F474770
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 680 | 316 | 678 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10921903|Ga0105241_109219032 |
| Length | 145 |
| Sequence | LINKKILICKSINHNNKNIYMNFPENLRYTKDHEWILLEGDIATVGITDFAQHELGDIVYVEIETKGKSLAAETVFGTVEAVKTVSDLFLPVSGTIIEINPLLEKEPEKVNNDPYGDGWMIKMKVDDPDAVSRLMDKEAYQKIMA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 2 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 161 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 162 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 163 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 165 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 166 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 167 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 168 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 169 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 181 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 182 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 184 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 185 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 192 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 193 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 194 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 195 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 196 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 197 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 198 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 199 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 200 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 201 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 202 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 203 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 204 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 209 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 210 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 211 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 212 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 213 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 235 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 236 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 237 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 238 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 239 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 240 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 241 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 242 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 263 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 264 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 265 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 266 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 267 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 268 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 269 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 275 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 276 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 277 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 281 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 282 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 283 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 288 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 289 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 290 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 291 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 292 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 293 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 294 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 295 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 296 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 297 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 298 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 299 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 301 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 302 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 303 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 304 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 305 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 306 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 307 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 308 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 309 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 310 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 312 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 314 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 316 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.56 |
| Metatranscriptomes | 0 |
| Isolates | 0.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.76 |
| Nodule | 0 |
| Rhizoplane | 2.5 |
| Rhizosphere | 86.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25154J39366_1000006 | 3300002738 | Bacteria | 336396 |
| 2 | JGI25157J39369_1003000 | 3300002741 | Bacteria | 3701 |
| 3 | JGI25153J46596_10000827 | 3300003215 | Bacteria | 18904 |
| 4 | rootH1_10023398 | 3300003316 | Bacteria | 8434 |
| 5 | rootH2_10109333 | 3300003320 | Bacteria | 1259 |
| 6 | rootH1_10001241 | 3300003316 | Bacteria | 2253 |
| 7 | rootH1_10001241 | 3300003323 | Bacteria | 4779 |
| 8 | rootH1_10036348 | 3300003323 | Bacteria | 2903 |
| 9 | JGI25160J50197_1004979 | 3300003354 | Bacteria | 5636 |
| 10 | Ga0055535_1004403 | 3300003761 | Bacteria | 3431 |
| 11 | Ga0055542_1003719 | 3300003762 | Bacteria | 3987 |
| 12 | Ga0065165_1010013 | 3300005262 | Bacteria | 4168 |
| 13 | Ga0070658_10064572 | 3300005327 | Bacteria | 2986 |
| 14 | Ga0070658_10065092 | 3300005327 | Bacteria | 2974 |
| 15 | Ga0070676_10900583 | 3300005328 | Bacteria | 659 |
| 16 | Ga0070683_100001587 | 3300005329 | Bacteria | 17593 |
| 17 | Ga0070683_100250941 | 3300005329 | Bacteria | 1683 |
| 18 | Ga0070683_100783335 | 3300005329 | Unclassified | 914 |
| 19 | Ga0070683_100866395 | 3300005329 | Bacteria | 866 |
| 20 | Ga0070683_102103663 | 3300005329 | Bacteria | 542 |
| 21 | Ga0070690_100580825 | 3300005330 | Unclassified | 848 |
| 22 | Ga0070670_100056793 | 3300005331 | Bacteria | 3360 |
| 23 | Ga0070670_100151928 | 3300005331 | Bacteria | 2004 |
| 24 | Ga0070670_100318598 | 3300005331 | Bacteria | 1362 |
| 25 | Ga0070670_101202821 | 3300005331 | Bacteria | 693 |
| 26 | Ga0070677_10052159 | 3300005333 | Bacteria | 1659 |
| 27 | Ga0068869_100057460 | 3300005334 | Bacteria | 2841 |
| 28 | Ga0068869_100933983 | 3300005334 | Bacteria | 752 |
| 29 | Ga0070666_10097033 | 3300005335 | Bacteria | 2029 |
| 30 | Ga0070666_10390710 | 3300005335 | Bacteria | 999 |
| 31 | Ga0070680_100027158 | 3300005336 | Bacteria | 4584 |
| 32 | Ga0070680_100151810 | 3300005336 | Bacteria | 1945 |
| 33 | Ga0070682_100021600 | 3300005337 | Bacteria | 3801 |
| 34 | Ga0070682_100051139 | 3300005337 | Bacteria | 2582 |
| 35 | Ga0070682_100352787 | 3300005337 | Unclassified | 1097 |
| 36 | Ga0068868_100616176 | 3300005338 | Bacteria | 963 |
| 37 | Ga0068868_101215262 | 3300005338 | Bacteria | 697 |
| 38 | Ga0070660_100092212 | 3300005339 | Bacteria | 2391 |
| 39 | Ga0070689_100856546 | 3300005340 | Bacteria | 802 |
| 40 | Ga0070691_10005121 | 3300005341 | Bacteria | 5958 |
| 41 | Ga0070691_10050069 | 3300005341 | Bacteria | 1992 |
| 42 | Ga0070687_100661212 | 3300005343 | Bacteria | 725 |
| 43 | Ga0070687_101246530 | 3300005343 | Unclassified | 550 |
| 44 | Ga0070661_101386690 | 3300005344 | Bacteria | 591 |
| 45 | Ga0070668_100009533 | 3300005347 | Bacteria | 7204 |
| 46 | Ga0070668_100028705 | 3300005347 | Bacteria | 4222 |
| 47 | Ga0070668_101624260 | 3300005347 | Unclassified | 592 |
| 48 | Ga0070669_100000286 | 3300005353 | Bacteria | 39758 |
| 49 | Ga0070669_101560518 | 3300005353 | Unclassified | 574 |
| 50 | Ga0070675_100408204 | 3300005354 | Bacteria | 1213 |
| 51 | Ga0070671_100922881 | 3300005355 | Unclassified | 763 |
| 52 | Ga0070673_100162996 | 3300005364 | Bacteria | 1897 |
| 53 | Ga0070659_100463640 | 3300005366 | Bacteria | 1076 |
| 54 | Ga0070667_100099848 | 3300005367 | Bacteria | 2506 |
| 55 | Ga0070667_100467128 | 3300005367 | Bacteria | 1154 |
| 56 | Ga0070667_100560104 | 3300005367 | Bacteria | 1051 |
| 57 | Ga0070710_10132057 | 3300005437 | Bacteria | 1523 |
| 58 | Ga0070711_100661884 | 3300005439 | Unclassified | 876 |
| 59 | Ga0070705_100405228 | 3300005440 | Bacteria | 1011 |
| 60 | Ga0070694_100111413 | 3300005444 | Unclassified | 1950 |
| 61 | Ga0070708_100034768 | 3300005445 | Bacteria | 4386 |
| 62 | Ga0070663_101515561 | 3300005455 | Unclassified | 596 |
| 63 | Ga0070663_101916499 | 3300005455 | Unclassified | 532 |
| 64 | Ga0070678_100268594 | 3300005456 | Unclassified | 1437 |
| 65 | Ga0070678_100872159 | 3300005456 | Bacteria | 821 |
| 66 | Ga0070678_101500986 | 3300005456 | Unclassified | 631 |
| 67 | Ga0070681_10021141 | 3300005458 | Bacteria | 6521 |
| 68 | Ga0070681_10325793 | 3300005458 | Bacteria | 1446 |
| 69 | Ga0070681_10768457 | 3300005458 | Bacteria | 880 |
| 70 | Ga0068867_100275001 | 3300005459 | Bacteria | 1379 |
| 71 | Ga0068867_100302167 | 3300005459 | Unclassified | 1320 |
| 72 | Ga0068867_100507484 | 3300005459 | Unclassified | 1037 |
| 73 | Ga0070698_100030250 | 3300005471 | Bacteria | 5616 |
| 74 | Ga0070699_100012095 | 3300005518 | Bacteria | 7448 |
| 75 | Ga0070679_100000398 | 3300005530 | Bacteria | 37016 |
| 76 | Ga0070679_100159173 | 3300005530 | Bacteria | 2233 |
| 77 | Ga0070684_100033876 | 3300005535 | Bacteria | 4364 |
| 78 | Ga0070684_100215644 | 3300005535 | Bacteria | 1750 |
| 79 | Ga0070684_100240773 | 3300005535 | Bacteria | 1653 |
| 80 | Ga0070684_100443289 | 3300005535 | Bacteria | 1199 |
| 81 | Ga0070684_101293294 | 3300005535 | Unclassified | 686 |
| 82 | Ga0068853_100002293 | 3300005539 | Bacteria | 14302 |
| 83 | Ga0068853_100042107 | 3300005539 | Bacteria | 3903 |
| 84 | Ga0068853_100054056 | 3300005539 | Bacteria | 3460 |
| 85 | Ga0068853_100095837 | 3300005539 | Bacteria | 2617 |
| 86 | Ga0070672_100148086 | 3300005543 | Bacteria | 1941 |
| 87 | Ga0070672_100270486 | 3300005543 | Bacteria | 1435 |
| 88 | Ga0070696_100053796 | 3300005546 | Bacteria | 2803 |
| 89 | Ga0070665_100000002 | 3300005548 | Bacteria | 849037 |
| 90 | Ga0070665_100338470 | 3300005548 | Unclassified | 1509 |
| 91 | Ga0070704_102138276 | 3300005549 | Bacteria | 520 |
| 92 | Ga0068855_100000303 | 3300005563 | Bacteria | 61260 |
| 93 | Ga0068855_100055326 | 3300005563 | Unclassified | 4661 |
| 94 | Ga0068855_100066058 | 3300005563 | Bacteria | 4217 |
| 95 | Ga0068855_100070130 | 3300005563 | Bacteria | 4078 |
| 96 | Ga0068855_100310751 | 3300005563 | Unclassified | 1744 |
| 97 | Ga0068855_100818299 | 3300005563 | Bacteria | 989 |
| 98 | Ga0070664_100040078 | 3300005564 | Bacteria | 3948 |
| 99 | Ga0070664_100075140 | 3300005564 | Bacteria | 2901 |
| 100 | Ga0070664_100365483 | 3300005564 | Bacteria | 1315 |
| 101 | Ga0068857_100009853 | 3300005577 | Bacteria | 8298 |
| 102 | Ga0068857_100023721 | 3300005577 | Bacteria | 5401 |
| 103 | Ga0068857_100599898 | 3300005577 | Unclassified | 1041 |
| 104 | Ga0068854_100048807 | 3300005578 | Bacteria | 3021 |
| 105 | Ga0068854_100199560 | 3300005578 | Bacteria | 1572 |
| 106 | Ga0068854_100240485 | 3300005578 | Bacteria | 1441 |
| 107 | Ga0068854_100466724 | 3300005578 | Unclassified | 1057 |
| 108 | Ga0068854_100767449 | 3300005578 | Bacteria | 838 |
| 109 | Ga0068854_101356387 | 3300005578 | Bacteria | 642 |
| 110 | Ga0068854_101418168 | 3300005578 | Bacteria | 628 |
| 111 | Ga0068854_102209361 | 3300005578 | Bacteria | 509 |
| 112 | Ga0068856_100018889 | 3300005614 | Bacteria | 6685 |
| 113 | Ga0068856_100062498 | 3300005614 | Bacteria | 3678 |
| 114 | Ga0068856_100142153 | 3300005614 | Bacteria | 2407 |
| 115 | Ga0068852_100000744 | 3300005616 | Bacteria | 21378 |
| 116 | Ga0068852_100016599 | 3300005616 | Bacteria | 5749 |
| 117 | Ga0068852_100025486 | 3300005616 | Bacteria | 4792 |
| 118 | Ga0068852_100101947 | 3300005616 | Bacteria | 2593 |
| 119 | Ga0068852_100395602 | 3300005616 | Bacteria | 1358 |
| 120 | Ga0068859_100240106 | 3300005617 | Unclassified | 1901 |
| 121 | Ga0068859_100400910 | 3300005617 | Unclassified | 1468 |
| 122 | Ga0068859_102466703 | 3300005617 | Bacteria | 573 |
| 123 | Ga0068864_100062502 | 3300005618 | Bacteria | 3226 |
| 124 | Ga0068864_100092332 | 3300005618 | Bacteria | 2672 |
| 125 | Ga0068864_100137090 | 3300005618 | Bacteria | 2204 |
| 126 | Ga0068864_101292180 | 3300005618 | Unclassified | 730 |
| 127 | Ga0068866_10065788 | 3300005718 | Bacteria | 1897 |
| 128 | Ga0068866_10108731 | 3300005718 | Bacteria | 1543 |
| 129 | Ga0068861_100048923 | 3300005719 | Bacteria | 3199 |
| 130 | Ga0068861_101315335 | 3300005719 | Bacteria | 703 |
| 131 | Ga0068851_10151435 | 3300005834 | Unclassified | 1268 |
| 132 | Ga0068870_10106797 | 3300005840 | Bacteria | 1592 |
| 133 | Ga0068870_10539382 | 3300005840 | Unclassified | 784 |
| 134 | Ga0068870_10557603 | 3300005840 | Unclassified | 772 |
| 135 | Ga0068863_100019900 | 3300005841 | Bacteria | 6420 |
| 136 | Ga0068863_100136868 | 3300005841 | Bacteria | 2340 |
| 137 | Ga0068863_100268162 | 3300005841 | Bacteria | 1652 |
| 138 | Ga0068863_101900279 | 3300005841 | Unclassified | 605 |
| 139 | Ga0068858_100661564 | 3300005842 | Bacteria | 1015 |
| 140 | Ga0068858_100711816 | 3300005842 | Bacteria | 977 |
| 141 | Ga0068860_100000003 | 3300005843 | Bacteria | 575741 |
| 142 | Ga0068860_100001341 | 3300005843 | Bacteria | 26789 |
| 143 | Ga0068860_100005037 | 3300005843 | Bacteria | 13446 |
| 144 | Ga0068860_100196827 | 3300005843 | Unclassified | 1952 |
| 145 | Ga0068860_100348020 | 3300005843 | Bacteria | 1458 |
| 146 | Ga0068860_100890582 | 3300005843 | Bacteria | 906 |
| 147 | Ga0068860_102257620 | 3300005843 | Bacteria | 565 |
| 148 | Ga0068860_102502556 | 3300005843 | Bacteria | 536 |
| 149 | Ga0068862_100000640 | 3300005844 | Bacteria | 36163 |
| 150 | Ga0068862_100009867 | 3300005844 | Bacteria | 7886 |
| 151 | Ga0068862_100385499 | 3300005844 | Bacteria | 1308 |
| 152 | Ga0081540_1002061 | 3300005983 | Bacteria | 16771 |
| 153 | Ga0075366_10236151 | 3300006195 | Unclassified | 1114 |
| 154 | Ga0097621_100393569 | 3300006237 | Unclassified | 1239 |
| 155 | Ga0097621_100638313 | 3300006237 | Unclassified | 976 |
| 156 | Ga0097621_100664668 | 3300006237 | Unclassified | 957 |
| 157 | Ga0097621_101442364 | 3300006237 | Unclassified | 652 |
| 158 | Ga0097621_101709230 | 3300006237 | Bacteria | 599 |
| 159 | Ga0068871_100881961 | 3300006358 | Unclassified | 828 |
| 160 | Ga0075428_100093090 | 3300006844 | Bacteria | 3286 |
| 161 | Ga0075428_100412552 | 3300006844 | Bacteria | 1447 |
| 162 | Ga0075431_100391686 | 3300006847 | Unclassified | 1392 |
| 163 | Ga0068865_100206320 | 3300006881 | Bacteria | 1529 |
| 164 | Ga0068865_100523722 | 3300006881 | Bacteria | 992 |
| 165 | Ga0097620_100240104 | 3300006931 | Unclassified | 1901 |
| 166 | Ga0097620_100400904 | 3300006931 | Unclassified | 1468 |
| 167 | Ga0097620_100419814 | 3300006931 | Bacteria | 1434 |
| 168 | Ga0097620_102466855 | 3300006931 | Bacteria | 573 |
| 169 | Ga0105240_10000367 | 3300009093 | Bacteria | 84666 |
| 170 | Ga0105240_10004312 | 3300009093 | Bacteria | 21724 |
| 171 | Ga0105240_10005773 | 3300009093 | Bacteria | 18354 |
| 172 | Ga0105240_10019425 | 3300009093 | Bacteria | 9078 |
| 173 | Ga0105240_10031491 | 3300009093 | Bacteria | 6879 |
| 174 | Ga0105240_10034497 | 3300009093 | Bacteria | 6526 |
| 175 | Ga0105240_10043465 | 3300009093 | Bacteria | 5717 |
| 176 | Ga0105240_10061895 | 3300009093 | Bacteria | 4661 |
| 177 | Ga0105240_10161623 | 3300009093 | Bacteria | 2660 |
| 178 | Ga0105240_10221553 | 3300009093 | Bacteria | 2204 |
| 179 | Ga0105240_10311888 | 3300009093 | Bacteria | 1796 |
| 180 | Ga0111539_10289205 | 3300009094 | Bacteria | 1907 |
| 181 | Ga0111539_10961127 | 3300009094 | Bacteria | 993 |
| 182 | Ga0111539_11414110 | 3300009094 | Bacteria | 807 |
| 183 | Ga0111539_12901970 | 3300009094 | Bacteria | 555 |
| 184 | Ga0114129_10102207 | 3300009147 | Bacteria | 3964 |
| 185 | Ga0114129_11297970 | 3300009147 | Bacteria | 902 |
| 186 | Ga0105243_10144367 | 3300009148 | Bacteria | 2035 |
| 187 | Ga0105241_10014751 | 3300009174 | Bacteria | 5720 |
| 188 | Ga0105241_10030253 | 3300009174 | Bacteria | 4045 |
| 189 | Ga0105241_10152724 | 3300009174 | Bacteria | 1890 |
| 190 | Ga0105241_10266752 | 3300009174 | Bacteria | 1457 |
| 191 | Ga0105241_10483136 | 3300009174 | Bacteria | 1101 |
| 192 | Ga0105241_10581552 | 3300009174 | Bacteria | 1009 |
| 193 | Ga0105241_10921903 | 3300009174 | Bacteria | 813 |
| 194 | Ga0105241_11088108 | 3300009174 | Bacteria | 752 |
| 195 | Ga0105242_10073196 | 3300009176 | Unclassified | 2848 |
| 196 | Ga0105237_10004885 | 3300009545 | Bacteria | 15359 |
| 197 | Ga0105237_10023054 | 3300009545 | Bacteria | 6383 |
| 198 | Ga0105237_10061850 | 3300009545 | Bacteria | 3742 |
| 199 | Ga0105237_10066020 | 3300009545 | Bacteria | 3613 |
| 200 | Ga0105237_10162414 | 3300009545 | Bacteria | 2232 |
| 201 | Ga0105237_10167094 | 3300009545 | Bacteria | 2199 |
| 202 | Ga0105237_10858237 | 3300009545 | Bacteria | 915 |
| 203 | Ga0105238_10005360 | 3300009551 | Bacteria | 12672 |
| 204 | Ga0105238_10059649 | 3300009551 | Bacteria | 3821 |
| 205 | Ga0105238_10137755 | 3300009551 | Bacteria | 2418 |
| 206 | Ga0105238_10140744 | 3300009551 | Bacteria | 2389 |
| 207 | Ga0105238_10187971 | 3300009551 | Unclassified | 2042 |
| 208 | Ga0105238_10516926 | 3300009551 | Bacteria | 1196 |
| 209 | Ga0105238_10873947 | 3300009551 | Bacteria | 917 |
| 210 | Ga0105249_10000186 | 3300009553 | Bacteria | 71781 |
| 211 | Ga0105249_10601511 | 3300009553 | Bacteria | 1154 |
| 212 | Ga0105249_10883124 | 3300009553 | Unclassified | 960 |
| 213 | Ga0105239_10000252 | 3300010375 | Bacteria | 80006 |
| 214 | Ga0105239_10001074 | 3300010375 | Bacteria | 37985 |
| 215 | Ga0105239_10021740 | 3300010375 | Bacteria | 7072 |
| 216 | Ga0105239_10042684 | 3300010375 | Bacteria | 4969 |
| 217 | Ga0105239_10143887 | 3300010375 | Bacteria | 2658 |
| 218 | Ga0105239_10146496 | 3300010375 | Bacteria | 2634 |
| 219 | Ga0105246_10684583 | 3300011119 | Bacteria | 897 |
| 220 | Ga0105246_10794954 | 3300011119 | Bacteria | 839 |
| 221 | Ga0157373_10012126 | 3300013100 | Bacteria | 6335 |
| 222 | Ga0157373_10016610 | 3300013100 | Bacteria | 5366 |
| 223 | Ga0157373_10032389 | 3300013100 | Bacteria | 3763 |
| 224 | Ga0157373_10032587 | 3300013100 | Bacteria | 3750 |
| 225 | Ga0157373_10048751 | 3300013100 | Unclassified | 3020 |
| 226 | Ga0157371_10007530 | 3300013102 | Bacteria | 8805 |
| 227 | Ga0157371_10009681 | 3300013102 | Bacteria | 7570 |
| 228 | Ga0157371_10013530 | 3300013102 | Bacteria | 6193 |
| 229 | Ga0157371_10014129 | 3300013102 | Bacteria | 6038 |
| 230 | Ga0157371_10108747 | 3300013102 | Unclassified | 1967 |
| 231 | Ga0157370_10006582 | 3300013104 | Bacteria | 12793 |
| 232 | Ga0157370_10011323 | 3300013104 | Bacteria | 9344 |
| 233 | Ga0157370_10081542 | 3300013104 | Bacteria | 3044 |
| 234 | Ga0157370_10431861 | 3300013104 | Bacteria | 1211 |
| 235 | Ga0157369_10024734 | 3300013105 | Bacteria | 6673 |
| 236 | Ga0157369_10025573 | 3300013105 | Bacteria | 6551 |
| 237 | Ga0157369_10274277 | 3300013105 | Bacteria | 1757 |
| 238 | Ga0157374_10471708 | 3300013296 | Bacteria | 1257 |
| 239 | Ga0157378_10220608 | 3300013297 | Bacteria | 1802 |
| 240 | Ga0157378_10307575 | 3300013297 | Bacteria | 1536 |
| 241 | Ga0157378_10561088 | 3300013297 | Bacteria | 1148 |
| 242 | Ga0157378_11387635 | 3300013297 | Bacteria | 745 |
| 243 | Ga0157372_10004417 | 3300013307 | Bacteria | 14996 |
| 244 | Ga0157372_10013597 | 3300013307 | Bacteria | 8700 |
| 245 | Ga0157372_10030899 | 3300013307 | Bacteria | 5861 |
| 246 | Ga0157372_10034708 | 3300013307 | Bacteria | 5548 |
| 247 | Ga0157372_10070354 | 3300013307 | Bacteria | 3936 |
| 248 | Ga0157372_10219308 | 3300013307 | Bacteria | 2205 |
| 249 | Ga0157372_10393469 | 3300013307 | Bacteria | 1615 |
| 250 | Ga0157372_10407498 | 3300013307 | Bacteria | 1584 |
| 251 | Ga0157372_10811421 | 3300013307 | Unclassified | 1087 |
| 252 | Ga0157372_10813964 | 3300013307 | Bacteria | 1085 |
| 253 | Ga0157375_10244671 | 3300013308 | Bacteria | 1954 |
| 254 | Ga0157375_11311482 | 3300013308 | Unclassified | 851 |
| 255 | Ga0157375_11447129 | 3300013308 | Bacteria | 810 |
| 256 | Ga0163163_10088748 | 3300014325 | Bacteria | 3103 |
| 257 | Ga0163163_10342377 | 3300014325 | Bacteria | 1551 |
| 258 | Ga0163163_10686223 | 3300014325 | Bacteria | 1088 |
| 259 | Ga0163163_11832991 | 3300014325 | Bacteria | 667 |
| 260 | Ga0163163_11838493 | 3300014325 | Unclassified | 666 |
| 261 | Ga0157380_10060428 | 3300014326 | Bacteria | 3029 |
| 262 | Ga0157380_11053221 | 3300014326 | Bacteria | 850 |
| 263 | Ga0157380_11455505 | 3300014326 | Bacteria | 737 |
| 264 | Ga0157380_13297421 | 3300014326 | Bacteria | 516 |
| 265 | Ga0157379_10123521 | 3300014968 | Bacteria | 2329 |
| 266 | Ga0157379_10197769 | 3300014968 | Unclassified | 1817 |
| 267 | Ga0157379_10863971 | 3300014968 | Unclassified | 857 |
| 268 | Ga0157376_11118885 | 3300014969 | Bacteria | 814 |
| 269 | Ga0157376_12054105 | 3300014969 | Bacteria | 609 |
| 270 | Ga0163161_10719221 | 3300017792 | Unclassified | 833 |
| 271 | Ga0163161_10767701 | 3300017792 | Unclassified | 808 |
| 272 | Ga0209258_100029 | 3300025242 | Bacteria | 490648 |
| 273 | Ga0207425_1037748 | 3300025245 | Bacteria | 931 |
| 274 | Ga0209646_1000031 | 3300025246 | Bacteria | 381260 |
| 275 | Ga0209026_1000019 | 3300025250 | Bacteria | 381260 |
| 276 | Ga0209148_1000089 | 3300025254 | Bacteria | 253548 |
| 277 | Ga0209758_1003209 | 3300025297 | Bacteria | 15235 |
| 278 | Ga0207426_1000445 | 3300025302 | Bacteria | 66319 |
| 279 | Ga0207697_10355355 | 3300025315 | Unclassified | 651 |
| 280 | Ga0207682_10060577 | 3300025893 | Bacteria | 1583 |
| 281 | Ga0207642_10267329 | 3300025899 | Bacteria | 978 |
| 282 | Ga0207688_10625736 | 3300025901 | Unclassified | 679 |
| 283 | Ga0207680_10165044 | 3300025903 | Bacteria | 1488 |
| 284 | Ga0207647_10031932 | 3300025904 | Bacteria | 3387 |
| 285 | Ga0207647_10041580 | 3300025904 | Bacteria | 2889 |
| 286 | Ga0207645_10014557 | 3300025907 | Bacteria | 5262 |
| 287 | Ga0207643_10128235 | 3300025908 | Unclassified | 1507 |
| 288 | Ga0207643_10431782 | 3300025908 | Unclassified | 836 |
| 289 | Ga0207705_10053092 | 3300025909 | Bacteria | 2919 |
| 290 | Ga0207705_10072530 | 3300025909 | Bacteria | 2497 |
| 291 | Ga0207654_10002263 | 3300025911 | Bacteria | 9873 |
| 292 | Ga0207654_10152543 | 3300025911 | Bacteria | 1484 |
| 293 | Ga0207654_10284420 | 3300025911 | Bacteria | 1120 |
| 294 | Ga0207654_10295960 | 3300025911 | Unclassified | 1099 |
| 295 | Ga0207654_10395965 | 3300025911 | Bacteria | 959 |
| 296 | Ga0207654_10785223 | 3300025911 | Bacteria | 687 |
| 297 | Ga0207654_11114581 | 3300025911 | Unclassified | 575 |
| 298 | Ga0207707_10131519 | 3300025912 | Bacteria | 2189 |
| 299 | Ga0207707_10444633 | 3300025912 | Unclassified | 1109 |
| 300 | Ga0207695_10000051 | 3300025913 | Bacteria | 399641 |
| 301 | Ga0207695_10000056 | 3300025913 | Bacteria | 382433 |
| 302 | Ga0207695_10000066 | 3300025913 | Bacteria | 334103 |
| 303 | Ga0207695_10000081 | 3300025913 | Bacteria | 284797 |
| 304 | Ga0207695_10000156 | 3300025913 | Bacteria | 204576 |
| 305 | Ga0207695_10000778 | 3300025913 | Bacteria | 60342 |
| 306 | Ga0207695_10002773 | 3300025913 | Bacteria | 25522 |
| 307 | Ga0207695_10027790 | 3300025913 | Bacteria | 6293 |
| 308 | Ga0207695_10050894 | 3300025913 | Bacteria | 4354 |
| 309 | Ga0207695_10234759 | 3300025913 | Bacteria | 1737 |
| 310 | Ga0207695_10508598 | 3300025913 | Unclassified | 1086 |
| 311 | Ga0207671_10001925 | 3300025914 | Bacteria | 23035 |
| 312 | Ga0207671_10003817 | 3300025914 | Bacteria | 14748 |
| 313 | Ga0207671_10004406 | 3300025914 | Bacteria | 13490 |
| 314 | Ga0207671_10010183 | 3300025914 | Bacteria | 7784 |
| 315 | Ga0207671_10140228 | 3300025914 | Bacteria | 1862 |
| 316 | Ga0207671_10179936 | 3300025914 | Bacteria | 1645 |
| 317 | Ga0207671_10241082 | 3300025914 | Unclassified | 1420 |
| 318 | Ga0207660_10015717 | 3300025917 | Bacteria | 5000 |
| 319 | Ga0207660_10152805 | 3300025917 | Unclassified | 1775 |
| 320 | Ga0207660_10614591 | 3300025917 | Bacteria | 885 |
| 321 | Ga0207660_11216029 | 3300025917 | Bacteria | 613 |
| 322 | Ga0207657_10096842 | 3300025919 | Bacteria | 2454 |
| 323 | Ga0207649_10163071 | 3300025920 | Unclassified | 1546 |
| 324 | Ga0207649_10371679 | 3300025920 | Bacteria | 1063 |
| 325 | Ga0207652_10004292 | 3300025921 | Bacteria | 11623 |
| 326 | Ga0207652_10051391 | 3300025921 | Bacteria | 3534 |
| 327 | Ga0207681_10002248 | 3300025923 | Bacteria | 12274 |
| 328 | Ga0207681_11385049 | 3300025923 | Unclassified | 590 |
| 329 | Ga0207694_10080350 | 3300025924 | Unclassified | 2559 |
| 330 | Ga0207694_10130152 | 3300025924 | Bacteria | 2017 |
| 331 | Ga0207694_10170886 | 3300025924 | Bacteria | 1760 |
| 332 | Ga0207694_10366716 | 3300025924 | Bacteria | 1194 |
| 333 | Ga0207650_10254160 | 3300025925 | Bacteria | 1423 |
| 334 | Ga0207659_10240420 | 3300025926 | Bacteria | 1464 |
| 335 | Ga0207644_11337968 | 3300025931 | Bacteria | 602 |
| 336 | Ga0207690_10622987 | 3300025932 | Bacteria | 882 |
| 337 | Ga0207706_10049802 | 3300025933 | Bacteria | 3701 |
| 338 | Ga0207709_10689611 | 3300025935 | Unclassified | 816 |
| 339 | Ga0207709_11509043 | 3300025935 | Unclassified | 558 |
| 340 | Ga0207669_10223395 | 3300025937 | Unclassified | 1384 |
| 341 | Ga0207704_10457578 | 3300025938 | Bacteria | 1020 |
| 342 | Ga0207704_11775786 | 3300025938 | Bacteria | 530 |
| 343 | Ga0207691_10008993 | 3300025940 | Bacteria | 9578 |
| 344 | Ga0207691_10144191 | 3300025940 | Bacteria | 2097 |
| 345 | Ga0207689_10020682 | 3300025942 | Bacteria | 5533 |
| 346 | Ga0207689_10029163 | 3300025942 | Bacteria | 4611 |
| 347 | Ga0207689_10953540 | 3300025942 | Bacteria | 724 |
| 348 | Ga0207661_10134500 | 3300025944 | Unclassified | 2122 |
| 349 | Ga0207661_10139225 | 3300025944 | Bacteria | 2087 |
| 350 | Ga0207661_10142881 | 3300025944 | Bacteria | 2061 |
| 351 | Ga0207661_10766348 | 3300025944 | Unclassified | 888 |
| 352 | Ga0207661_10908018 | 3300025944 | Bacteria | 811 |
| 353 | Ga0207679_10118129 | 3300025945 | Bacteria | 2105 |
| 354 | Ga0207679_10135709 | 3300025945 | Bacteria | 1981 |
| 355 | Ga0207667_10000713 | 3300025949 | Bacteria | 43129 |
| 356 | Ga0207667_10001674 | 3300025949 | Bacteria | 27927 |
| 357 | Ga0207667_10028437 | 3300025949 | Bacteria | 6073 |
| 358 | Ga0207667_10331045 | 3300025949 | Unclassified | 1555 |
| 359 | Ga0207651_10015820 | 3300025960 | Bacteria | 4397 |
| 360 | Ga0207712_10000260 | 3300025961 | Bacteria | 51278 |
| 361 | Ga0207712_10730842 | 3300025961 | Bacteria | 866 |
| 362 | Ga0207668_10031696 | 3300025972 | Bacteria | 3485 |
| 363 | Ga0207668_10149154 | 3300025972 | Bacteria | 1808 |
| 364 | Ga0207668_10621253 | 3300025972 | Bacteria | 943 |
| 365 | Ga0207640_10118075 | 3300025981 | Unclassified | 1894 |
| 366 | Ga0207640_10122251 | 3300025981 | Bacteria | 1867 |
| 367 | Ga0207640_10139199 | 3300025981 | Bacteria | 1767 |
| 368 | Ga0207640_10243169 | 3300025981 | Bacteria | 1392 |
| 369 | Ga0207640_10862207 | 3300025981 | Bacteria | 789 |
| 370 | Ga0207640_11540678 | 3300025981 | Bacteria | 598 |
| 371 | Ga0207658_10020190 | 3300025986 | Bacteria | 4615 |
| 372 | Ga0207658_10362691 | 3300025986 | Bacteria | 1265 |
| 373 | Ga0207658_10746184 | 3300025986 | Unclassified | 886 |
| 374 | Ga0207639_10012880 | 3300026041 | Bacteria | 5835 |
| 375 | Ga0207639_10017764 | 3300026041 | Bacteria | 5044 |
| 376 | Ga0207639_10071978 | 3300026041 | Bacteria | 2706 |
| 377 | Ga0207639_10902457 | 3300026041 | Unclassified | 826 |
| 378 | Ga0207639_11496900 | 3300026041 | Unclassified | 633 |
| 379 | Ga0207702_10021240 | 3300026078 | Bacteria | 5372 |
| 380 | Ga0207702_10142894 | 3300026078 | Bacteria | 2168 |
| 381 | Ga0207702_11200102 | 3300026078 | Bacteria | 753 |
| 382 | Ga0207702_11369936 | 3300026078 | Bacteria | 701 |
| 383 | Ga0207641_10085654 | 3300026088 | Bacteria | 2746 |
| 384 | Ga0207641_10151070 | 3300026088 | Bacteria | 2103 |
| 385 | Ga0207641_11568499 | 3300026088 | Unclassified | 660 |
| 386 | Ga0207648_10003726 | 3300026089 | Bacteria | 15946 |
| 387 | Ga0207648_10080405 | 3300026089 | Bacteria | 2843 |
| 388 | Ga0207648_10716544 | 3300026089 | Bacteria | 928 |
| 389 | Ga0207648_11376805 | 3300026089 | Bacteria | 663 |
| 390 | Ga0207676_10039845 | 3300026095 | Bacteria | 3597 |
| 391 | Ga0207676_10326167 | 3300026095 | Bacteria | 1411 |
| 392 | Ga0207676_11079115 | 3300026095 | Bacteria | 793 |
| 393 | Ga0207674_10002012 | 3300026116 | Bacteria | 25817 |
| 394 | Ga0207674_10033048 | 3300026116 | Bacteria | 5420 |
| 395 | Ga0207675_100106388 | 3300026118 | Bacteria | 2645 |
| 396 | Ga0207675_100236612 | 3300026118 | Bacteria | 1763 |
| 397 | Ga0207675_100240144 | 3300026118 | Unclassified | 1751 |
| 398 | Ga0207675_100580431 | 3300026118 | Bacteria | 1122 |
| 399 | Ga0207675_101139565 | 3300026118 | Bacteria | 800 |
| 400 | Ga0207675_101218131 | 3300026118 | Unclassified | 773 |
| 401 | Ga0207683_11411006 | 3300026121 | Unclassified | 644 |
| 402 | Ga0207683_11702201 | 3300026121 | Unclassified | 580 |
| 403 | Ga0207698_10004751 | 3300026142 | Bacteria | 8310 |
| 404 | Ga0207698_10024170 | 3300026142 | Bacteria | 4260 |
| 405 | Ga0207698_10038406 | 3300026142 | Bacteria | 3537 |
| 406 | Ga0207698_10043618 | 3300026142 | Bacteria | 3362 |
| 407 | Ga0207698_10134888 | 3300026142 | Bacteria | 2116 |
| 408 | Ga0207698_10468351 | 3300026142 | Unclassified | 1220 |
| 409 | Ga0207698_10559093 | 3300026142 | Unclassified | 1123 |
| 410 | Ga0207698_12012418 | 3300026142 | Bacteria | 592 |
| 411 | Ga0209968_1046814 | 3300027526 | Unclassified | 746 |
| 412 | Ga0209998_10029491 | 3300027717 | Bacteria | 1210 |
| 413 | Ga0268266_10000073 | 3300028379 | Bacteria | 232074 |
| 414 | Ga0268266_10629876 | 3300028379 | Unclassified | 1031 |
| 415 | Ga0268265_10000144 | 3300028380 | Bacteria | 90132 |
| 416 | Ga0268265_10006712 | 3300028380 | Bacteria | 7789 |
| 417 | Ga0268265_11990433 | 3300028380 | Unclassified | 588 |
| 418 | Ga0268264_10000973 | 3300028381 | Bacteria | 29345 |
| 419 | Ga0268264_10004437 | 3300028381 | Bacteria | 11970 |
| 420 | Ga0268264_10051628 | 3300028381 | Bacteria | 3427 |
| 421 | Ga0268264_10090288 | 3300028381 | Unclassified | 2640 |
| 422 | Ga0268264_10126109 | 3300028381 | Unclassified | 2262 |
| 423 | Ga0268264_10546669 | 3300028381 | Bacteria | 1135 |
| 424 | Ga0307517_10075437 | 3300028786 | Bacteria | 2957 |
| 425 | Ga0307517_10169437 | 3300028786 | Bacteria | 1440 |
| 426 | Ga0307511_10000232 | 3300030521 | Bacteria | 56875 |
| 427 | Ga0316179_1078913 | 3300030734 | Bacteria | 579 |
| 428 | Ga0265320_10263333 | 3300031240 | Bacteria | 764 |
| 429 | Ga0307513_10241313 | 3300031456 | Unclassified | 1611 |
| 430 | Ga0307509_10061299 | 3300031507 | Bacteria | 3972 |
| 431 | Ga0307509_10108305 | 3300031507 | Unclassified | 2792 |
| 432 | Ga0307509_10178032 | 3300031507 | Unclassified | 1996 |
| 433 | Ga0307509_10563097 | 3300031507 | Bacteria | 816 |
| 434 | Ga0307408_100001245 | 3300031548 | Bacteria | 19112 |
| 435 | Ga0307408_100059733 | 3300031548 | Bacteria | 2776 |
| 436 | Ga0307408_100102511 | 3300031548 | Bacteria | 2183 |
| 437 | Ga0307408_100166439 | 3300031548 | Bacteria | 1756 |
| 438 | Ga0307408_100197325 | 3300031548 | Bacteria | 1626 |
| 439 | Ga0307508_10000181 | 3300031616 | Bacteria | 76433 |
| 440 | Ga0307516_10146874 | 3300031730 | Bacteria | 2123 |
| 441 | Ga0307405_10032769 | 3300031731 | Bacteria | 3074 |
| 442 | Ga0307405_10073057 | 3300031731 | Bacteria | 2213 |
| 443 | Ga0307413_10004719 | 3300031824 | Bacteria | 5982 |
| 444 | Ga0307413_10044344 | 3300031824 | Bacteria | 2628 |
| 445 | Ga0307413_10234344 | 3300031824 | Bacteria | 1350 |
| 446 | Ga0307413_10976038 | 3300031824 | Bacteria | 724 |
| 447 | Ga0307410_10026490 | 3300031852 | Bacteria | 3651 |
| 448 | Ga0307410_10034501 | 3300031852 | Bacteria | 3277 |
| 449 | Ga0307410_10090396 | 3300031852 | Bacteria | 2171 |
| 450 | Ga0307406_10000404 | 3300031901 | Bacteria | 25000 |
| 451 | Ga0307406_10018903 | 3300031901 | Bacteria | 4035 |
| 452 | Ga0307406_10023017 | 3300031901 | Bacteria | 3702 |
| 453 | Ga0307406_10112503 | 3300031901 | Bacteria | 1877 |
| 454 | Ga0307406_10148922 | 3300031901 | Bacteria | 1667 |
| 455 | Ga0307407_10185961 | 3300031903 | Bacteria | 1380 |
| 456 | Ga0307407_10238443 | 3300031903 | Bacteria | 1239 |
| 457 | Ga0307412_10025250 | 3300031911 | Bacteria | 3678 |
| 458 | Ga0307412_11424086 | 3300031911 | Unclassified | 628 |
| 459 | Ga0307409_100018059 | 3300031995 | Bacteria | 4725 |
| 460 | Ga0307409_100044542 | 3300031995 | Bacteria | 3343 |
| 461 | Ga0307409_100236268 | 3300031995 | Bacteria | 1660 |
| 462 | Ga0307409_100635794 | 3300031995 | Bacteria | 1059 |
| 463 | Ga0307409_101278977 | 3300031995 | Bacteria | 758 |
| 464 | Ga0307416_100117717 | 3300032002 | Bacteria | 2359 |
| 465 | Ga0307416_100179705 | 3300032002 | Bacteria | 1981 |
| 466 | Ga0307416_100215596 | 3300032002 | Bacteria | 1836 |
| 467 | Ga0307416_100382202 | 3300032002 | Bacteria | 1439 |
| 468 | Ga0307416_101432988 | 3300032002 | Bacteria | 796 |
| 469 | Ga0307414_10000052 | 3300032004 | Bacteria | 126684 |
| 470 | Ga0307414_10028364 | 3300032004 | Bacteria | 3630 |
| 471 | Ga0307414_10047632 | 3300032004 | Bacteria | 2952 |
| 472 | Ga0307414_10133539 | 3300032004 | Bacteria | 1931 |
| 473 | Ga0307414_10162000 | 3300032004 | Bacteria | 1778 |
| 474 | Ga0307414_10182668 | 3300032004 | Bacteria | 1688 |
| 475 | Ga0307414_10278391 | 3300032004 | Bacteria | 1404 |
| 476 | Ga0307414_10516010 | 3300032004 | Bacteria | 1060 |
| 477 | Ga0307414_10865549 | 3300032004 | Bacteria | 827 |
| 478 | Ga0307411_10021864 | 3300032005 | Bacteria | 3754 |
| 479 | Ga0307411_10051637 | 3300032005 | Bacteria | 2683 |
| 480 | Ga0307411_10095276 | 3300032005 | Bacteria | 2089 |
| 481 | Ga0307411_10910838 | 3300032005 | Bacteria | 782 |
| 482 | Ga0307415_100193110 | 3300032126 | Bacteria | 1608 |
| 483 | Ga0307415_100313629 | 3300032126 | Bacteria | 1304 |
| 484 | Ga0307415_100502271 | 3300032126 | Bacteria | 1060 |
| 485 | Ga0307415_101324770 | 3300032126 | Unclassified | 683 |
| 486 | Ga0307510_10000637 | 3300033180 | Bacteria | 35581 |
| 487 | Ga0373930_0017728 | 3300034816 | Bacteria | 1361 |
| 488 | Ga0373961_0046634 | 3300035241 | Bacteria | 1271 |
| 489 | Ga0373962_0038271 | 3300035242 | Bacteria | 1342 |
| 490 | Ga0373933_0741535 | 3300035724 | Unclassified | 646 |
| 491 | Ga0395899_0194311 | 3300037312 | Bacteria | 1418 |
| 492 | Ga0395899_0384134 | 3300037312 | Bacteria | 932 |
| 493 | Ga0395899_0386796 | 3300037312 | Bacteria | 928 |
| 494 | Ga0395900_0207469 | 3300037418 | Bacteria | 1979 |
| 495 | Ga0395900_0573779 | 3300037418 | Bacteria | 1070 |
| 496 | Ga0395900_0574665 | 3300037418 | Bacteria | 1069 |
| 497 | Ga0395898_0573709 | 3300037466 | Bacteria | 1070 |
| 498 | Ga0395898_0574615 | 3300037466 | Bacteria | 1069 |
| 499 | Ga0395905_0014608 | 3300037471 | Bacteria | 7490 |
| 500 | Ga0395905_0691188 | 3300037471 | Bacteria | 922 |
| 501 | Ga0436364_0272780 | 3300037853 | Bacteria | 1656 |
| 502 | Ga0395901_0119569 | 3300038443 | Bacteria | 2768 |
| 503 | Ga0395901_0181786 | 3300038443 | Bacteria | 2205 |
| 504 | Ga0395901_0708627 | 3300038443 | Bacteria | 1003 |
| 505 | Ga0439439_0003919 | 3300041406 | Bacteria | 3314 |
| 506 | Ga0439439_0174051 | 3300041406 | Bacteria | 618 |
| 507 | Ga0451837_0175745 | 3300041494 | Bacteria | 885 |
| 508 | Ga0451845_0745347 | 3300041501 | Bacteria | 509 |
| 509 | Ga0451853_0292156 | 3300041512 | Bacteria | 1165 |
| 510 | Ga0439433_0056306 | 3300041999 | Unclassified | 933 |
| 511 | Ga0439433_0223219 | 3300041999 | Bacteria | 503 |
| 512 | Ga0439457_014463 | 3300042014 | Bacteria | 1766 |
| 513 | Ga0439462_0004254 | 3300042015 | Bacteria | 3483 |
| 514 | Ga0439462_0122260 | 3300042015 | Bacteria | 724 |
| 515 | Ga0450923_151684 | 3300042125 | Bacteria | 561 |
| 516 | Ga0450897_043261 | 3300042128 | Bacteria | 533 |
| 517 | Ga0450898_003159 | 3300042134 | Bacteria | 2349 |
| 518 | Ga0439446_0015945 | 3300042156 | Bacteria | 2089 |
| 519 | Ga0450908_052247 | 3300042184 | Bacteria | 712 |
| 520 | Ga0439434_0056500 | 3300042435 | Unclassified | 1222 |
| 521 | Ga0439434_0105984 | 3300042435 | Bacteria | 908 |
| 522 | Ga0450893_0094336 | 3300042532 | Bacteria | 604 |
| 523 | Ga0451577_0020179 | 3300042876 | Bacteria | 6119 |
| 524 | Ga0453683_0067000 | 3300044673 | Bacteria | 2244 |
| 525 | Ga0466961_0034395 | 3300044693 | Bacteria | 3253 |
| 526 | Ga0466963_0088980 | 3300044694 | Bacteria | 2100 |
| 527 | Ga0466964_0009653 | 3300044706 | Bacteria | 3636 |
| 528 | Ga0466964_0139287 | 3300044706 | Bacteria | 1113 |
| 529 | Ga0453684_0059472 | 3300044712 | Bacteria | 4926 |
| 530 | Ga0466971_0040206 | 3300044719 | Bacteria | 2100 |
| 531 | Ga0466968_0052519 | 3300044735 | Bacteria | 1744 |
| 532 | Ga0466970_0214827 | 3300044765 | Bacteria | 1072 |
| 533 | Ga0466959_0005141 | 3300045049 | Bacteria | 8913 |
| 534 | Ga0451576_1503075 | 3300045051 | Bacteria | 700 |
| 535 | Ga0466967_0161903 | 3300045976 | Bacteria | 2101 |
| 536 | Ga0495638_0026894 | 3300046460 | Bacteria | 3727 |
| 537 | Ga0495638_0028140 | 3300046460 | Bacteria | 3632 |
| 538 | Ga0495594_0028657 | 3300046499 | Bacteria | 3006 |
| 539 | Ga0495606_0009808 | 3300046507 | Bacteria | 8045 |
| 540 | Ga0495648_0002315 | 3300046524 | Bacteria | 17740 |
| 541 | Ga0495668_0604032 | 3300046616 | Bacteria | 606 |
| 542 | Ga0495611_0001153 | 3300046648 | Bacteria | 13800 |
| 543 | Ga0495611_0030145 | 3300046648 | Bacteria | 2384 |
| 544 | Ga0495625_0419761 | 3300046660 | Bacteria | 832 |
| 545 | Ga0495625_0560692 | 3300046660 | Bacteria | 691 |
| 546 | Ga0495649_0146982 | 3300046694 | Bacteria | 1239 |
| 547 | Ga0495649_0473505 | 3300046694 | Bacteria | 624 |
| 548 | Ga0495683_0222870 | 3300047323 | Bacteria | 840 |
| 549 | Ga0495687_000179 | 3300047443 | Bacteria | 92387 |
| 550 | Ga0495686_0000010 | 3300047472 | Bacteria | 573229 |
| 551 | Ga0496101_0598287 | 3300048904 | Bacteria | 872 |
| 552 | Ga0496102_1540391 | 3300048905 | Bacteria | 583 |
| 553 | Ga0496105_0257520 | 3300048908 | Bacteria | 1412 |
| 554 | Ga0496106_0284353 | 3300048909 | Bacteria | 1325 |
| 555 | Ga0496106_0728810 | 3300048909 | Bacteria | 789 |
| 556 | Ga0496108_0000454 | 3300048911 | Bacteria | 32702 |
| 557 | Ga0496108_0114107 | 3300048911 | Bacteria | 2313 |
| 558 | Ga0496108_1118980 | 3300048911 | Bacteria | 668 |
| 559 | Ga0496109_0004696 | 3300048912 | Bacteria | 11401 |
| 560 | Ga0496109_0846179 | 3300048912 | Bacteria | 853 |
| 561 | Ga0496110_0009965 | 3300048913 | Bacteria | 7708 |
| 562 | Ga0496111_0068890 | 3300048914 | Bacteria | 2572 |
| 563 | Ga0496111_0115777 | 3300048914 | Bacteria | 1977 |
| 564 | Ga0496111_0525593 | 3300048914 | Bacteria | 870 |
| 565 | Ga0496112_0000336 | 3300048915 | Bacteria | 30511 |
| 566 | Ga0496113_0000286 | 3300048916 | Bacteria | 23871 |
| 567 | Ga0496115_0870958 | 3300048918 | Unclassified | 696 |
| 568 | Ga0496123_0389536 | 3300048926 | Bacteria | 637 |
| 569 | Ga0496126_0735119 | 3300048929 | Bacteria | 763 |
| 570 | Ga0501291_013912 | 3300049514 | Bacteria | 1197 |
| 571 | Ga0501032_0380597 | 3300049569 | Bacteria | 908 |
| 572 | Ga0501033_0011966 | 3300049570 | Bacteria | 6629 |
| 573 | Ga0501033_0522226 | 3300049570 | Bacteria | 820 |
| 574 | Ga0501034_0125286 | 3300049571 | Unclassified | 2554 |
| 575 | Ga0501034_0166402 | 3300049571 | Bacteria | 2173 |
| 576 | Ga0501036_0004307 | 3300049572 | Bacteria | 11494 |
| 577 | Ga0501036_0118762 | 3300049572 | Bacteria | 2233 |
| 578 | Ga0501037_0041022 | 3300049573 | Bacteria | 3405 |
| 579 | Ga0501037_0505749 | 3300049573 | Bacteria | 819 |
| 580 | Ga0501037_0864110 | 3300049573 | Bacteria | 594 |
| 581 | Ga0501039_0320495 | 3300049575 | Bacteria | 1218 |
| 582 | Ga0501039_0360952 | 3300049575 | Unclassified | 1141 |
| 583 | Ga0501043_0033919 | 3300049579 | Bacteria | 4016 |
| 584 | Ga0501043_0142344 | 3300049579 | Unclassified | 1877 |
| 585 | Ga0501046_0033176 | 3300049580 | Bacteria | 4174 |
| 586 | Ga0501046_0264573 | 3300049580 | Bacteria | 1263 |
| 587 | Ga0501047_0053697 | 3300049581 | Bacteria | 3897 |
| 588 | Ga0501047_0067395 | 3300049581 | Bacteria | 3449 |
| 589 | Ga0501047_0093604 | 3300049581 | Bacteria | 2884 |
| 590 | Ga0501048_0006935 | 3300049582 | Bacteria | 8608 |
| 591 | Ga0501048_0218006 | 3300049582 | Bacteria | 1353 |
| 592 | Ga0501048_0221110 | 3300049582 | Bacteria | 1343 |
| 593 | Ga0501067_0028416 | 3300049583 | Bacteria | 3098 |
| 594 | Ga0501068_0115527 | 3300049584 | Bacteria | 1671 |
| 595 | Ga0501068_0992822 | 3300049584 | Bacteria | 554 |
| 596 | Ga0501069_0166456 | 3300049585 | Bacteria | 1271 |
| 597 | Ga0501069_0296809 | 3300049585 | Bacteria | 947 |
| 598 | Ga0501070_0037058 | 3300049586 | Bacteria | 4071 |
| 599 | Ga0501070_0119799 | 3300049586 | Bacteria | 2175 |
| 600 | Ga0501072_0051833 | 3300049588 | Bacteria | 3231 |
| 601 | Ga0501073_0000302 | 3300049589 | Bacteria | 32545 |
| 602 | Ga0501073_1234566 | 3300049589 | Bacteria | 513 |
| 603 | Ga0501074_0000754 | 3300049590 | Bacteria | 20343 |
| 604 | Ga0501074_0163788 | 3300049590 | Bacteria | 1588 |
| 605 | Ga0501075_0063049 | 3300049591 | Bacteria | 2795 |
| 606 | Ga0501076_0199389 | 3300049592 | Bacteria | 1634 |
| 607 | Ga0501076_0662908 | 3300049592 | Bacteria | 861 |
| 608 | Ga0501077_0315025 | 3300049593 | Unclassified | 997 |
| 609 | Ga0501223_032405 | 3300049663 | Bacteria | 1017 |
| 610 | Ga0501227_001545 | 3300049665 | Bacteria | 5132 |
| 611 | Ga0501238_038654 | 3300049671 | Bacteria | 699 |
| 612 | Ga0501242_027402 | 3300049674 | Bacteria | 757 |
| 613 | Ga0501242_047035 | 3300049674 | Bacteria | 624 |
| 614 | Ga0501247_080045 | 3300049677 | Bacteria | 526 |
| 615 | Ga0501249_167419 | 3300049679 | Bacteria | 561 |
| 616 | Ga0501219_000106 | 3300049703 | Bacteria | 14642 |
| 617 | Ga0501234_079819 | 3300049707 | Bacteria | 575 |
| 618 | Ga0501079_0044593 | 3300049741 | Bacteria | 3422 |
| 619 | Ga0501080_0045485 | 3300049742 | Bacteria | 4086 |
| 620 | Ga0501080_0646528 | 3300049742 | Bacteria | 936 |
| 621 | Ga0501081_0541720 | 3300049743 | Bacteria | 869 |
| 622 | Ga0501083_0062154 | 3300049744 | Bacteria | 2492 |
| 623 | Ga0501241_003713 | 3300049758 | Bacteria | 2878 |
| 624 | Ga0501268_155552 | 3300049765 | Bacteria | 530 |
| 625 | Ga0501273_018901 | 3300049770 | Bacteria | 921 |
| 626 | Ga0501035_0029492 | 3300049822 | Bacteria | 5003 |
| 627 | Ga0501035_0212737 | 3300049822 | Bacteria | 1654 |
| 628 | Ga0501044_0056382 | 3300049823 | Bacteria | 4034 |
| 629 | Ga0501044_0067956 | 3300049823 | Bacteria | 3631 |
| 630 | Ga0501044_0076382 | 3300049823 | Bacteria | 3400 |
| 631 | Ga0501045_0782509 | 3300049824 | Bacteria | 703 |
| 632 | Ga0501284_00148 | 3300050005 | Bacteria | 8332 |
| 633 | nmdc:mga0k408_184103_c1 | 3300050493 | Unclassified | 1246 |
| 634 | nmdc:mga06z11_1022635_c1 | 3300050494 | Unclassified | 504 |
| 635 | nmdc:mga05p37_142533_c1 | 3300050507 | Bacteria | 2935 |
| 636 | nmdc:mga09592_309398_c1 | 3300050508 | Bacteria | 1369 |
| 637 | nmdc:mga06r32_183164_c1 | 3300050510 | Unclassified | 2080 |
| 638 | nmdc:mga08y16_1172790_c1 | 3300050511 | Bacteria | 740 |
| 639 | nmdc:mga08y16_593501_c1 | 3300050511 | Bacteria | 1117 |
| 640 | nmdc:mga08y16_68970_c1 | 3300050511 | Bacteria | 3686 |
| 641 | Ga0500578_0469291 | 3300053086 | Unclassified | 713 |
| 642 | Ga0500643_102255 | 3300053087 | Bacteria | 777 |
| 643 | Ga0500644_0000117 | 3300053088 | Bacteria | 49928 |
| 644 | Ga0500644_0048729 | 3300053088 | Bacteria | 1443 |
| 645 | Ga0500646_0001812 | 3300053090 | Bacteria | 5619 |
| 646 | Ga0500583_0002281 | 3300053092 | Bacteria | 5722 |
| 647 | Ga0500569_000434 | 3300053109 | Bacteria | 6833 |
| 648 | Ga0500594_0081157 | 3300053118 | Bacteria | 970 |
| 649 | Ga0500607_050200 | 3300053121 | Bacteria | 2224 |
| 650 | Ga0500608_133717 | 3300053122 | Bacteria | 1109 |
| 651 | Ga0500608_269706 | 3300053122 | Bacteria | 651 |
| 652 | Ga0500642_0132452 | 3300053130 | Bacteria | 1168 |
| 653 | Ga0500652_059722 | 3300053131 | Bacteria | 1568 |
| 654 | Ga0500652_243122 | 3300053131 | Bacteria | 716 |
| 655 | Ga0500655_012047 | 3300053133 | Bacteria | 1571 |
| 656 | Ga0500658_0006812 | 3300053134 | Bacteria | 4227 |
| 657 | Ga0500559_0000580 | 3300053136 | Bacteria | 25109 |
| 658 | Ga0500559_0032244 | 3300053136 | Bacteria | 2251 |
| 659 | Ga0500561_0226260 | 3300053137 | Bacteria | 594 |
| 660 | Ga0500568_0018171 | 3300053139 | Bacteria | 3084 |
| 661 | Ga0500577_0003665 | 3300053142 | Bacteria | 4005 |
| 662 | Ga0500577_0279760 | 3300053142 | Bacteria | 727 |
| 663 | Ga0500588_0001757 | 3300053146 | Bacteria | 4212 |
| 664 | Ga0500590_032355 | 3300053148 | Bacteria | 2713 |
| 665 | Ga0500590_247765 | 3300053148 | Bacteria | 711 |
| 666 | Ga0500604_0323582 | 3300053151 | Bacteria | 535 |
| 667 | Ga0500616_0137764 | 3300053153 | Bacteria | 1144 |
| 668 | Ga0500622_0003896 | 3300053156 | Bacteria | 9662 |
| 669 | Ga0500633_0001931 | 3300053160 | Bacteria | 4099 |
| 670 | Ga0500636_0005080 | 3300053177 | Bacteria | 7470 |
| 671 | Ga0500637_0050787 | 3300053178 | Bacteria | 2363 |
| 672 | Ga0500637_0217632 | 3300053178 | Bacteria | 1081 |
| 673 | Ga0501084_0065651 | 3300054114 | Bacteria | 3037 |
| 674 | Ga0501084_0207862 | 3300054114 | Bacteria | 1652 |
| 675 | Ga0500661_004973 | 3300055283 | Bacteria | 2491 |
| 676 | Ga0501082_0127210 | 3300060353 | Bacteria | 2210 |
| 677 | Ga0501082_1880680 | 3300060353 | Bacteria | 522 |
| 678 | Ga0466962_0053217 | 3300061719 | Bacteria | 1935 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005331 | Ga0070670_100318598 | Ga0070670_1003185982 | 117 |
| 2 | 3300005343 | Ga0070687_101246530 | Ga0070687_1012465301 | 117 |
| 3 | 3300005347 | Ga0070668_100009533 | Ga0070668_1000095332 | 117 |
| 4 | 3300005353 | Ga0070669_100000286 | Ga0070669_10000028622 | 117 |
| 5 | 3300005444 | Ga0070694_100111413 | Ga0070694_1001114132 | 117 |
| 6 | 3300005543 | Ga0070672_100270486 | Ga0070672_1002704862 | 117 |
| 7 | 3300005577 | Ga0068857_100023721 | Ga0068857_1000237214 | 117 |
| 8 | 3300005719 | Ga0068861_100048923 | Ga0068861_1000489232 | 117 |
| 9 | 3300005840 | Ga0068870_10106797 | Ga0068870_101067972 | 117 |
| 10 | 3300005844 | Ga0068862_100000640 | Ga0068862_10000064023 | 117 |
| 11 | 3300006881 | Ga0068865_100206320 | Ga0068865_1002063202 | 117 |
| 12 | 3300009094 | Ga0111539_10961127 | Ga0111539_109611272 | 117 |
| 13 | 3300009148 | Ga0105243_10144367 | Ga0105243_101443671 | 117 |
| 14 | 3300009553 | Ga0105249_10000186 | Ga0105249_1000018611 | 117 |
| 15 | 3300025315 | Ga0207697_10355355 | Ga0207697_103553551 | 117 |
| 16 | 3300025908 | Ga0207643_10128235 | Ga0207643_101282352 | 117 |
| 17 | 3300025923 | Ga0207681_10002248 | Ga0207681_100022484 | 117 |
| 18 | 3300025933 | Ga0207706_10049802 | Ga0207706_100498022 | 117 |
| 19 | 3300025935 | Ga0207709_10689611 | Ga0207709_106896112 | 117 |
| 20 | 3300025961 | Ga0207712_10000260 | Ga0207712_100002604 | 117 |
| 21 | 3300025972 | Ga0207668_10031696 | Ga0207668_100316962 | 117 |
| 22 | 3300026116 | Ga0207674_10033048 | Ga0207674_100330481 | 117 |
| 23 | 3300026118 | Ga0207675_100106388 | Ga0207675_1001063882 | 117 |
| 24 | 3300028380 | Ga0268265_10000144 | Ga0268265_1000014473 | 117 |
| 25 | 3300028381 | Ga0268264_10051628 | Ga0268264_100516281 | 117 |
| 26 | 3300050511 | nmdc:mga08y16_68970_c1 | nmdc:mga08y16_68970_c1_1927_2316 | 117 |
| 27 | 3300005341 | Ga0070691_10050069 | Ga0070691_100500693 | 119 |
| 28 | 3300025914 | Ga0207671_10241082 | Ga0207671_102410822 | 119 |
| 29 | 3300049570 | Ga0501033_0522226 | Ga0501033_0522226_161_526 | 120 |
| 30 | 3300049572 | Ga0501036_0118762 | Ga0501036_0118762_1097_1462 | 120 |
| 31 | 3300049575 | Ga0501039_0320495 | Ga0501039_0320495_122_487 | 120 |
| 32 | 3300049580 | Ga0501046_0264573 | Ga0501046_0264573_531_896 | 120 |
| 33 | 3300049582 | Ga0501048_0221110 | Ga0501048_0221110_713_1078 | 120 |
| 34 | 3300049590 | Ga0501074_0163788 | Ga0501074_0163788_53_418 | 120 |
| 35 | 3300049592 | Ga0501076_0662908 | Ga0501076_0662908_314_679 | 120 |
| 36 | 3300049743 | Ga0501081_0541720 | Ga0501081_0541720_466_831 | 120 |
| 37 | 3300054114 | Ga0501084_0207862 | Ga0501084_0207862_1148_1513 | 120 |
| 38 | 3300060353 | Ga0501082_1880680 | Ga0501082_1880680_25_390 | 120 |
| 39 | iso_pu_bacteria | 2884791551 | 2884797085 | 122 |
| 40 | iso_pu_bacteria | 2929239360 | 2929239821 | 122 |
| 41 | iso_pu_bacteria | 8003151029 | 8003151999 | 122 |
| 42 | 3300037853 | Ga0436364_0272780 | Ga0436364_0272780_947_1324 | 123 |
| 43 | 3300049592 | Ga0501076_0199389 | Ga0501076_0199389_186_566 | 123 |
| 44 | 3300025961 | Ga0207712_10730842 | Ga0207712_107308422 | 124 |
| 45 | 3300003316 | rootH1_10023398 | rootH1_100233988 | 125 |
| 46 | 3300003320 | rootH2_10109333 | rootH2_101093332 | 125 |
| 47 | 3300003323 | rootH1_10036348 | rootH1_100363482 | 125 |
| 48 | 3300005327 | Ga0070658_10065092 | Ga0070658_100650925 | 125 |
| 49 | 3300005328 | Ga0070676_10900583 | Ga0070676_109005832 | 125 |
| 50 | 3300005329 | Ga0070683_100001587 | Ga0070683_10000158719 | 125 |
| 51 | 3300005329 | Ga0070683_100250941 | Ga0070683_1002509413 | 125 |
| 52 | 3300005329 | Ga0070683_100783335 | Ga0070683_1007833352 | 125 |
| 53 | 3300005329 | Ga0070683_100866395 | Ga0070683_1008663952 | 125 |
| 54 | 3300005329 | Ga0070683_102103663 | Ga0070683_1021036631 | 125 |
| 55 | 3300005331 | Ga0070670_100056793 | Ga0070670_1000567932 | 125 |
| 56 | 3300005331 | Ga0070670_100151928 | Ga0070670_1001519282 | 125 |
| 57 | 3300005331 | Ga0070670_101202821 | Ga0070670_1012028212 | 125 |
| 58 | 3300005333 | Ga0070677_10052159 | Ga0070677_100521592 | 125 |
| 59 | 3300005334 | Ga0068869_100057460 | Ga0068869_1000574604 | 125 |
| 60 | 3300005334 | Ga0068869_100933983 | Ga0068869_1009339831 | 125 |
| 61 | 3300005335 | Ga0070666_10097033 | Ga0070666_100970333 | 125 |
| 62 | 3300005335 | Ga0070666_10390710 | Ga0070666_103907102 | 125 |
| 63 | 3300005336 | Ga0070680_100027158 | Ga0070680_1000271584 | 125 |
| 64 | 3300005337 | Ga0070682_100021600 | Ga0070682_1000216005 | 125 |
| 65 | 3300005337 | Ga0070682_100051139 | Ga0070682_1000511392 | 125 |
| 66 | 3300005337 | Ga0070682_100352787 | Ga0070682_1003527872 | 125 |
| 67 | 3300005338 | Ga0068868_100616176 | Ga0068868_1006161761 | 125 |
| 68 | 3300005338 | Ga0068868_101215262 | Ga0068868_1012152622 | 125 |
| 69 | 3300005339 | Ga0070660_100092212 | Ga0070660_1000922123 | 125 |
| 70 | 3300005340 | Ga0070689_100856546 | Ga0070689_1008565461 | 125 |
| 71 | 3300005341 | Ga0070691_10005121 | Ga0070691_100051214 | 125 |
| 72 | 3300005343 | Ga0070687_100661212 | Ga0070687_1006612121 | 125 |
| 73 | 3300005344 | Ga0070661_101386690 | Ga0070661_1013866901 | 125 |
| 74 | 3300005347 | Ga0070668_100028705 | Ga0070668_1000287053 | 125 |
| 75 | 3300005347 | Ga0070668_101624260 | Ga0070668_1016242601 | 125 |
| 76 | 3300005353 | Ga0070669_101560518 | Ga0070669_1015605182 | 125 |
| 77 | 3300005354 | Ga0070675_100408204 | Ga0070675_1004082042 | 125 |
| 78 | 3300005355 | Ga0070671_100922881 | Ga0070671_1009228811 | 125 |
| 79 | 3300005364 | Ga0070673_100162996 | Ga0070673_1001629962 | 125 |
| 80 | 3300005366 | Ga0070659_100463640 | Ga0070659_1004636402 | 125 |
| 81 | 3300005367 | Ga0070667_100099848 | Ga0070667_1000998481 | 125 |
| 82 | 3300005367 | Ga0070667_100467128 | Ga0070667_1004671282 | 125 |
| 83 | 3300005437 | Ga0070710_10132057 | Ga0070710_101320572 | 125 |
| 84 | 3300005439 | Ga0070711_100661884 | Ga0070711_1006618842 | 125 |
| 85 | 3300005440 | Ga0070705_100405228 | Ga0070705_1004052282 | 125 |
| 86 | 3300005445 | Ga0070708_100034768 | Ga0070708_1000347685 | 125 |
| 87 | 3300005455 | Ga0070663_101515561 | Ga0070663_1015155611 | 125 |
| 88 | 3300005455 | Ga0070663_101916499 | Ga0070663_1019164991 | 125 |
| 89 | 3300005456 | Ga0070678_100268594 | Ga0070678_1002685942 | 125 |
| 90 | 3300005456 | Ga0070678_100872159 | Ga0070678_1008721592 | 125 |
| 91 | 3300005456 | Ga0070678_101500986 | Ga0070678_1015009861 | 125 |
| 92 | 3300005458 | Ga0070681_10021141 | Ga0070681_100211417 | 125 |
| 93 | 3300005458 | Ga0070681_10325793 | Ga0070681_103257932 | 125 |
| 94 | 3300005458 | Ga0070681_10768457 | Ga0070681_107684571 | 125 |
| 95 | 3300005459 | Ga0068867_100275001 | Ga0068867_1002750013 | 125 |
| 96 | 3300005459 | Ga0068867_100302167 | Ga0068867_1003021671 | 125 |
| 97 | 3300005459 | Ga0068867_100507484 | Ga0068867_1005074842 | 125 |
| 98 | 3300005530 | Ga0070679_100000398 | Ga0070679_10000039824 | 125 |
| 99 | 3300005530 | Ga0070679_100159173 | Ga0070679_1001591733 | 125 |
| 100 | 3300005535 | Ga0070684_100033876 | Ga0070684_1000338762 | 125 |
| 101 | 3300005535 | Ga0070684_100215644 | Ga0070684_1002156444 | 125 |
| 102 | 3300005535 | Ga0070684_100240773 | Ga0070684_1002407733 | 125 |
| 103 | 3300005535 | Ga0070684_101293294 | Ga0070684_1012932942 | 125 |
| 104 | 3300005539 | Ga0068853_100002293 | Ga0068853_1000022939 | 125 |
| 105 | 3300005539 | Ga0068853_100042107 | Ga0068853_1000421075 | 125 |
| 106 | 3300005539 | Ga0068853_100054056 | Ga0068853_1000540563 | 125 |
| 107 | 3300005539 | Ga0068853_100095837 | Ga0068853_1000958373 | 125 |
| 108 | 3300005543 | Ga0070672_100148086 | Ga0070672_1001480862 | 125 |
| 109 | 3300005548 | Ga0070665_100000002 | Ga0070665_100000002460 | 125 |
| 110 | 3300005548 | Ga0070665_100338470 | Ga0070665_1003384702 | 125 |
| 111 | 3300005549 | Ga0070704_102138276 | Ga0070704_1021382761 | 125 |
| 112 | 3300005563 | Ga0068855_100000303 | Ga0068855_10000030340 | 125 |
| 113 | 3300005563 | Ga0068855_100055326 | Ga0068855_1000553265 | 125 |
| 114 | 3300005563 | Ga0068855_100066058 | Ga0068855_1000660584 | 125 |
| 115 | 3300005563 | Ga0068855_100070130 | Ga0068855_1000701303 | 125 |
| 116 | 3300005563 | Ga0068855_100310751 | Ga0068855_1003107513 | 125 |
| 117 | 3300005563 | Ga0068855_100818299 | Ga0068855_1008182992 | 125 |
| 118 | 3300005564 | Ga0070664_100040078 | Ga0070664_1000400783 | 125 |
| 119 | 3300005564 | Ga0070664_100365483 | Ga0070664_1003654832 | 125 |
| 120 | 3300005577 | Ga0068857_100009853 | Ga0068857_1000098537 | 125 |
| 121 | 3300005577 | Ga0068857_100599898 | Ga0068857_1005998982 | 125 |
| 122 | 3300005578 | Ga0068854_100048807 | Ga0068854_1000488075 | 125 |
| 123 | 3300005578 | Ga0068854_100199560 | Ga0068854_1001995602 | 125 |
| 124 | 3300005578 | Ga0068854_100240485 | Ga0068854_1002404851 | 125 |
| 125 | 3300005578 | Ga0068854_100466724 | Ga0068854_1004667242 | 125 |
| 126 | 3300005578 | Ga0068854_100767449 | Ga0068854_1007674492 | 125 |
| 127 | 3300005578 | Ga0068854_101356387 | Ga0068854_1013563871 | 125 |
| 128 | 3300005578 | Ga0068854_101418168 | Ga0068854_1014181681 | 125 |
| 129 | 3300005614 | Ga0068856_100018889 | Ga0068856_1000188896 | 125 |
| 130 | 3300005614 | Ga0068856_100062498 | Ga0068856_1000624982 | 125 |
| 131 | 3300005614 | Ga0068856_100142153 | Ga0068856_1001421533 | 125 |
| 132 | 3300005616 | Ga0068852_100000744 | Ga0068852_1000007445 | 125 |
| 133 | 3300005616 | Ga0068852_100016599 | Ga0068852_1000165992 | 125 |
| 134 | 3300005616 | Ga0068852_100025486 | Ga0068852_1000254862 | 125 |
| 135 | 3300005616 | Ga0068852_100101947 | Ga0068852_1001019475 | 125 |
| 136 | 3300005616 | Ga0068852_100395602 | Ga0068852_1003956022 | 125 |
| 137 | 3300005617 | Ga0068859_100240106 | Ga0068859_1002401063 | 125 |
| 138 | 3300005617 | Ga0068859_100400910 | Ga0068859_1004009102 | 125 |
| 139 | 3300005617 | Ga0068859_102466703 | Ga0068859_1024667031 | 125 |
| 140 | 3300005618 | Ga0068864_100062502 | Ga0068864_1000625025 | 125 |
| 141 | 3300005618 | Ga0068864_101292180 | Ga0068864_1012921802 | 125 |
| 142 | 3300005718 | Ga0068866_10065788 | Ga0068866_100657882 | 125 |
| 143 | 3300005718 | Ga0068866_10108731 | Ga0068866_101087312 | 125 |
| 144 | 3300005719 | Ga0068861_101315335 | Ga0068861_1013153352 | 125 |
| 145 | 3300005834 | Ga0068851_10151435 | Ga0068851_101514352 | 125 |
| 146 | 3300005840 | Ga0068870_10539382 | Ga0068870_105393822 | 125 |
| 147 | 3300005840 | Ga0068870_10557603 | Ga0068870_105576031 | 125 |
| 148 | 3300005841 | Ga0068863_100136868 | Ga0068863_1001368683 | 125 |
| 149 | 3300005841 | Ga0068863_101900279 | Ga0068863_1019002791 | 125 |
| 150 | 3300005842 | Ga0068858_100661564 | Ga0068858_1006615642 | 125 |
| 151 | 3300005843 | Ga0068860_100000003 | Ga0068860_10000000376 | 125 |
| 152 | 3300005843 | Ga0068860_100001341 | Ga0068860_10000134120 | 125 |
| 153 | 3300005843 | Ga0068860_100005037 | Ga0068860_10000503712 | 125 |
| 154 | 3300005843 | Ga0068860_100196827 | Ga0068860_1001968272 | 125 |
| 155 | 3300005843 | Ga0068860_100348020 | Ga0068860_1003480203 | 125 |
| 156 | 3300005843 | Ga0068860_102257620 | Ga0068860_1022576201 | 125 |
| 157 | 3300005843 | Ga0068860_102502556 | Ga0068860_1025025561 | 125 |
| 158 | 3300005844 | Ga0068862_100009867 | Ga0068862_1000098675 | 125 |
| 159 | 3300005844 | Ga0068862_100385499 | Ga0068862_1003854991 | 125 |
| 160 | 3300005983 | Ga0081540_1002061 | Ga0081540_10020616 | 125 |
| 161 | 3300006195 | Ga0075366_10236151 | Ga0075366_102361512 | 125 |
| 162 | 3300006237 | Ga0097621_100393569 | Ga0097621_1003935692 | 125 |
| 163 | 3300006237 | Ga0097621_100638313 | Ga0097621_1006383132 | 125 |
| 164 | 3300006237 | Ga0097621_100664668 | Ga0097621_1006646682 | 125 |
| 165 | 3300006237 | Ga0097621_101442364 | Ga0097621_1014423641 | 125 |
| 166 | 3300006237 | Ga0097621_101709230 | Ga0097621_1017092301 | 125 |
| 167 | 3300006358 | Ga0068871_100881961 | Ga0068871_1008819612 | 125 |
| 168 | 3300006881 | Ga0068865_100523722 | Ga0068865_1005237222 | 125 |
| 169 | 3300006931 | Ga0097620_100240104 | Ga0097620_1002401043 | 125 |
| 170 | 3300006931 | Ga0097620_100400904 | Ga0097620_1004009042 | 125 |
| 171 | 3300006931 | Ga0097620_102466855 | Ga0097620_1024668551 | 125 |
| 172 | 3300009093 | Ga0105240_10000367 | Ga0105240_1000036774 | 125 |
| 173 | 3300009093 | Ga0105240_10004312 | Ga0105240_100043122 | 125 |
| 174 | 3300009093 | Ga0105240_10005773 | Ga0105240_1000577318 | 125 |
| 175 | 3300009093 | Ga0105240_10019425 | Ga0105240_100194257 | 125 |
| 176 | 3300009093 | Ga0105240_10031491 | Ga0105240_100314917 | 125 |
| 177 | 3300009093 | Ga0105240_10034497 | Ga0105240_100344972 | 125 |
| 178 | 3300009093 | Ga0105240_10043465 | Ga0105240_100434652 | 125 |
| 179 | 3300009093 | Ga0105240_10061895 | Ga0105240_100618954 | 125 |
| 180 | 3300009093 | Ga0105240_10161623 | Ga0105240_101616232 | 125 |
| 181 | 3300009093 | Ga0105240_10221553 | Ga0105240_102215532 | 125 |
| 182 | 3300009093 | Ga0105240_10311888 | Ga0105240_103118883 | 125 |
| 183 | 3300009174 | Ga0105241_10014751 | Ga0105241_100147514 | 125 |
| 184 | 3300009174 | Ga0105241_10030253 | Ga0105241_100302535 | 125 |
| 185 | 3300009174 | Ga0105241_10152724 | Ga0105241_101527243 | 125 |
| 186 | 3300009174 | Ga0105241_10266752 | Ga0105241_102667523 | 125 |
| 187 | 3300009174 | Ga0105241_10483136 | Ga0105241_104831362 | 125 |
| 188 | 3300009174 | Ga0105241_10581552 | Ga0105241_105815522 | 125 |
| 189 | 3300009174 | Ga0105241_10921903 | Ga0105241_109219032 | 125 |
| 190 | 3300009174 | Ga0105241_11088108 | Ga0105241_110881081 | 125 |
| 191 | 3300009176 | Ga0105242_10073196 | Ga0105242_100731963 | 125 |
| 192 | 3300009545 | Ga0105237_10004885 | Ga0105237_100048855 | 125 |
| 193 | 3300009545 | Ga0105237_10023054 | Ga0105237_100230546 | 125 |
| 194 | 3300009545 | Ga0105237_10061850 | Ga0105237_100618502 | 125 |
| 195 | 3300009545 | Ga0105237_10066020 | Ga0105237_100660205 | 125 |
| 196 | 3300009545 | Ga0105237_10162414 | Ga0105237_101624143 | 125 |
| 197 | 3300009545 | Ga0105237_10167094 | Ga0105237_101670943 | 125 |
| 198 | 3300009551 | Ga0105238_10005360 | Ga0105238_100053606 | 125 |
| 199 | 3300009551 | Ga0105238_10059649 | Ga0105238_100596493 | 125 |
| 200 | 3300009551 | Ga0105238_10137755 | Ga0105238_101377552 | 125 |
| 201 | 3300009551 | Ga0105238_10140744 | Ga0105238_101407443 | 125 |
| 202 | 3300009551 | Ga0105238_10187971 | Ga0105238_101879712 | 125 |
| 203 | 3300009551 | Ga0105238_10516926 | Ga0105238_105169262 | 125 |
| 204 | 3300009551 | Ga0105238_10873947 | Ga0105238_108739472 | 125 |
| 205 | 3300009553 | Ga0105249_10601511 | Ga0105249_106015112 | 125 |
| 206 | 3300009553 | Ga0105249_10883124 | Ga0105249_108831242 | 125 |
| 207 | 3300010375 | Ga0105239_10000252 | Ga0105239_1000025239 | 125 |
| 208 | 3300010375 | Ga0105239_10001074 | Ga0105239_1000107423 | 125 |
| 209 | 3300010375 | Ga0105239_10021740 | Ga0105239_100217404 | 125 |
| 210 | 3300010375 | Ga0105239_10042684 | Ga0105239_100426846 | 125 |
| 211 | 3300010375 | Ga0105239_10143887 | Ga0105239_101438873 | 125 |
| 212 | 3300010375 | Ga0105239_10146496 | Ga0105239_101464963 | 125 |
| 213 | 3300011119 | Ga0105246_10794954 | Ga0105246_107949541 | 125 |
| 214 | 3300013100 | Ga0157373_10012126 | Ga0157373_100121265 | 125 |
| 215 | 3300013100 | Ga0157373_10016610 | Ga0157373_100166106 | 125 |
| 216 | 3300013100 | Ga0157373_10032389 | Ga0157373_100323895 | 125 |
| 217 | 3300013100 | Ga0157373_10032587 | Ga0157373_100325875 | 125 |
| 218 | 3300013100 | Ga0157373_10048751 | Ga0157373_100487515 | 125 |
| 219 | 3300013102 | Ga0157371_10007530 | Ga0157371_100075306 | 125 |
| 220 | 3300013102 | Ga0157371_10009681 | Ga0157371_100096816 | 125 |
| 221 | 3300013102 | Ga0157371_10013530 | Ga0157371_100135305 | 125 |
| 222 | 3300013102 | Ga0157371_10014129 | Ga0157371_100141295 | 125 |
| 223 | 3300013102 | Ga0157371_10108747 | Ga0157371_101087472 | 125 |
| 224 | 3300013104 | Ga0157370_10006582 | Ga0157370_1000658210 | 125 |
| 225 | 3300013104 | Ga0157370_10011323 | Ga0157370_100113234 | 125 |
| 226 | 3300013104 | Ga0157370_10081542 | Ga0157370_100815422 | 125 |
| 227 | 3300013104 | Ga0157370_10431861 | Ga0157370_104318613 | 125 |
| 228 | 3300013105 | Ga0157369_10024734 | Ga0157369_100247347 | 125 |
| 229 | 3300013105 | Ga0157369_10025573 | Ga0157369_100255732 | 125 |
| 230 | 3300013105 | Ga0157369_10274277 | Ga0157369_102742773 | 125 |
| 231 | 3300013296 | Ga0157374_10471708 | Ga0157374_104717081 | 125 |
| 232 | 3300013297 | Ga0157378_10220608 | Ga0157378_102206083 | 125 |
| 233 | 3300013297 | Ga0157378_10307575 | Ga0157378_103075752 | 125 |
| 234 | 3300013297 | Ga0157378_11387635 | Ga0157378_113876351 | 125 |
| 235 | 3300013307 | Ga0157372_10004417 | Ga0157372_100044174 | 125 |
| 236 | 3300013307 | Ga0157372_10013597 | Ga0157372_100135977 | 125 |
| 237 | 3300013307 | Ga0157372_10030899 | Ga0157372_100308994 | 125 |
| 238 | 3300013307 | Ga0157372_10034708 | Ga0157372_100347085 | 125 |
| 239 | 3300013307 | Ga0157372_10070354 | Ga0157372_100703543 | 125 |
| 240 | 3300013307 | Ga0157372_10219308 | Ga0157372_102193082 | 125 |
| 241 | 3300013307 | Ga0157372_10393469 | Ga0157372_103934693 | 125 |
| 242 | 3300013307 | Ga0157372_10407498 | Ga0157372_104074982 | 125 |
| 243 | 3300013307 | Ga0157372_10811421 | Ga0157372_108114213 | 125 |
| 244 | 3300013308 | Ga0157375_10244671 | Ga0157375_102446712 | 125 |
| 245 | 3300013308 | Ga0157375_11311482 | Ga0157375_113114822 | 125 |
| 246 | 3300014325 | Ga0163163_10686223 | Ga0163163_106862231 | 125 |
| 247 | 3300014325 | Ga0163163_11832991 | Ga0163163_118329912 | 125 |
| 248 | 3300014325 | Ga0163163_11838493 | Ga0163163_118384931 | 125 |
| 249 | 3300014326 | Ga0157380_10060428 | Ga0157380_100604284 | 125 |
| 250 | 3300014326 | Ga0157380_11053221 | Ga0157380_110532212 | 125 |
| 251 | 3300014326 | Ga0157380_11455505 | Ga0157380_114555053 | 125 |
| 252 | 3300014326 | Ga0157380_13297421 | Ga0157380_132974211 | 125 |
| 253 | 3300014968 | Ga0157379_10197769 | Ga0157379_101977692 | 125 |
| 254 | 3300014969 | Ga0157376_12054105 | Ga0157376_120541052 | 125 |
| 255 | 3300017792 | Ga0163161_10767701 | Ga0163161_107677012 | 125 |
| 256 | 3300025893 | Ga0207682_10060577 | Ga0207682_100605771 | 125 |
| 257 | 3300025899 | Ga0207642_10267329 | Ga0207642_102673292 | 125 |
| 258 | 3300025901 | Ga0207688_10625736 | Ga0207688_106257362 | 125 |
| 259 | 3300025903 | Ga0207680_10165044 | Ga0207680_101650443 | 125 |
| 260 | 3300025904 | Ga0207647_10031932 | Ga0207647_100319324 | 125 |
| 261 | 3300025904 | Ga0207647_10041580 | Ga0207647_100415804 | 125 |
| 262 | 3300025907 | Ga0207645_10014557 | Ga0207645_100145576 | 125 |
| 263 | 3300025908 | Ga0207643_10431782 | Ga0207643_104317822 | 125 |
| 264 | 3300025909 | Ga0207705_10053092 | Ga0207705_100530922 | 125 |
| 265 | 3300025909 | Ga0207705_10072530 | Ga0207705_100725304 | 125 |
| 266 | 3300025911 | Ga0207654_10002263 | Ga0207654_100022638 | 125 |
| 267 | 3300025911 | Ga0207654_10152543 | Ga0207654_101525432 | 125 |
| 268 | 3300025911 | Ga0207654_10284420 | Ga0207654_102844202 | 125 |
| 269 | 3300025911 | Ga0207654_10295960 | Ga0207654_102959602 | 125 |
| 270 | 3300025911 | Ga0207654_10395965 | Ga0207654_103959652 | 125 |
| 271 | 3300025911 | Ga0207654_10785223 | Ga0207654_107852232 | 125 |
| 272 | 3300025911 | Ga0207654_11114581 | Ga0207654_111145811 | 125 |
| 273 | 3300025912 | Ga0207707_10131519 | Ga0207707_101315192 | 125 |
| 274 | 3300025912 | Ga0207707_10444633 | Ga0207707_104446333 | 125 |
| 275 | 3300025913 | Ga0207695_10000051 | Ga0207695_1000005146 | 125 |
| 276 | 3300025913 | Ga0207695_10000056 | Ga0207695_10000056196 | 125 |
| 277 | 3300025913 | Ga0207695_10000066 | Ga0207695_1000006687 | 125 |
| 278 | 3300025913 | Ga0207695_10000081 | Ga0207695_1000008146 | 125 |
| 279 | 3300025913 | Ga0207695_10000156 | Ga0207695_1000015622 | 125 |
| 280 | 3300025913 | Ga0207695_10000778 | Ga0207695_100007782 | 125 |
| 281 | 3300025913 | Ga0207695_10002773 | Ga0207695_100027735 | 125 |
| 282 | 3300025913 | Ga0207695_10027790 | Ga0207695_100277905 | 125 |
| 283 | 3300025913 | Ga0207695_10050894 | Ga0207695_100508943 | 125 |
| 284 | 3300025913 | Ga0207695_10234759 | Ga0207695_102347592 | 125 |
| 285 | 3300025913 | Ga0207695_10508598 | Ga0207695_105085982 | 125 |
| 286 | 3300025914 | Ga0207671_10001925 | Ga0207671_1000192513 | 125 |
| 287 | 3300025914 | Ga0207671_10003817 | Ga0207671_100038171 | 125 |
| 288 | 3300025914 | Ga0207671_10004406 | Ga0207671_1000440614 | 125 |
| 289 | 3300025914 | Ga0207671_10010183 | Ga0207671_100101838 | 125 |
| 290 | 3300025914 | Ga0207671_10140228 | Ga0207671_101402283 | 125 |
| 291 | 3300025914 | Ga0207671_10179936 | Ga0207671_101799362 | 125 |
| 292 | 3300025917 | Ga0207660_10015717 | Ga0207660_100157176 | 125 |
| 293 | 3300025917 | Ga0207660_10152805 | Ga0207660_101528052 | 125 |
| 294 | 3300025919 | Ga0207657_10096842 | Ga0207657_100968423 | 125 |
| 295 | 3300025920 | Ga0207649_10163071 | Ga0207649_101630713 | 125 |
| 296 | 3300025921 | Ga0207652_10004292 | Ga0207652_100042925 | 125 |
| 297 | 3300025921 | Ga0207652_10051391 | Ga0207652_100513914 | 125 |
| 298 | 3300025923 | Ga0207681_11385049 | Ga0207681_113850492 | 125 |
| 299 | 3300025924 | Ga0207694_10080350 | Ga0207694_100803502 | 125 |
| 300 | 3300025924 | Ga0207694_10130152 | Ga0207694_101301523 | 125 |
| 301 | 3300025924 | Ga0207694_10170886 | Ga0207694_101708862 | 125 |
| 302 | 3300025924 | Ga0207694_10366716 | Ga0207694_103667162 | 125 |
| 303 | 3300025925 | Ga0207650_10254160 | Ga0207650_102541602 | 125 |
| 304 | 3300025926 | Ga0207659_10240420 | Ga0207659_102404203 | 125 |
| 305 | 3300025931 | Ga0207644_11337968 | Ga0207644_113379682 | 125 |
| 306 | 3300025935 | Ga0207709_11509043 | Ga0207709_115090431 | 125 |
| 307 | 3300025937 | Ga0207669_10223395 | Ga0207669_102233952 | 125 |
| 308 | 3300025938 | Ga0207704_10457578 | Ga0207704_104575781 | 125 |
| 309 | 3300025938 | Ga0207704_11775786 | Ga0207704_117757861 | 125 |
| 310 | 3300025940 | Ga0207691_10008993 | Ga0207691_100089937 | 125 |
| 311 | 3300025940 | Ga0207691_10144191 | Ga0207691_101441913 | 125 |
| 312 | 3300025942 | Ga0207689_10020682 | Ga0207689_100206824 | 125 |
| 313 | 3300025942 | Ga0207689_10029163 | Ga0207689_100291634 | 125 |
| 314 | 3300025942 | Ga0207689_10953540 | Ga0207689_109535402 | 125 |
| 315 | 3300025944 | Ga0207661_10134500 | Ga0207661_101345002 | 125 |
| 316 | 3300025944 | Ga0207661_10139225 | Ga0207661_101392251 | 125 |
| 317 | 3300025944 | Ga0207661_10142881 | Ga0207661_101428813 | 125 |
| 318 | 3300025944 | Ga0207661_10766348 | Ga0207661_107663482 | 125 |
| 319 | 3300025944 | Ga0207661_10908018 | Ga0207661_109080181 | 125 |
| 320 | 3300025945 | Ga0207679_10135709 | Ga0207679_101357092 | 125 |
| 321 | 3300025949 | Ga0207667_10000713 | Ga0207667_1000071333 | 125 |
| 322 | 3300025949 | Ga0207667_10001674 | Ga0207667_100016746 | 125 |
| 323 | 3300025949 | Ga0207667_10028437 | Ga0207667_100284376 | 125 |
| 324 | 3300025949 | Ga0207667_10331045 | Ga0207667_103310452 | 125 |
| 325 | 3300025960 | Ga0207651_10015820 | Ga0207651_100158205 | 125 |
| 326 | 3300025972 | Ga0207668_10149154 | Ga0207668_101491542 | 125 |
| 327 | 3300025972 | Ga0207668_10621253 | Ga0207668_106212531 | 125 |
| 328 | 3300025981 | Ga0207640_10118075 | Ga0207640_101180751 | 125 |
| 329 | 3300025981 | Ga0207640_10122251 | Ga0207640_101222512 | 125 |
| 330 | 3300025981 | Ga0207640_10139199 | Ga0207640_101391992 | 125 |
| 331 | 3300025981 | Ga0207640_10243169 | Ga0207640_102431693 | 125 |
| 332 | 3300025981 | Ga0207640_10862207 | Ga0207640_108622072 | 125 |
| 333 | 3300025986 | Ga0207658_10020190 | Ga0207658_100201906 | 125 |
| 334 | 3300025986 | Ga0207658_10746184 | Ga0207658_107461842 | 125 |
| 335 | 3300026041 | Ga0207639_10012880 | Ga0207639_100128803 | 125 |
| 336 | 3300026041 | Ga0207639_10017764 | Ga0207639_100177644 | 125 |
| 337 | 3300026041 | Ga0207639_10071978 | Ga0207639_100719783 | 125 |
| 338 | 3300026041 | Ga0207639_10902457 | Ga0207639_109024571 | 125 |
| 339 | 3300026041 | Ga0207639_11496900 | Ga0207639_114969001 | 125 |
| 340 | 3300026078 | Ga0207702_10021240 | Ga0207702_100212406 | 125 |
| 341 | 3300026078 | Ga0207702_10142894 | Ga0207702_101428943 | 125 |
| 342 | 3300026078 | Ga0207702_11200102 | Ga0207702_112001022 | 125 |
| 343 | 3300026078 | Ga0207702_11369936 | Ga0207702_113699362 | 125 |
| 344 | 3300026088 | Ga0207641_11568499 | Ga0207641_115684992 | 125 |
| 345 | 3300026089 | Ga0207648_10003726 | Ga0207648_1000372610 | 125 |
| 346 | 3300026089 | Ga0207648_10080405 | Ga0207648_100804054 | 125 |
| 347 | 3300026089 | Ga0207648_10716544 | Ga0207648_107165442 | 125 |
| 348 | 3300026095 | Ga0207676_10039845 | Ga0207676_100398455 | 125 |
| 349 | 3300026116 | Ga0207674_10002012 | Ga0207674_1000201220 | 125 |
| 350 | 3300026118 | Ga0207675_100236612 | Ga0207675_1002366122 | 125 |
| 351 | 3300026118 | Ga0207675_100240144 | Ga0207675_1002401443 | 125 |
| 352 | 3300026118 | Ga0207675_100580431 | Ga0207675_1005804312 | 125 |
| 353 | 3300026118 | Ga0207675_101139565 | Ga0207675_1011395652 | 125 |
| 354 | 3300026118 | Ga0207675_101218131 | Ga0207675_1012181312 | 125 |
| 355 | 3300026121 | Ga0207683_11411006 | Ga0207683_114110061 | 125 |
| 356 | 3300026121 | Ga0207683_11702201 | Ga0207683_117022011 | 125 |
| 357 | 3300026142 | Ga0207698_10004751 | Ga0207698_100047512 | 125 |
| 358 | 3300026142 | Ga0207698_10024170 | Ga0207698_100241702 | 125 |
| 359 | 3300026142 | Ga0207698_10038406 | Ga0207698_100384064 | 125 |
| 360 | 3300026142 | Ga0207698_10043618 | Ga0207698_100436184 | 125 |
| 361 | 3300026142 | Ga0207698_10134888 | Ga0207698_101348884 | 125 |
| 362 | 3300026142 | Ga0207698_10468351 | Ga0207698_104683512 | 125 |
| 363 | 3300026142 | Ga0207698_10559093 | Ga0207698_105590931 | 125 |
| 364 | 3300026142 | Ga0207698_12012418 | Ga0207698_120124181 | 125 |
| 365 | 3300027526 | Ga0209968_1046814 | Ga0209968_10468141 | 125 |
| 366 | 3300028379 | Ga0268266_10000073 | Ga0268266_1000007325 | 125 |
| 367 | 3300028379 | Ga0268266_10629876 | Ga0268266_106298761 | 125 |
| 368 | 3300028380 | Ga0268265_10006712 | Ga0268265_100067126 | 125 |
| 369 | 3300028380 | Ga0268265_11990433 | Ga0268265_119904331 | 125 |
| 370 | 3300028381 | Ga0268264_10000973 | Ga0268264_100009738 | 125 |
| 371 | 3300028381 | Ga0268264_10004437 | Ga0268264_1000443715 | 125 |
| 372 | 3300028381 | Ga0268264_10090288 | Ga0268264_100902882 | 125 |
| 373 | 3300028381 | Ga0268264_10126109 | Ga0268264_101261092 | 125 |
| 374 | 3300028381 | Ga0268264_10546669 | Ga0268264_105466692 | 125 |
| 375 | 3300028786 | Ga0307517_10075437 | Ga0307517_100754374 | 125 |
| 376 | 3300028786 | Ga0307517_10169437 | Ga0307517_101694373 | 125 |
| 377 | 3300030521 | Ga0307511_10000232 | Ga0307511_100002325 | 125 |
| 378 | 3300031240 | Ga0265320_10263333 | Ga0265320_102633332 | 125 |
| 379 | 3300031456 | Ga0307513_10241313 | Ga0307513_102413133 | 125 |
| 380 | 3300031507 | Ga0307509_10108305 | Ga0307509_101083052 | 125 |
| 381 | 3300031507 | Ga0307509_10178032 | Ga0307509_101780323 | 125 |
| 382 | 3300031507 | Ga0307509_10563097 | Ga0307509_105630972 | 125 |
| 383 | 3300031548 | Ga0307408_100001245 | Ga0307408_10000124515 | 125 |
| 384 | 3300031548 | Ga0307408_100059733 | Ga0307408_1000597332 | 125 |
| 385 | 3300031548 | Ga0307408_100102511 | Ga0307408_1001025111 | 125 |
| 386 | 3300031548 | Ga0307408_100197325 | Ga0307408_1001973253 | 125 |
| 387 | 3300031616 | Ga0307508_10000181 | Ga0307508_1000018125 | 125 |
| 388 | 3300031730 | Ga0307516_10146874 | Ga0307516_101468742 | 125 |
| 389 | 3300031731 | Ga0307405_10032769 | Ga0307405_100327692 | 125 |
| 390 | 3300031824 | Ga0307413_10004719 | Ga0307413_100047193 | 125 |
| 391 | 3300031824 | Ga0307413_10234344 | Ga0307413_102343442 | 125 |
| 392 | 3300031852 | Ga0307410_10034501 | Ga0307410_100345012 | 125 |
| 393 | 3300031901 | Ga0307406_10000404 | Ga0307406_100004041 | 125 |
| 394 | 3300031901 | Ga0307406_10023017 | Ga0307406_100230172 | 125 |
| 395 | 3300031903 | Ga0307407_10185961 | Ga0307407_101859612 | 125 |
| 396 | 3300031903 | Ga0307407_10238443 | Ga0307407_102384432 | 125 |
| 397 | 3300031911 | Ga0307412_10025250 | Ga0307412_100252503 | 125 |
| 398 | 3300031995 | Ga0307409_100018059 | Ga0307409_1000180593 | 125 |
| 399 | 3300031995 | Ga0307409_101278977 | Ga0307409_1012789772 | 125 |
| 400 | 3300032002 | Ga0307416_100179705 | Ga0307416_1001797051 | 125 |
| 401 | 3300032002 | Ga0307416_101432988 | Ga0307416_1014329881 | 125 |
| 402 | 3300032004 | Ga0307414_10000052 | Ga0307414_10000052115 | 125 |
| 403 | 3300032004 | Ga0307414_10028364 | Ga0307414_100283643 | 125 |
| 404 | 3300032004 | Ga0307414_10047632 | Ga0307414_100476322 | 125 |
| 405 | 3300032004 | Ga0307414_10133539 | Ga0307414_101335393 | 125 |
| 406 | 3300032004 | Ga0307414_10162000 | Ga0307414_101620003 | 125 |
| 407 | 3300032004 | Ga0307414_10182668 | Ga0307414_101826682 | 125 |
| 408 | 3300032004 | Ga0307414_10865549 | Ga0307414_108655491 | 125 |
| 409 | 3300032005 | Ga0307411_10051637 | Ga0307411_100516371 | 125 |
| 410 | 3300032005 | Ga0307411_10910838 | Ga0307411_109108382 | 125 |
| 411 | 3300032126 | Ga0307415_100502271 | Ga0307415_1005022711 | 125 |
| 412 | 3300033180 | Ga0307510_10000637 | Ga0307510_1000063726 | 125 |
| 413 | 3300037312 | Ga0395899_0194311 | Ga0395899_0194311_392_769 | 125 |
| 414 | 3300037312 | Ga0395899_0384134 | Ga0395899_0384134_219_596 | 125 |
| 415 | 3300037312 | Ga0395899_0386796 | Ga0395899_0386796_292_669 | 125 |
| 416 | 3300037418 | Ga0395900_0207469 | Ga0395900_0207469_1499_1876 | 125 |
| 417 | 3300037418 | Ga0395900_0573779 | Ga0395900_0573779_302_679 | 125 |
| 418 | 3300037418 | Ga0395900_0574665 | Ga0395900_0574665_392_769 | 125 |
| 419 | 3300037466 | Ga0395898_0573709 | Ga0395898_0573709_392_769 | 125 |
| 420 | 3300037466 | Ga0395898_0574615 | Ga0395898_0574615_392_769 | 125 |
| 421 | 3300037471 | Ga0395905_0014608 | Ga0395905_0014608_899_1276 | 125 |
| 422 | 3300037471 | Ga0395905_0691188 | Ga0395905_0691188_254_631 | 125 |
| 423 | 3300038443 | Ga0395901_0119569 | Ga0395901_0119569_655_1032 | 125 |
| 424 | 3300038443 | Ga0395901_0181786 | Ga0395901_0181786_1141_1518 | 125 |
| 425 | 3300038443 | Ga0395901_0708627 | Ga0395901_0708627_302_679 | 125 |
| 426 | 3300041494 | Ga0451837_0175745 | Ga0451837_0175745_49_426 | 125 |
| 427 | 3300041501 | Ga0451845_0745347 | Ga0451845_0745347_81_464 | 125 |
| 428 | 3300041512 | Ga0451853_0292156 | Ga0451853_0292156_512_889 | 125 |
| 429 | 3300044673 | Ga0453683_0067000 | Ga0453683_0067000_1377_1754 | 125 |
| 430 | 3300044693 | Ga0466961_0034395 | Ga0466961_0034395_710_1090 | 125 |
| 431 | 3300044694 | Ga0466963_0088980 | Ga0466963_0088980_15_401 | 125 |
| 432 | 3300044706 | Ga0466964_0009653 | Ga0466964_0009653_2140_2517 | 125 |
| 433 | 3300044706 | Ga0466964_0139287 | Ga0466964_0139287_36_416 | 125 |
| 434 | 3300044712 | Ga0453684_0059472 | Ga0453684_0059472_2204_2581 | 125 |
| 435 | 3300044719 | Ga0466971_0040206 | Ga0466971_0040206_1155_1535 | 125 |
| 436 | 3300044735 | Ga0466968_0052519 | Ga0466968_0052519_1292_1669 | 125 |
| 437 | 3300044765 | Ga0466970_0214827 | Ga0466970_0214827_247_624 | 125 |
| 438 | 3300045049 | Ga0466959_0005141 | Ga0466959_0005141_529_909 | 125 |
| 439 | 3300045976 | Ga0466967_0161903 | Ga0466967_0161903_131_517 | 125 |
| 440 | 3300046460 | Ga0495638_0026894 | Ga0495638_0026894_2085_2465 | 125 |
| 441 | 3300046460 | Ga0495638_0028140 | Ga0495638_0028140_2016_2396 | 125 |
| 442 | 3300046507 | Ga0495606_0009808 | Ga0495606_0009808_5670_6050 | 125 |
| 443 | 3300046524 | Ga0495648_0002315 | Ga0495648_0002315_359_739 | 125 |
| 444 | 3300046616 | Ga0495668_0604032 | Ga0495668_0604032_193_570 | 125 |
| 445 | 3300046648 | Ga0495611_0001153 | Ga0495611_0001153_574_954 | 125 |
| 446 | 3300046648 | Ga0495611_0030145 | Ga0495611_0030145_1872_2252 | 125 |
| 447 | 3300046660 | Ga0495625_0419761 | Ga0495625_0419761_164_541 | 125 |
| 448 | 3300046660 | Ga0495625_0560692 | Ga0495625_0560692_193_573 | 125 |
| 449 | 3300046694 | Ga0495649_0146982 | Ga0495649_0146982_709_1086 | 125 |
| 450 | 3300046694 | Ga0495649_0473505 | Ga0495649_0473505_97_477 | 125 |
| 451 | 3300047323 | Ga0495683_0222870 | Ga0495683_0222870_382_762 | 125 |
| 452 | 3300047443 | Ga0495687_000179 | Ga0495687_000179_2222_2602 | 125 |
| 453 | 3300047472 | Ga0495686_0000010 | Ga0495686_0000010_336771_337148 | 125 |
| 454 | 3300048918 | Ga0496115_0870958 | Ga0496115_0870958_26_406 | 125 |
| 455 | 3300048926 | Ga0496123_0389536 | Ga0496123_0389536_11_388 | 125 |
| 456 | 3300048929 | Ga0496126_0735119 | Ga0496126_0735119_101_481 | 125 |
| 457 | 3300049569 | Ga0501032_0380597 | Ga0501032_0380597_11_397 | 125 |
| 458 | 3300049570 | Ga0501033_0011966 | Ga0501033_0011966_1938_2324 | 125 |
| 459 | 3300049571 | Ga0501034_0125286 | Ga0501034_0125286_1679_2056 | 125 |
| 460 | 3300049571 | Ga0501034_0166402 | Ga0501034_0166402_1188_1574 | 125 |
| 461 | 3300049572 | Ga0501036_0004307 | Ga0501036_0004307_6977_7354 | 125 |
| 462 | 3300049573 | Ga0501037_0041022 | Ga0501037_0041022_2603_2980 | 125 |
| 463 | 3300049573 | Ga0501037_0864110 | Ga0501037_0864110_110_496 | 125 |
| 464 | 3300049575 | Ga0501039_0360952 | Ga0501039_0360952_270_647 | 125 |
| 465 | 3300049579 | Ga0501043_0033919 | Ga0501043_0033919_87_473 | 125 |
| 466 | 3300049579 | Ga0501043_0142344 | Ga0501043_0142344_1281_1658 | 125 |
| 467 | 3300049580 | Ga0501046_0033176 | Ga0501046_0033176_681_1058 | 125 |
| 468 | 3300049581 | Ga0501047_0053697 | Ga0501047_0053697_770_1156 | 125 |
| 469 | 3300049581 | Ga0501047_0067395 | Ga0501047_0067395_2853_3230 | 125 |
| 470 | 3300049582 | Ga0501048_0006935 | Ga0501048_0006935_5423_5800 | 125 |
| 471 | 3300049582 | Ga0501048_0218006 | Ga0501048_0218006_873_1259 | 125 |
| 472 | 3300049583 | Ga0501067_0028416 | Ga0501067_0028416_254_631 | 125 |
| 473 | 3300049584 | Ga0501068_0115527 | Ga0501068_0115527_866_1243 | 125 |
| 474 | 3300049585 | Ga0501069_0166456 | Ga0501069_0166456_688_1065 | 125 |
| 475 | 3300049586 | Ga0501070_0037058 | Ga0501070_0037058_848_1225 | 125 |
| 476 | 3300049589 | Ga0501073_0000302 | Ga0501073_0000302_18550_18927 | 125 |
| 477 | 3300049590 | Ga0501074_0000754 | Ga0501074_0000754_18266_18643 | 125 |
| 478 | 3300049593 | Ga0501077_0315025 | Ga0501077_0315025_432_809 | 125 |
| 479 | 3300049663 | Ga0501223_032405 | Ga0501223_032405_79_456 | 125 |
| 480 | 3300049665 | Ga0501227_001545 | Ga0501227_001545_2010_2387 | 125 |
| 481 | 3300049674 | Ga0501242_027402 | Ga0501242_027402_266_649 | 125 |
| 482 | 3300049674 | Ga0501242_047035 | Ga0501242_047035_224_601 | 125 |
| 483 | 3300049677 | Ga0501247_080045 | Ga0501247_080045_67_450 | 125 |
| 484 | 3300049679 | Ga0501249_167419 | Ga0501249_167419_84_467 | 125 |
| 485 | 3300049707 | Ga0501234_079819 | Ga0501234_079819_19_402 | 125 |
| 486 | 3300049744 | Ga0501083_0062154 | Ga0501083_0062154_1466_1843 | 125 |
| 487 | 3300049770 | Ga0501273_018901 | Ga0501273_018901_392_775 | 125 |
| 488 | 3300049822 | Ga0501035_0029492 | Ga0501035_0029492_3442_3819 | 125 |
| 489 | 3300049823 | Ga0501044_0056382 | Ga0501044_0056382_3400_3786 | 125 |
| 490 | 3300049823 | Ga0501044_0076382 | Ga0501044_0076382_183_560 | 125 |
| 491 | 3300050493 | nmdc:mga0k408_184103_c1 | nmdc:mga0k408_184103_c1_536_913 | 125 |
| 492 | 3300050494 | nmdc:mga06z11_1022635_c1 | nmdc:mga06z11_1022635_c1_36_413 | 125 |
| 493 | 3300053086 | Ga0500578_0469291 | Ga0500578_0469291_125_505 | 125 |
| 494 | 3300053087 | Ga0500643_102255 | Ga0500643_102255_253_633 | 125 |
| 495 | 3300053088 | Ga0500644_0048729 | Ga0500644_0048729_937_1317 | 125 |
| 496 | 3300053090 | Ga0500646_0001812 | Ga0500646_0001812_1778_2155 | 125 |
| 497 | 3300053092 | Ga0500583_0002281 | Ga0500583_0002281_1654_2034 | 125 |
| 498 | 3300053122 | Ga0500608_269706 | Ga0500608_269706_108_488 | 125 |
| 499 | 3300053130 | Ga0500642_0132452 | Ga0500642_0132452_17_397 | 125 |
| 500 | 3300053131 | Ga0500652_243122 | Ga0500652_243122_145_522 | 125 |
| 501 | 3300053133 | Ga0500655_012047 | Ga0500655_012047_156_536 | 125 |
| 502 | 3300053136 | Ga0500559_0000580 | Ga0500559_0000580_3786_4163 | 125 |
| 503 | 3300053139 | Ga0500568_0018171 | Ga0500568_0018171_617_997 | 125 |
| 504 | 3300053142 | Ga0500577_0279760 | Ga0500577_0279760_210_590 | 125 |
| 505 | 3300053146 | Ga0500588_0001757 | Ga0500588_0001757_483_860 | 125 |
| 506 | 3300053148 | Ga0500590_247765 | Ga0500590_247765_178_558 | 125 |
| 507 | 3300053151 | Ga0500604_0323582 | Ga0500604_0323582_102_479 | 125 |
| 508 | 3300053156 | Ga0500622_0003896 | Ga0500622_0003896_7173_7553 | 125 |
| 509 | 3300053178 | Ga0500637_0050787 | Ga0500637_0050787_1403_1783 | 125 |
| 510 | 3300053178 | Ga0500637_0217632 | Ga0500637_0217632_294_674 | 125 |
| 511 | 3300054114 | Ga0501084_0065651 | Ga0501084_0065651_2078_2455 | 125 |
| 512 | 3300060353 | Ga0501082_0127210 | Ga0501082_0127210_301_678 | 125 |
| 513 | 3300061719 | Ga0466962_0053217 | Ga0466962_0053217_670_1050 | 125 |
| 514 | 3300002738 | JGI25154J39366_1000006 | JGI25154J39366_100000697 | 126 |
| 515 | 3300002741 | JGI25157J39369_1003000 | JGI25157J39369_10030005 | 126 |
| 516 | 3300003215 | JGI25153J46596_10000827 | JGI25153J46596_1000082711 | 126 |
| 517 | 3300003323 | rootH1_10001241 | rootH1_100012416 | 126 |
| 518 | 3300003354 | JGI25160J50197_1004979 | JGI25160J50197_10049797 | 126 |
| 519 | 3300003761 | Ga0055535_1004403 | Ga0055535_10044034 | 126 |
| 520 | 3300003762 | Ga0055542_1003719 | Ga0055542_10037196 | 126 |
| 521 | 3300005262 | Ga0065165_1010013 | Ga0065165_10100133 | 126 |
| 522 | 3300005327 | Ga0070658_10064572 | Ga0070658_100645723 | 126 |
| 523 | 3300005330 | Ga0070690_100580825 | Ga0070690_1005808252 | 126 |
| 524 | 3300005336 | Ga0070680_100151810 | Ga0070680_1001518102 | 126 |
| 525 | 3300005367 | Ga0070667_100560104 | Ga0070667_1005601042 | 126 |
| 526 | 3300005471 | Ga0070698_100030250 | Ga0070698_1000302502 | 126 |
| 527 | 3300005518 | Ga0070699_100012095 | Ga0070699_1000120952 | 126 |
| 528 | 3300005535 | Ga0070684_100443289 | Ga0070684_1004432892 | 126 |
| 529 | 3300005546 | Ga0070696_100053796 | Ga0070696_1000537963 | 126 |
| 530 | 3300005564 | Ga0070664_100075140 | Ga0070664_1000751402 | 126 |
| 531 | 3300005578 | Ga0068854_102209361 | Ga0068854_1022093611 | 126 |
| 532 | 3300005618 | Ga0068864_100092332 | Ga0068864_1000923322 | 126 |
| 533 | 3300005618 | Ga0068864_100137090 | Ga0068864_1001370902 | 126 |
| 534 | 3300005841 | Ga0068863_100019900 | Ga0068863_1000199007 | 126 |
| 535 | 3300005841 | Ga0068863_100268162 | Ga0068863_1002681622 | 126 |
| 536 | 3300005842 | Ga0068858_100711816 | Ga0068858_1007118162 | 126 |
| 537 | 3300005843 | Ga0068860_100890582 | Ga0068860_1008905822 | 126 |
| 538 | 3300006844 | Ga0075428_100093090 | Ga0075428_1000930904 | 126 |
| 539 | 3300006844 | Ga0075428_100412552 | Ga0075428_1004125522 | 126 |
| 540 | 3300006847 | Ga0075431_100391686 | Ga0075431_1003916862 | 126 |
| 541 | 3300006931 | Ga0097620_100419814 | Ga0097620_1004198142 | 126 |
| 542 | 3300009094 | Ga0111539_10289205 | Ga0111539_102892052 | 126 |
| 543 | 3300009094 | Ga0111539_11414110 | Ga0111539_114141102 | 126 |
| 544 | 3300009094 | Ga0111539_12901970 | Ga0111539_129019701 | 126 |
| 545 | 3300009147 | Ga0114129_10102207 | Ga0114129_101022074 | 126 |
| 546 | 3300009147 | Ga0114129_11297970 | Ga0114129_112979702 | 126 |
| 547 | 3300009545 | Ga0105237_10858237 | Ga0105237_108582371 | 126 |
| 548 | 3300011119 | Ga0105246_10684583 | Ga0105246_106845832 | 126 |
| 549 | 3300013297 | Ga0157378_10561088 | Ga0157378_105610881 | 126 |
| 550 | 3300013307 | Ga0157372_10813964 | Ga0157372_108139642 | 126 |
| 551 | 3300013308 | Ga0157375_11447129 | Ga0157375_114471291 | 126 |
| 552 | 3300014325 | Ga0163163_10088748 | Ga0163163_100887482 | 126 |
| 553 | 3300014325 | Ga0163163_10342377 | Ga0163163_103423772 | 126 |
| 554 | 3300014968 | Ga0157379_10123521 | Ga0157379_101235211 | 126 |
| 555 | 3300014968 | Ga0157379_10863971 | Ga0157379_108639712 | 126 |
| 556 | 3300014969 | Ga0157376_11118885 | Ga0157376_111188852 | 126 |
| 557 | 3300017792 | Ga0163161_10719221 | Ga0163161_107192212 | 126 |
| 558 | 3300025242 | Ga0209258_100029 | Ga0209258_100029304 | 126 |
| 559 | 3300025245 | Ga0207425_1037748 | Ga0207425_10377482 | 126 |
| 560 | 3300025246 | Ga0209646_1000031 | Ga0209646_1000031129 | 126 |
| 561 | 3300025250 | Ga0209026_1000019 | Ga0209026_1000019129 | 126 |
| 562 | 3300025254 | Ga0209148_1000089 | Ga0209148_1000089212 | 126 |
| 563 | 3300025297 | Ga0209758_1003209 | Ga0209758_100320911 | 126 |
| 564 | 3300025302 | Ga0207426_1000445 | Ga0207426_100044518 | 126 |
| 565 | 3300025917 | Ga0207660_10614591 | Ga0207660_106145912 | 126 |
| 566 | 3300025917 | Ga0207660_11216029 | Ga0207660_112160292 | 126 |
| 567 | 3300025920 | Ga0207649_10371679 | Ga0207649_103716791 | 126 |
| 568 | 3300025932 | Ga0207690_10622987 | Ga0207690_106229872 | 126 |
| 569 | 3300025945 | Ga0207679_10118129 | Ga0207679_101181292 | 126 |
| 570 | 3300025981 | Ga0207640_11540678 | Ga0207640_115406781 | 126 |
| 571 | 3300025986 | Ga0207658_10362691 | Ga0207658_103626912 | 126 |
| 572 | 3300026088 | Ga0207641_10085654 | Ga0207641_100856543 | 126 |
| 573 | 3300026088 | Ga0207641_10151070 | Ga0207641_101510702 | 126 |
| 574 | 3300026089 | Ga0207648_11376805 | Ga0207648_113768051 | 126 |
| 575 | 3300026095 | Ga0207676_10326167 | Ga0207676_103261672 | 126 |
| 576 | 3300026095 | Ga0207676_11079115 | Ga0207676_110791152 | 126 |
| 577 | 3300027717 | Ga0209998_10029491 | Ga0209998_100294912 | 126 |
| 578 | 3300030734 | Ga0316179_1078913 | Ga0316179_10789132 | 126 |
| 579 | 3300031507 | Ga0307509_10061299 | Ga0307509_100612994 | 126 |
| 580 | 3300031548 | Ga0307408_100166439 | Ga0307408_1001664392 | 126 |
| 581 | 3300031731 | Ga0307405_10073057 | Ga0307405_100730571 | 126 |
| 582 | 3300031824 | Ga0307413_10044344 | Ga0307413_100443442 | 126 |
| 583 | 3300031824 | Ga0307413_10976038 | Ga0307413_109760382 | 126 |
| 584 | 3300031852 | Ga0307410_10026490 | Ga0307410_100264904 | 126 |
| 585 | 3300031852 | Ga0307410_10090396 | Ga0307410_100903962 | 126 |
| 586 | 3300031901 | Ga0307406_10018903 | Ga0307406_100189035 | 126 |
| 587 | 3300031901 | Ga0307406_10112503 | Ga0307406_101125032 | 126 |
| 588 | 3300031901 | Ga0307406_10148922 | Ga0307406_101489222 | 126 |
| 589 | 3300031911 | Ga0307412_11424086 | Ga0307412_114240862 | 126 |
| 590 | 3300031995 | Ga0307409_100044542 | Ga0307409_1000445424 | 126 |
| 591 | 3300031995 | Ga0307409_100236268 | Ga0307409_1002362682 | 126 |
| 592 | 3300031995 | Ga0307409_100635794 | Ga0307409_1006357941 | 126 |
| 593 | 3300032002 | Ga0307416_100117717 | Ga0307416_1001177171 | 126 |
| 594 | 3300032002 | Ga0307416_100215596 | Ga0307416_1002155961 | 126 |
| 595 | 3300032002 | Ga0307416_100382202 | Ga0307416_1003822022 | 126 |
| 596 | 3300032004 | Ga0307414_10278391 | Ga0307414_102783912 | 126 |
| 597 | 3300032004 | Ga0307414_10516010 | Ga0307414_105160101 | 126 |
| 598 | 3300032005 | Ga0307411_10021864 | Ga0307411_100218644 | 126 |
| 599 | 3300032005 | Ga0307411_10095276 | Ga0307411_100952762 | 126 |
| 600 | 3300032126 | Ga0307415_100193110 | Ga0307415_1001931101 | 126 |
| 601 | 3300032126 | Ga0307415_100313629 | Ga0307415_1003136292 | 126 |
| 602 | 3300032126 | Ga0307415_101324770 | Ga0307415_1013247702 | 126 |
| 603 | 3300034816 | Ga0373930_0017728 | Ga0373930_0017728_243_632 | 126 |
| 604 | 3300035241 | Ga0373961_0046634 | Ga0373961_0046634_736_1125 | 126 |
| 605 | 3300035242 | Ga0373962_0038271 | Ga0373962_0038271_411_800 | 126 |
| 606 | 3300035724 | Ga0373933_0741535 | Ga0373933_0741535_253_633 | 126 |
| 607 | 3300041406 | Ga0439439_0003919 | Ga0439439_0003919_1051_1452 | 126 |
| 608 | 3300041406 | Ga0439439_0174051 | Ga0439439_0174051_28_417 | 126 |
| 609 | 3300041999 | Ga0439433_0056306 | Ga0439433_0056306_153_554 | 126 |
| 610 | 3300041999 | Ga0439433_0223219 | Ga0439433_0223219_30_419 | 126 |
| 611 | 3300042014 | Ga0439457_014463 | Ga0439457_014463_599_1000 | 126 |
| 612 | 3300042015 | Ga0439462_0004254 | Ga0439462_0004254_2758_3159 | 126 |
| 613 | 3300042015 | Ga0439462_0122260 | Ga0439462_0122260_59_448 | 126 |
| 614 | 3300042125 | Ga0450923_151684 | Ga0450923_151684_48_449 | 126 |
| 615 | 3300042128 | Ga0450897_043261 | Ga0450897_043261_111_500 | 126 |
| 616 | 3300042134 | Ga0450898_003159 | Ga0450898_003159_935_1324 | 126 |
| 617 | 3300042156 | Ga0439446_0015945 | Ga0439446_0015945_1219_1620 | 126 |
| 618 | 3300042184 | Ga0450908_052247 | Ga0450908_052247_271_660 | 126 |
| 619 | 3300042435 | Ga0439434_0056500 | Ga0439434_0056500_378_779 | 126 |
| 620 | 3300042435 | Ga0439434_0105984 | Ga0439434_0105984_358_747 | 126 |
| 621 | 3300042532 | Ga0450893_0094336 | Ga0450893_0094336_173_562 | 126 |
| 622 | 3300042876 | Ga0451577_0020179 | Ga0451577_0020179_4310_4735 | 126 |
| 623 | 3300045051 | Ga0451576_1503075 | Ga0451576_1503075_115_504 | 126 |
| 624 | 3300046499 | Ga0495594_0028657 | Ga0495594_0028657_2280_2669 | 126 |
| 625 | 3300048904 | Ga0496101_0598287 | Ga0496101_0598287_397_786 | 126 |
| 626 | 3300048905 | Ga0496102_1540391 | Ga0496102_1540391_133_522 | 126 |
| 627 | 3300048908 | Ga0496105_0257520 | Ga0496105_0257520_23_412 | 126 |
| 628 | 3300048909 | Ga0496106_0284353 | Ga0496106_0284353_568_957 | 126 |
| 629 | 3300048909 | Ga0496106_0728810 | Ga0496106_0728810_157_546 | 126 |
| 630 | 3300048911 | Ga0496108_0000454 | Ga0496108_0000454_14861_15250 | 126 |
| 631 | 3300048911 | Ga0496108_0114107 | Ga0496108_0114107_1717_2106 | 126 |
| 632 | 3300048911 | Ga0496108_1118980 | Ga0496108_1118980_29_418 | 126 |
| 633 | 3300048912 | Ga0496109_0004696 | Ga0496109_0004696_654_1043 | 126 |
| 634 | 3300048912 | Ga0496109_0846179 | Ga0496109_0846179_100_489 | 126 |
| 635 | 3300048913 | Ga0496110_0009965 | Ga0496110_0009965_6772_7161 | 126 |
| 636 | 3300048914 | Ga0496111_0068890 | Ga0496111_0068890_1444_1833 | 126 |
| 637 | 3300048914 | Ga0496111_0115777 | Ga0496111_0115777_1549_1938 | 126 |
| 638 | 3300048914 | Ga0496111_0525593 | Ga0496111_0525593_367_756 | 126 |
| 639 | 3300048915 | Ga0496112_0000336 | Ga0496112_0000336_20859_21248 | 126 |
| 640 | 3300048916 | Ga0496113_0000286 | Ga0496113_0000286_8853_9242 | 126 |
| 641 | 3300049514 | Ga0501291_013912 | Ga0501291_013912_219_608 | 126 |
| 642 | 3300049573 | Ga0501037_0505749 | Ga0501037_0505749_341_721 | 126 |
| 643 | 3300049581 | Ga0501047_0093604 | Ga0501047_0093604_2269_2649 | 126 |
| 644 | 3300049584 | Ga0501068_0992822 | Ga0501068_0992822_120_509 | 126 |
| 645 | 3300049585 | Ga0501069_0296809 | Ga0501069_0296809_530_919 | 126 |
| 646 | 3300049586 | Ga0501070_0119799 | Ga0501070_0119799_1453_1842 | 126 |
| 647 | 3300049588 | Ga0501072_0051833 | Ga0501072_0051833_1467_1856 | 126 |
| 648 | 3300049589 | Ga0501073_1234566 | Ga0501073_1234566_26_415 | 126 |
| 649 | 3300049591 | Ga0501075_0063049 | Ga0501075_0063049_1846_2235 | 126 |
| 650 | 3300049671 | Ga0501238_038654 | Ga0501238_038654_193_573 | 126 |
| 651 | 3300049703 | Ga0501219_000106 | Ga0501219_000106_1404_1784 | 126 |
| 652 | 3300049741 | Ga0501079_0044593 | Ga0501079_0044593_2533_2922 | 126 |
| 653 | 3300049742 | Ga0501080_0045485 | Ga0501080_0045485_2364_2753 | 126 |
| 654 | 3300049742 | Ga0501080_0646528 | Ga0501080_0646528_352_741 | 126 |
| 655 | 3300049758 | Ga0501241_003713 | Ga0501241_003713_2000_2380 | 126 |
| 656 | 3300049765 | Ga0501268_155552 | Ga0501268_155552_69_458 | 126 |
| 657 | 3300049822 | Ga0501035_0212737 | Ga0501035_0212737_511_891 | 126 |
| 658 | 3300049823 | Ga0501044_0067956 | Ga0501044_0067956_1446_1826 | 126 |
| 659 | 3300049824 | Ga0501045_0782509 | Ga0501045_0782509_222_611 | 126 |
| 660 | 3300050005 | Ga0501284_00148 | Ga0501284_00148_3142_3522 | 126 |
| 661 | 3300050507 | nmdc:mga05p37_142533_c1 | nmdc:mga05p37_142533_c1_1478_1867 | 126 |
| 662 | 3300050508 | nmdc:mga09592_309398_c1 | nmdc:mga09592_309398_c1_184_573 | 126 |
| 663 | 3300050510 | nmdc:mga06r32_183164_c1 | nmdc:mga06r32_183164_c1_1574_1963 | 126 |
| 664 | 3300050511 | nmdc:mga08y16_1172790_c1 | nmdc:mga08y16_1172790_c1_30_410 | 126 |
| 665 | 3300050511 | nmdc:mga08y16_593501_c1 | nmdc:mga08y16_593501_c1_408_797 | 126 |
| 666 | 3300053088 | Ga0500644_0000117 | Ga0500644_0000117_36756_37136 | 126 |
| 667 | 3300053109 | Ga0500569_000434 | Ga0500569_000434_546_926 | 126 |
| 668 | 3300053118 | Ga0500594_0081157 | Ga0500594_0081157_107_487 | 126 |
| 669 | 3300053121 | Ga0500607_050200 | Ga0500607_050200_989_1369 | 126 |
| 670 | 3300053122 | Ga0500608_133717 | Ga0500608_133717_531_911 | 126 |
| 671 | 3300053131 | Ga0500652_059722 | Ga0500652_059722_1107_1487 | 126 |
| 672 | 3300053134 | Ga0500658_0006812 | Ga0500658_0006812_3210_3590 | 126 |
| 673 | 3300053136 | Ga0500559_0032244 | Ga0500559_0032244_1642_2022 | 126 |
| 674 | 3300053137 | Ga0500561_0226260 | Ga0500561_0226260_62_442 | 126 |
| 675 | 3300053142 | Ga0500577_0003665 | Ga0500577_0003665_663_1043 | 126 |
| 676 | 3300053148 | Ga0500590_032355 | Ga0500590_032355_533_913 | 126 |
| 677 | 3300053153 | Ga0500616_0137764 | Ga0500616_0137764_409_789 | 126 |
| 678 | 3300053160 | Ga0500633_0001931 | Ga0500633_0001931_3528_3908 | 126 |
| 679 | 3300053177 | Ga0500636_0005080 | Ga0500636_0005080_3134_3514 | 126 |
| 680 | 3300055283 | Ga0500661_004973 | Ga0500661_004973_201_623 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1onl-assembly3.cif.gz_C | crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system | 0.9826 | 2 | 124 |
| 1htp-assembly1.cif.gz_A | refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex | 0.9743 | 1 | 122 |
| 3wdn-assembly1.cif.gz_A | high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method | 0.9683 | 5 | 124 |
| 3hgb-assembly1.cif.gz_A | crystal structure of glycine cleavage system protein h from mycobacterium tuberculosis | 0.9594 | 2 | 123 |
| 2ka7-assembly1.cif.gz_A | nmr solution structure of tm0212 at 40 c | 0.9558 | 7 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3wdnA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9677 | 5 | 124 | 2.40.50.100 |
| af_Q20634_6_139_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9676 | 5 | 123 | 2.40.50.100 |
| af_A4IC11_1_107_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9527 | 20 | 124 | 2.40.50.100 |
| af_Q4E4F5_6_138_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9444 | 5 | 124 | 2.40.50.100 |
| af_K7TZ76_31_128_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9393 | 37 | 124 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3E1Y9Y3-F1-model_v4 | Glycine cleavage system H protein | 1.003 | 1 | 126 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A7D4ULF5-F1-model_v4 | Glycine cleavage system H protein | 1.003 | 1 | 126 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-I4AGP6-F1-model_v4 | Glycine cleavage system H protein | 1.003 | 1 | 125 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A3M7TI61-F1-model_v4 | Glycine cleavage system H protein | 1 | 1 | 125 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A1H9G454-F1-model_v4 | Glycine cleavage system H protein | 0.9972 | 1 | 126 |
GO:0005829
GO:0005960 GO:0019464 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar