 Ga0466969_0000020_35503_36279 254
353 3300044656 Ga0466969_0189657 Ga0466969_0189657_39_818 254
354 3300044683 Ga0466965_0043431 Ga0466965_0043431_719_1498 254
355 3300044684 Ga0466966_0013049 Ga0466966_0013049_762_1541 254
356 3300044684 Ga0466966_0145052 Ga0466966_0145052_38_814 254
357 3300044693 Ga0466961_0029661 Ga0466961_0029661_93_872 254
358 3300044694 Ga0466963_0301687 Ga0466963_0301687_249_1028 254
359 3300044706 Ga0466964_0021846 Ga0466964_0021846_93_872 254
360 3300044765 Ga0466970_0030545 Ga0466970_0030545_190_969 254
361 3300044842 Ga0466957_0142010 Ga0466957_0142010_272_1051 254
362 3300045049 Ga0466959_0000210 Ga0466959_0000210_31700_32479 254
363 3300045049 Ga0466959_0163203 Ga0466959_0163203_703_1479 254
364 3300045051 Ga0451576_0047445 Ga0451576_0047445_2624_3388 254
365 3300046454 Ga0495592_0006972 Ga0495592_0006972_6397_7170 254
366 3300046507 Ga0495606_0121912 Ga0495606_0121912_741_1517 254
367 3300046517 Ga0495630_0364834 Ga0495630_0364834_220_987 254
368 3300046680 Ga0495646_0047667 Ga0495646_0047667_209_982 254
369 3300047321 Ga0495676_0007213 Ga0495676_0007213_8647_9414 254
370 3300048905 Ga0496102_0006127 Ga0496102_0006127_1287_2051 254
371 3300048909 Ga0496106_0007087 Ga0496106_0007087_4384_5157 254
372 3300048925 Ga0496122_0000612 Ga0496122_0000612_51032_51796 254
373 3300048926 Ga0496123_0000274 Ga0496123_0000274_50000_50764 254
374 3300048927 Ga0496124_0000108 Ga0496124_0000108_134684_135460 254
375 3300048928 Ga0496125_0014355 Ga0496125_0014355_5267_6043 254
376 3300049649 Ga0501198_000024 Ga0501198_000024_23027_23839 254
377 3300049662 Ga0501222_000020 Ga0501222_000020_43351_44163 254
378 3300049822 Ga0501035_0325646 Ga0501035_0325646_362_1150 254
379 3300050489 nmdc:mga03683_68446_c1 nmdc:mga03683_68446_c1_114_890 254
380 3300050493 nmdc:mga0k408_22368_c1 nmdc:mga0k408_22368_c1_77_847 254
381 3300050493 nmdc:mga0k408_26608_c1 nmdc:mga0k408_26608_c1_943_1719 254
382 3300050493 nmdc:mga0k408_6011_c1 nmdc:mga0k408_6011_c1_5038_5802 254
383 3300050496 nmdc:mga07m45_4966_c2 nmdc:mga07m45_4966_c2_1779_2561 254
384 3300050496 nmdc:mga07m45_5339_c1 nmdc:mga07m45_5339_c1_277_1041 254
385 3300050511 nmdc:mga08y16_608942_c1 nmdc:mga08y16_608942_c1_291_1061 254
386 3300053086 Ga0500578_0110065 Ga0500578_0110065_429_1202 254
387 3300053093 Ga0500651_0080058 Ga0500651_0080058_469_1245 254
388 3300053131 Ga0500652_000177 Ga0500652_000177_14393_15169 254
389 3300053156 Ga0500622_0004247 Ga0500622_0004247_3128_3904 254
390 3300053724 Ga0500570_103326 Ga0500570_103326_309_1085 254
391 3300005328 Ga0070676_10297556 Ga0070676_102975562 255
392 3300005354 Ga0070675_100066125 Ga0070675_1000661252 255
393 3300005356 Ga0070674_100181127 Ga0070674_1001811272 255
394 3300005456 Ga0070678_100243295 Ga0070678_1002432952 255
395 3300005543 Ga0070672_100083064 Ga0070672_1000830643 255
396 3300005578 Ga0068854_100246202 Ga0068854_1002462021 255
397 3300005844 Ga0068862_100015164 Ga0068862_1000151646 255
398 3300006237 Ga0097621_100619378 Ga0097621_1006193782 255
399 3300009148 Ga0105243_10064760 Ga0105243_100647602 255
400 3300013306 Ga0163162_10198545 Ga0163162_101985452 255
401 3300014968 Ga0157379_10016771 Ga0157379_100167712 255
402 3300015262 Ga0182007_10003809 Ga0182007_100038094 255
403 3300017792 Ga0163161_10126584 Ga0163161_101265841 255
404 3300025907 Ga0207645_10045823 Ga0207645_100458233 255
405 3300025927 Ga0207687_10051884 Ga0207687_100518843 255
406 3300025940 Ga0207691_10012349 Ga0207691_100123493 255
407 3300025981 Ga0207640_10134770 Ga0207640_101347702 255
408 3300025986 Ga0207658_10142722 Ga0207658_101427223 255
409 3300026089 Ga0207648_10024898 Ga0207648_100248983 255
410 3300026116 Ga0207674_10010750 Ga0207674_100107504 255
411 3300031251 Ga0265327_10000789 Ga0265327_1000078923 255
412 3300031507 Ga0307509_10040214 Ga0307509_100402143 255
413 3300037068 Ga0373925_0155437 Ga0373925_0155437_92_880 255
414 3300041404 Ga0439436_0001048 Ga0439436_0001048_5122_5889 255
415 3300041407 Ga0439447_023051 Ga0439447_023051_320_1087 255
416 3300041411 Ga0439466_0004086 Ga0439466_0004086_3265_4032 255
417 3300041997 Ga0439431_0000483 Ga0439431_0000483_3050_3817 255
418 3300041999 Ga0439433_0002772 Ga0439433_0002772_1352_2119 255
419 3300042002 Ga0439442_024130 Ga0439442_024130_42_809 255
420 3300042004 Ga0439445_0059399 Ga0439445_0059399_108_875 255
421 3300042006 Ga0439432_001040 Ga0439432_001040_7067_7834 255
422 3300042007 Ga0439449_0001389 Ga0439449_0001389_5581_6348 255
423 3300042007 Ga0439449_0032823 Ga0439449_0032823_244_1011 255
424 3300042435 Ga0439434_0024175 Ga0439434_0024175_832_1599 255
425 3300046457 Ga0495590_0042912 Ga0495590_0042912_198_965 255
426 3300046475 Ga0495639_0023242 Ga0495639_0023242_1024_1791 255
427 3300046663 Ga0495635_0348180 Ga0495635_0348180_154_921 255
428 3300046690 Ga0495624_0036674 Ga0495624_0036674_1553_2359 255
429 3300048903 Ga0496100_0009165 Ga0496100_0009165_1674_2441 255
430 3300048904 Ga0496101_0004382 Ga0496101_0004382_7580_8347 255
431 3300048914 Ga0496111_0071605 Ga0496111_0071605_980_1747 255
432 3300053136 Ga0500559_0004164 Ga0500559_0004164_969_1736 255
433 3300053156 Ga0500622_0100443 Ga0500622_0100443_544_1332 255
434 iso_pu_bacteria 2928115317 2928118038 255
435 3300005328 Ga0070676_10043832 Ga0070676_100438322 256
436 3300005330 Ga0070690_100097048 Ga0070690_1000970482 256
437 3300005331 Ga0070670_100380408 Ga0070670_1003804081 256
438 3300005333 Ga0070677_10131373 Ga0070677_101313732 256
439 3300005335 Ga0070666_10375841 Ga0070666_103758411 256
440 3300005338 Ga0068868_100002184 Ga0068868_1000021845 256
441 3300005338 Ga0068868_100077659 Ga0068868_1000776594 256
442 3300005338 Ga0068868_100257875 Ga0068868_1002578751 256
443 3300005340 Ga0070689_100154089 Ga0070689_1001540892 256
444 3300005343 Ga0070687_100087950 Ga0070687_1000879502 256
445 3300005344 Ga0070661_100045911 Ga0070661_1000459114 256
446 3300005347 Ga0070668_100232233 Ga0070668_1002322331 256
447 3300005354 Ga0070675_100005881 Ga0070675_10000588110 256
448 3300005354 Ga0070675_100160050 Ga0070675_1001600502 256
449 3300005354 Ga0070675_100352375 Ga0070675_1003523751 256
450 3300005355 Ga0070671_100001168 Ga0070671_1000011681 256
451 3300005355 Ga0070671_100006977 Ga0070671_1000069774 256
452 3300005355 Ga0070671_100255293 Ga0070671_1002552932 256
453 3300005355 Ga0070671_100427027 Ga0070671_1004270271 256
454 3300005356 Ga0070674_100029445 Ga0070674_1000294451 256
455 3300005356 Ga0070674_100313785 Ga0070674_1003137852 256
456 3300005364 Ga0070673_100011217 Ga0070673_1000112173 256
457 3300005364 Ga0070673_100465855 Ga0070673_1004658551 256
458 3300005365 Ga0070688_100104820 Ga0070688_1001048202 256
459 3300005367 Ga0070667_100515932 Ga0070667_1005159321 256
460 3300005438 Ga0070701_10301101 Ga0070701_103011011 256
461 3300005441 Ga0070700_100015225 Ga0070700_1000152251 256
462 3300005456 Ga0070678_100061182 Ga0070678_1000611822 256
463 3300005456 Ga0070678_100293416 Ga0070678_1002934162 256
464 3300005456 Ga0070678_100505917 Ga0070678_1005059171 256
465 3300005457 Ga0070662_100092313 Ga0070662_1000923132 256
466 3300005459 Ga0068867_100051624 Ga0068867_1000516242 256
467 3300005459 Ga0068867_100464269 Ga0068867_1004642691 256
468 3300005543 Ga0070672_100033131 Ga0070672_1000331315 256
469 3300005543 Ga0070672_100127409 Ga0070672_1001274092 256
470 3300005543 Ga0070672_100178702 Ga0070672_1001787022 256
471 3300005543 Ga0070672_100461019 Ga0070672_1004610192 256
472 3300005564 Ga0070664_100468852 Ga0070664_1004688522 256
473 3300005616 Ga0068852_100130740 Ga0068852_1001307402 256
474 3300005617 Ga0068859_100016893 Ga0068859_1000168934 256
475 3300005618 Ga0068864_100003420 Ga0068864_1000034206 256
476 3300005618 Ga0068864_100084362 Ga0068864_1000843623 256
477 3300005618 Ga0068864_100095719 Ga0068864_1000957192 256
478 3300005719 Ga0068861_100184381 Ga0068861_1001843812 256
479 3300005841 Ga0068863_100002555 Ga0068863_10000255511 256
480 3300005842 Ga0068858_100003018 Ga0068858_10000301819 256
481 3300005842 Ga0068858_100221385 Ga0068858_1002213852 256
482 3300005844 Ga0068862_100072879 Ga0068862_1000728793 256
483 3300006051 Ga0075364_10000064 Ga0075364_1000006417 256
484 3300006051 Ga0075364_10020412 Ga0075364_100204123 256
485 3300006881 Ga0068865_100197302 Ga0068865_1001973022 256
486 3300006931 Ga0097620_100016893 Ga0097620_1000168936 256
487 3300009098 Ga0105245_10295752 Ga0105245_102957522 256
488 3300009177 Ga0105248_10166922 Ga0105248_101669223 256
489 3300009177 Ga0105248_10899838 Ga0105248_108998381 256
490 3300009177 Ga0105248_10979104 Ga0105248_109791042 256
491 3300009553 Ga0105249_10033740 Ga0105249_100337402 256
492 3300009553 Ga0105249_10468261 Ga0105249_104682611 256
493 3300013296 Ga0157374_10060726 Ga0157374_100607262 256
494 3300013296 Ga0157374_10544521 Ga0157374_105445211 256
495 3300013306 Ga0163162_10059242 Ga0163162_100592425 256
496 3300013308 Ga0157375_10009144 Ga0157375_100091443 256
497 3300014325 Ga0163163_10039345 Ga0163163_100393454 256
498 3300014325 Ga0163163_10331363 Ga0163163_103313632 256
499 3300014326 Ga0157380_10065129 Ga0157380_100651293 256
500 3300017792 Ga0163161_10471997 Ga0163161_104719972 256
501 3300025315 Ga0207697_10020000 Ga0207697_100200001 256
502 3300025893 Ga0207682_10018894 Ga0207682_100188941 256
503 3300025893 Ga0207682_10026689 Ga0207682_100266892 256
504 3300025899 Ga0207642_10185226 Ga0207642_101852261 256
505 3300025907 Ga0207645_10018015 Ga0207645_100180155 256
506 3300025918 Ga0207662_10042029 Ga0207662_100420292 256
507 3300025923 Ga0207681_10031313 Ga0207681_100313135 256
508 3300025923 Ga0207681_10149690 Ga0207681_101496902 256
509 3300025925 Ga0207650_10009807 Ga0207650_100098071 256
510 3300025925 Ga0207650_10109025 Ga0207650_101090252 256
511 3300025926 Ga0207659_10006351 Ga0207659_100063513 256
512 3300025926 Ga0207659_10039115 Ga0207659_100391153 256
513 3300025931 Ga0207644_10006307 Ga0207644_100063076 256
514 3300025931 Ga0207644_10051464 Ga0207644_100514643 256
515 3300025933 Ga0207706_10227064 Ga0207706_102270642 256
516 3300025935 Ga0207709_10315696 Ga0207709_103156962 256
517 3300025936 Ga0207670_10015720 Ga0207670_100157202 256
518 3300025937 Ga0207669_10109822 Ga0207669_101098222 256
519 3300025937 Ga0207669_10129968 Ga0207669_101299681 256
520 3300025938 Ga0207704_10061517 Ga0207704_100615173 256
521 3300025940 Ga0207691_10300713 Ga0207691_103007132 256
522 3300025941 Ga0207711_10016311 Ga0207711_100163112 256
523 3300025941 Ga0207711_10090689 Ga0207711_100906894 256
524 3300025941 Ga0207711_10134673 Ga0207711_101346731 256
525 3300025960 Ga0207651_10136651 Ga0207651_101366512 256
526 3300025961 Ga0207712_10031683 Ga0207712_100316835 256
527 3300025961 Ga0207712_10212147 Ga0207712_102121472 256
528 3300025972 Ga0207668_10221587 Ga0207668_102215872 256
529 3300025986 Ga0207658_10025833 Ga0207658_100258334 256
530 3300025986 Ga0207658_10031284 Ga0207658_100312844 256
531 3300026035 Ga0207703_10012819 Ga0207703_100128194 256
532 3300026035 Ga0207703_10624673 Ga0207703_106246731 256
533 3300026075 Ga0207708_10022695 Ga0207708_100226952 256
534 3300026088 Ga0207641_10083955 Ga0207641_100839552 256
535 3300026088 Ga0207641_10113960 Ga0207641_101139602 256
536 3300026095 Ga0207676_10001953 Ga0207676_1000195319 256
537 3300026095 Ga0207676_10126745 Ga0207676_101267452 256
538 3300026095 Ga0207676_10315668 Ga0207676_103156682 256
539 3300026118 Ga0207675_100008514 Ga0207675_1000085149 256
540 3300026121 Ga0207683_10006633 Ga0207683_1000663311 256
541 3300026121 Ga0207683_10409194 Ga0207683_104091942 256
542 3300026142 Ga0207698_10076176 Ga0207698_100761763 256
543 3300026142 Ga0207698_10125036 Ga0207698_101250362 256
544 3300026142 Ga0207698_10368060 Ga0207698_103680601 256
545 3300028380 Ga0268265_10222213 Ga0268265_102222131 256
546 3300036401 Ga0373937_0630638 Ga0373937_0630638_175_981 256
547 3300046543 Ga0495645_0133854 Ga0495645_0133854_299_1105 256
548 3300046683 Ga0495658_0075719 Ga0495658_0075719_641_1447 256
549 3300047319 Ga0495674_0290321 Ga0495674_0290321_188_994 256
550 3300048907 Ga0496104_0269833 Ga0496104_0269833_150_956 256
551 3300048911 Ga0496108_0036590 Ga0496108_0036590_664_1467 256
552 3300048911 Ga0496108_0317044 Ga0496108_0317044_184_990 256
553 3300048917 Ga0496114_0194525 Ga0496114_0194525_148_951 256
554 3300049570 Ga0501033_0111228 Ga0501033_0111228_804_1613 256
555 3300049574 Ga0501038_0114468 Ga0501038_0114468_227_1036 256
556 3300049581 Ga0501047_0076103 Ga0501047_0076103_1319_2128 256
557 3300049822 Ga0501035_0141426 Ga0501035_0141426_1280_2071 256
558 3300049823 Ga0501044_0004069 Ga0501044_0004069_14093_14902 256
559 3300049823 Ga0501044_0089818 Ga0501044_0089818_1633_2424 256
560 3300049823 Ga0501044_0227929 Ga0501044_0227929_902_1693 256
561 3300050491 nmdc:mga00v17_18021_c1 nmdc:mga00v17_18021_c1_2872_3705 256
562 3300050491 nmdc:mga00v17_29017_c1 nmdc:mga00v17_29017_c1_682_1557 256
563 3300050491 nmdc:mga00v17_69137_c1 nmdc:mga00v17_69137_c1_733_1608 256
564 3300053148 Ga0500590_077134 Ga0500590_077134_106_876 256
565 iso_pu_bacteria 8002392321 8002395896 256
566 iso_pu_bacteria 8055225921 8055228459 256
567 3300003187 JGI25151J46595_10000121 JGI25151J46595_1000012151 257
568 3300003763 Ga0055529_1001095 Ga0055529_10010959 257
569 3300005327 Ga0070658_10293216 Ga0070658_102932161 257
570 3300005355 Ga0070671_100137745 Ga0070671_1001377452 257
571 3300005364 Ga0070673_100092831 Ga0070673_1000928312 257
572 3300005456 Ga0070678_100103672 Ga0070678_1001036722 257
573 3300005543 Ga0070672_100007945 Ga0070672_1000079453 257
574 3300005543 Ga0070672_100077310 Ga0070672_1000773104 257
575 3300005563 Ga0068855_100257578 Ga0068855_1002575782 257
576 3300005614 Ga0068856_100846951 Ga0068856_1008469511 257
577 3300005616 Ga0068852_100418408 Ga0068852_1004184082 257
578 3300005618 Ga0068864_100001954 Ga0068864_10000195414 257
579 3300005618 Ga0068864_100266993 Ga0068864_1002669932 257
580 3300006237 Ga0097621_100082815 Ga0097621_1000828154 257
581 3300006358 Ga0068871_100051059 Ga0068871_1000510593 257
582 3300006358 Ga0068871_100191824 Ga0068871_1001918242 257
583 3300009036 Ga0105244_10038976 Ga0105244_100389763 257
584 3300009176 Ga0105242_10040441 Ga0105242_100404413 257
585 3300009177 Ga0105248_10004052 Ga0105248_1000405218 257
586 3300013296 Ga0157374_10071555 Ga0157374_100715552 257
587 3300013297 Ga0157378_10097588 Ga0157378_100975882 257
588 3300013308 Ga0157375_10264666 Ga0157375_102646662 257
589 3300025272 Ga0209455_1000447 Ga0209455_10004475 257
590 3300025292 Ga0209676_1006101 Ga0209676_10061012 257
591 3300025294 Ga0209025_1000019 Ga0209025_1000019115 257
592 3300025303 Ga0209051_1034612 Ga0209051_10346122 257
593 3300025321 Ga0207656_10053271 Ga0207656_100532712 257
594 3300025909 Ga0207705_10195193 Ga0207705_101951933 257
595 3300025920 Ga0207649_10360688 Ga0207649_103606881 257
596 3300025925 Ga0207650_10007627 Ga0207650_100076275 257
597 3300025927 Ga0207687_10188673 Ga0207687_101886732 257
598 3300025931 Ga0207644_10071322 Ga0207644_100713222 257
599 3300025931 Ga0207644_10345904 Ga0207644_103459041 257
600 3300025934 Ga0207686_10038520 Ga0207686_100385203 257
601 3300025940 Ga0207691_10059728 Ga0207691_100597282 257
602 3300025945 Ga0207679_10117672 Ga0207679_101176723 257
603 3300025949 Ga0207667_10057815 Ga0207667_100578155 257
604 3300025960 Ga0207651_10037610 Ga0207651_100376103 257
605 3300026067 Ga0207678_10034429 Ga0207678_100344291 257
606 3300026089 Ga0207648_10077174 Ga0207648_100771743 257
607 3300026095 Ga0207676_10112721 Ga0207676_101127213 257
608 3300026142 Ga0207698_10106125 Ga0207698_101061253 257
609 3300028666 Ga0265336_10000024 Ga0265336_10000024122 257
610 3300029957 Ga0265324_10001883 Ga0265324_1000188313 257
611 3300030500 Ga0268256_1026036 Ga0268256_10260362 257
612 3300030521 Ga0307511_10155354 Ga0307511_101553542 257
613 3300031616 Ga0307508_10201116 Ga0307508_102011162 257
614 3300031730 Ga0307516_10000676 Ga0307516_1000067648 257
615 3300031911 Ga0307412_10000061 Ga0307412_1000006133 257
616 3300035692 Ga0373935_0492792 Ga0373935_0492792_67_876 257
617 3300041452 Ga0451793_0140833 Ga0451793_0140833_583_1356 257
618 3300044735 Ga0466968_0006113 Ga0466968_0006113_2288_3106 257
619 3300046471 Ga0495650_0024628 Ga0495650_0024628_62_835 257
620 3300046543 Ga0495645_0073438 Ga0495645_0073438_1067_1879 257
621 3300046660 Ga0495625_0004651 Ga0495625_0004651_8936_9709 257
622 3300047472 Ga0495686_0023580 Ga0495686_0023580_2863_3636 257
623 3300048912 Ga0496109_0009016 Ga0496109_0009016_4949_5731 257
624 3300048913 Ga0496110_0057567 Ga0496110_0057567_2191_2973 257
625 3300048915 Ga0496112_0004885 Ga0496112_0004885_4795_5592 257
626 3300048919 Ga0496116_0022632 Ga0496116_0022632_2317_3129 257
627 3300048919 Ga0496116_0024092 Ga0496116_0024092_1168_1980 257
628 3300048920 Ga0496117_0009792 Ga0496117_0009792_2192_3004 257
629 3300048920 Ga0496117_0069549 Ga0496117_0069549_391_1203 257
630 3300048921 Ga0496118_0011294 Ga0496118_0011294_6585_7397 257
631 3300048921 Ga0496118_0018649 Ga0496118_0018649_3972_4784 257
632 3300048922 Ga0496119_0028700 Ga0496119_0028700_1229_2041 257
633 3300048923 Ga0496120_0004304 Ga0496120_0004304_2697_3509 257
634 3300048924 Ga0496121_0000647 Ga0496121_0000647_43642_44454 257
635 3300048925 Ga0496122_0003062 Ga0496122_0003062_8674_9486 257
636 3300048925 Ga0496122_0022055 Ga0496122_0022055_4395_5207 257
637 3300048926 Ga0496123_0002506 Ga0496123_0002506_8860_9672 257
638 3300048927 Ga0496124_0048778 Ga0496124_0048778_2281_3093 257
639 3300048927 Ga0496124_0196702 Ga0496124_0196702_68_880 257
640 3300048928 Ga0496125_0000051 Ga0496125_0000051_157237_158049 257
641 3300048928 Ga0496125_0004939 Ga0496125_0004939_5793_6605 257
642 3300048928 Ga0496125_0272563 Ga0496125_0272563_118_930 257
643 3300048929 Ga0496126_0008185 Ga0496126_0008185_4470_5282 257
644 3300048929 Ga0496126_0015870 Ga0496126_0015870_4423_5235 257
645 3300049570 Ga0501033_0098599 Ga0501033_0098599_281_1096 257
646 3300049662 Ga0501222_001766 Ga0501222_001766_1851_2651 257
647 3300049822 Ga0501035_0026335 Ga0501035_0026335_2563_3354 257
648 3300049823 Ga0501044_0000316 Ga0501044_0000316_17024_17815 257
649 3300050496 nmdc:mga07m45_2735_c1 nmdc:mga07m45_2735_c1_4982_5755 257
650 3300053077 Ga0495601_0032309 Ga0495601_0032309_912_1721 257
651 3300053080 Ga0500635_0000008 Ga0500635_0000008_68993_69766 257
652 3300053149 Ga0500600_0009254 Ga0500600_0009254_3762_4574 257
653 iso_pu_bacteria 2599185292 2599902783 257
654 iso_pu_bacteria 2643221569 2643861620 257
655 iso_pu_bacteria 2643221594 2643980040 257
656 iso_pu_bacteria 2643221621 2644123614 257
657 iso_pu_bacteria 2808606395 2809033123 257
658 iso_pu_bacteria 2855730933 2855732820 257
659 iso_pu_bacteria 2855767633 2855771572 257
660 iso_pu_bacteria 2857537821 2857542501 257
661 iso_pu_bacteria 2857542790 2857543360 257
662 iso_pu_bacteria 2858950400 2858952208 257
663 iso_pu_bacteria 2881412998 2881415624 257
664 iso_pu_bacteria 2941479691 2941482635 257
665 iso_pu_bacteria 8048746797 8048747535 257
666 3300002705 JGI25156J39149_1016063 JGI25156J39149_10160631 258
667 3300003761 Ga0055535_1000618 Ga0055535_10006185 258
668 3300003763 Ga0055529_1000053 Ga0055529_1000053142 258
669 3300003792 Ga0055540_1005560 Ga0055540_10055603 258
670 3300014325 Ga0163163_10986658 Ga0163163_109866581 258
671 3300021361 Ga0213872_10017110 Ga0213872_100171103 258
672 3300025242 Ga0209258_100074 Ga0209258_100074104 258
673 3300025256 Ga0209759_1000909 Ga0209759_100090919 258
674 3300025272 Ga0209455_1000066 Ga0209455_1000066144 258
675 3300025303 Ga0209051_1014684 Ga0209051_10146843 258
676 3300031251 Ga0265327_10019962 Ga0265327_100199624 258
677 3300031507 Ga0307509_10177792 Ga0307509_101777922 258
678 3300037418 Ga0395900_0027656 Ga0395900_0027656_1715_2572 258
679 3300037466 Ga0395898_0152268 Ga0395898_0152268_595_1452 258
680 3300039447 Ga0436361_0039667 Ga0436361_0039667_711_1538 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

49

240

0.92

PF01061

ABC2_membrane

ABC-2 type transporter

11

213

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jr7-assembly1.cif.gz_B cryo-em structure of abcg5/g8 in complex with fab 2e10 and 11f4 0.7003 20 254
5do7-assembly2.cif.gz_D crystal structure of the human sterol transporter abcg5/abcg8 0.686 17 252
8wbx-assembly1.cif.gz_B cryo-em structure of the abcg25 bound to aba 0.6837 27 252
6oih-assembly2.cif.gz_C crystal structure of o-antigen polysaccharide abc-transporter 0.6809 8 256
8wd6-assembly1.cif.gz_A cryo-em structure of the abcg25 0.6796 26 252
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8488 55 250 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8086 56 248 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7625 34 249 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6598 55 250 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6472 34 249 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A176S4K3-F1-model_v4 Abc-type multidrug transport system, permease component 0.9642 59 258 GO:0005886
GO:0140359
AF-A0A4Q3TZG4-F1-model_v4 Transport permease protein 0.9608 62 258 GO:0043190
GO:0140359
AF-A0A381YL02-F1-model_v4 ABC transmembrane type-2 domain-containing protein 0.9555 67 258 GO:0005886
GO:0140359
AF-A0A176S4K3-F1-model_v4 Abc-type multidrug transport system, permease component 0.9549 59 258 GO:0005886
GO:0140359
AF-A0A1G1J6N7-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9523 108 258 GO:0005886
GO:0140359

Feature Viewer

pLDDT pTM Quality
84.33 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map