F474770

General Info

Members Datasets Scaffolds Average Seq Length
680 316 678 126

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10921903|Ga0105241_109219032
Length 145
Sequence LINKKILICKSINHNNKNIYMNFPENLRYTKDHEWILLEGDIATVGITDFAQHELGDIVYVEIETKGKSLAAETVFGTVEAVKTVSDLFLPVSGTIIEINPLLEKEPEKVNNDPYGDGWMIKMKVDDPDAVSRLMDKEAYQKIMA

Samples

Sample ID Description Type Environment
1 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
2 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
163 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
192 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
193 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
196 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
197 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
198 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
199 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
200 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
201 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
202 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
203 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
204 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
226 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
263 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
264 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
265 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
266 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
267 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
268 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
269 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
275 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
276 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
281 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
282 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
288 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
289 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
290 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
291 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
292 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
293 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
294 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
295 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
296 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
297 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
298 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
299 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
302 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
303 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
304 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
305 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
306 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
309 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
310 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
311 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
312 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
313 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
315 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
316 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.76
Nodule 0
Rhizoplane 2.5
Rhizosphere 86.62
Stem 0
Stem Tuber 0
Unclassified 4.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000006 3300002738 Bacteria 336396
2 JGI25157J39369_1003000 3300002741 Bacteria 3701
3 JGI25153J46596_10000827 3300003215 Bacteria 18904
4 rootH1_10023398 3300003316 Bacteria 8434
5 rootH2_10109333 3300003320 Bacteria 1259
6 rootH1_10001241 3300003316 Bacteria 2253
7 rootH1_10001241 3300003323 Bacteria 4779
8 rootH1_10036348 3300003323 Bacteria 2903
9 JGI25160J50197_1004979 3300003354 Bacteria 5636
10 Ga0055535_1004403 3300003761 Bacteria 3431
11 Ga0055542_1003719 3300003762 Bacteria 3987
12 Ga0065165_1010013 3300005262 Bacteria 4168
13 Ga0070658_10064572 3300005327 Bacteria 2986
14 Ga0070658_10065092 3300005327 Bacteria 2974
15 Ga0070676_10900583 3300005328 Bacteria 659
16 Ga0070683_100001587 3300005329 Bacteria 17593
17 Ga0070683_100250941 3300005329 Bacteria 1683
18 Ga0070683_100783335 3300005329 Unclassified 914
19 Ga0070683_100866395 3300005329 Bacteria 866
20 Ga0070683_102103663 3300005329 Bacteria 542
21 Ga0070690_100580825 3300005330 Unclassified 848
22 Ga0070670_100056793 3300005331 Bacteria 3360
23 Ga0070670_100151928 3300005331 Bacteria 2004
24 Ga0070670_100318598 3300005331 Bacteria 1362
25 Ga0070670_101202821 3300005331 Bacteria 693
26 Ga0070677_10052159 3300005333 Bacteria 1659
27 Ga0068869_100057460 3300005334 Bacteria 2841
28 Ga0068869_100933983 3300005334 Bacteria 752
29 Ga0070666_10097033 3300005335 Bacteria 2029
30 Ga0070666_10390710 3300005335 Bacteria 999
31 Ga0070680_100027158 3300005336 Bacteria 4584
32 Ga0070680_100151810 3300005336 Bacteria 1945
33 Ga0070682_100021600 3300005337 Bacteria 3801
34 Ga0070682_100051139 3300005337 Bacteria 2582
35 Ga0070682_100352787 3300005337 Unclassified 1097
36 Ga0068868_100616176 3300005338 Bacteria 963
37 Ga0068868_101215262 3300005338 Bacteria 697
38 Ga0070660_100092212 3300005339 Bacteria 2391
39 Ga0070689_100856546 3300005340 Bacteria 802
40 Ga0070691_10005121 3300005341 Bacteria 5958
41 Ga0070691_10050069 3300005341 Bacteria 1992
42 Ga0070687_100661212 3300005343 Bacteria 725
43 Ga0070687_101246530 3300005343 Unclassified 550
44 Ga0070661_101386690 3300005344 Bacteria 591
45 Ga0070668_100009533 3300005347 Bacteria 7204
46 Ga0070668_100028705 3300005347 Bacteria 4222
47 Ga0070668_101624260 3300005347 Unclassified 592
48 Ga0070669_100000286 3300005353 Bacteria 39758
49 Ga0070669_101560518 3300005353 Unclassified 574
50 Ga0070675_100408204 3300005354 Bacteria 1213
51 Ga0070671_100922881 3300005355 Unclassified 763
52 Ga0070673_100162996 3300005364 Bacteria 1897
53 Ga0070659_100463640 3300005366 Bacteria 1076
54 Ga0070667_100099848 3300005367 Bacteria 2506
55 Ga0070667_100467128 3300005367 Bacteria 1154
56 Ga0070667_100560104 3300005367 Bacteria 1051
57 Ga0070710_10132057 3300005437 Bacteria 1523
58 Ga0070711_100661884 3300005439 Unclassified 876
59 Ga0070705_100405228 3300005440 Bacteria 1011
60 Ga0070694_100111413 3300005444 Unclassified 1950
61 Ga0070708_100034768 3300005445 Bacteria 4386
62 Ga0070663_101515561 3300005455 Unclassified 596
63 Ga0070663_101916499 3300005455 Unclassified 532
64 Ga0070678_100268594 3300005456 Unclassified 1437
65 Ga0070678_100872159 3300005456 Bacteria 821
66 Ga0070678_101500986 3300005456 Unclassified 631
67 Ga0070681_10021141 3300005458 Bacteria 6521
68 Ga0070681_10325793 3300005458 Bacteria 1446
69 Ga0070681_10768457 3300005458 Bacteria 880
70 Ga0068867_100275001 3300005459 Bacteria 1379
71 Ga0068867_100302167 3300005459 Unclassified 1320
72 Ga0068867_100507484 3300005459 Unclassified 1037
73 Ga0070698_100030250 3300005471 Bacteria 5616
74 Ga0070699_100012095 3300005518 Bacteria 7448
75 Ga0070679_100000398 3300005530 Bacteria 37016
76 Ga0070679_100159173 3300005530 Bacteria 2233
77 Ga0070684_100033876 3300005535 Bacteria 4364
78 Ga0070684_100215644 3300005535 Bacteria 1750
79 Ga0070684_100240773 3300005535 Bacteria 1653
80 Ga0070684_100443289 3300005535 Bacteria 1199
81 Ga0070684_101293294 3300005535 Unclassified 686
82 Ga0068853_100002293 3300005539 Bacteria 14302
83 Ga0068853_100042107 3300005539 Bacteria 3903
84 Ga0068853_100054056 3300005539 Bacteria 3460
85 Ga0068853_100095837 3300005539 Bacteria 2617
86 Ga0070672_100148086 3300005543 Bacteria 1941
87 Ga0070672_100270486 3300005543 Bacteria 1435
88 Ga0070696_100053796 3300005546 Bacteria 2803
89 Ga0070665_100000002 3300005548 Bacteria 849037
90 Ga0070665_100338470 3300005548 Unclassified 1509
91 Ga0070704_102138276 3300005549 Bacteria 520
92 Ga0068855_100000303 3300005563 Bacteria 61260
93 Ga0068855_100055326 3300005563 Unclassified 4661
94 Ga0068855_100066058 3300005563 Bacteria 4217
95 Ga0068855_100070130 3300005563 Bacteria 4078
96 Ga0068855_100310751 3300005563 Unclassified 1744
97 Ga0068855_100818299 3300005563 Bacteria 989
98 Ga0070664_100040078 3300005564 Bacteria 3948
99 Ga0070664_100075140 3300005564 Bacteria 2901
100 Ga0070664_100365483 3300005564 Bacteria 1315
101 Ga0068857_100009853 3300005577 Bacteria 8298
102 Ga0068857_100023721 3300005577 Bacteria 5401
103 Ga0068857_100599898 3300005577 Unclassified 1041
104 Ga0068854_100048807 3300005578 Bacteria 3021
105 Ga0068854_100199560 3300005578 Bacteria 1572
106 Ga0068854_100240485 3300005578 Bacteria 1441
107 Ga0068854_100466724 3300005578 Unclassified 1057
108 Ga0068854_100767449 3300005578 Bacteria 838
109 Ga0068854_101356387 3300005578 Bacteria 642
110 Ga0068854_101418168 3300005578 Bacteria 628
111 Ga0068854_102209361 3300005578 Bacteria 509
112 Ga0068856_100018889 3300005614 Bacteria 6685
113 Ga0068856_100062498 3300005614 Bacteria 3678
114 Ga0068856_100142153 3300005614 Bacteria 2407
115 Ga0068852_100000744 3300005616 Bacteria 21378
116 Ga0068852_100016599 3300005616 Bacteria 5749
117 Ga0068852_100025486 3300005616 Bacteria 4792
118 Ga0068852_100101947 3300005616 Bacteria 2593
119 Ga0068852_100395602 3300005616 Bacteria 1358
120 Ga0068859_100240106 3300005617 Unclassified 1901
121 Ga0068859_100400910 3300005617 Unclassified 1468
122 Ga0068859_102466703 3300005617 Bacteria 573
123 Ga0068864_100062502 3300005618 Bacteria 3226
124 Ga0068864_100092332 3300005618 Bacteria 2672
125 Ga0068864_100137090 3300005618 Bacteria 2204
126 Ga0068864_101292180 3300005618 Unclassified 730
127 Ga0068866_10065788 3300005718 Bacteria 1897
128 Ga0068866_10108731 3300005718 Bacteria 1543
129 Ga0068861_100048923 3300005719 Bacteria 3199
130 Ga0068861_101315335 3300005719 Bacteria 703
131 Ga0068851_10151435 3300005834 Unclassified 1268
132 Ga0068870_10106797 3300005840 Bacteria 1592
133 Ga0068870_10539382 3300005840 Unclassified 784
134 Ga0068870_10557603 3300005840 Unclassified 772
135 Ga0068863_100019900 3300005841 Bacteria 6420
136 Ga0068863_100136868 3300005841 Bacteria 2340
137 Ga0068863_100268162 3300005841 Bacteria 1652
138 Ga0068863_101900279 3300005841 Unclassified 605
139 Ga0068858_100661564 3300005842 Bacteria 1015
140 Ga0068858_100711816 3300005842 Bacteria 977
141 Ga0068860_100000003 3300005843 Bacteria 575741
142 Ga0068860_100001341 3300005843 Bacteria 26789
143 Ga0068860_100005037 3300005843 Bacteria 13446
144 Ga0068860_100196827 3300005843 Unclassified 1952
145 Ga0068860_100348020 3300005843 Bacteria 1458
146 Ga0068860_100890582 3300005843 Bacteria 906
147 Ga0068860_102257620 3300005843 Bacteria 565
148 Ga0068860_102502556 3300005843 Bacteria 536
149 Ga0068862_100000640 3300005844 Bacteria 36163
150 Ga0068862_100009867 3300005844 Bacteria 7886
151 Ga0068862_100385499 3300005844 Bacteria 1308
152 Ga0081540_1002061 3300005983 Bacteria 16771
153 Ga0075366_10236151 3300006195 Unclassified 1114
154 Ga0097621_100393569 3300006237 Unclassified 1239
155 Ga0097621_100638313 3300006237 Unclassified 976
156 Ga0097621_100664668 3300006237 Unclassified 957
157 Ga0097621_101442364 3300006237 Unclassified 652
158 Ga0097621_101709230 3300006237 Bacteria 599
159 Ga0068871_100881961 3300006358 Unclassified 828
160 Ga0075428_100093090 3300006844 Bacteria 3286
161 Ga0075428_100412552 3300006844 Bacteria 1447
162 Ga0075431_100391686 3300006847 Unclassified 1392
163 Ga0068865_100206320 3300006881 Bacteria 1529
164 Ga0068865_100523722 3300006881 Bacteria 992
165 Ga0097620_100240104 3300006931 Unclassified 1901
166 Ga0097620_100400904 3300006931 Unclassified 1468
167 Ga0097620_100419814 3300006931 Bacteria 1434
168 Ga0097620_102466855 3300006931 Bacteria 573
169 Ga0105240_10000367 3300009093 Bacteria 84666
170 Ga0105240_10004312 3300009093 Bacteria 21724
171 Ga0105240_10005773 3300009093 Bacteria 18354
172 Ga0105240_10019425 3300009093 Bacteria 9078
173 Ga0105240_10031491 3300009093 Bacteria 6879
174 Ga0105240_10034497 3300009093 Bacteria 6526
175 Ga0105240_10043465 3300009093 Bacteria 5717
176 Ga0105240_10061895 3300009093 Bacteria 4661
177 Ga0105240_10161623 3300009093 Bacteria 2660
178 Ga0105240_10221553 3300009093 Bacteria 2204
179 Ga0105240_10311888 3300009093 Bacteria 1796
180 Ga0111539_10289205 3300009094 Bacteria 1907
181 Ga0111539_10961127 3300009094 Bacteria 993
182 Ga0111539_11414110 3300009094 Bacteria 807
183 Ga0111539_12901970 3300009094 Bacteria 555
184 Ga0114129_10102207 3300009147 Bacteria 3964
185 Ga0114129_11297970 3300009147 Bacteria 902
186 Ga0105243_10144367 3300009148 Bacteria 2035
187 Ga0105241_10014751 3300009174 Bacteria 5720
188 Ga0105241_10030253 3300009174 Bacteria 4045
189 Ga0105241_10152724 3300009174 Bacteria 1890
190 Ga0105241_10266752 3300009174 Bacteria 1457
191 Ga0105241_10483136 3300009174 Bacteria 1101
192 Ga0105241_10581552 3300009174 Bacteria 1009
193 Ga0105241_10921903 3300009174 Bacteria 813
194 Ga0105241_11088108 3300009174 Bacteria 752
195 Ga0105242_10073196 3300009176 Unclassified 2848
196 Ga0105237_10004885 3300009545 Bacteria 15359
197 Ga0105237_10023054 3300009545 Bacteria 6383
198 Ga0105237_10061850 3300009545 Bacteria 3742
199 Ga0105237_10066020 3300009545 Bacteria 3613
200 Ga0105237_10162414 3300009545 Bacteria 2232
201 Ga0105237_10167094 3300009545 Bacteria 2199
202 Ga0105237_10858237 3300009545 Bacteria 915
203 Ga0105238_10005360 3300009551 Bacteria 12672
204 Ga0105238_10059649 3300009551 Bacteria 3821
205 Ga0105238_10137755 3300009551 Bacteria 2418
206 Ga0105238_10140744 3300009551 Bacteria 2389
207 Ga0105238_10187971 3300009551 Unclassified 2042
208 Ga0105238_10516926 3300009551 Bacteria 1196
209 Ga0105238_10873947 3300009551 Bacteria 917
210 Ga0105249_10000186 3300009553 Bacteria 71781
211 Ga0105249_10601511 3300009553 Bacteria 1154
212 Ga0105249_10883124 3300009553 Unclassified 960
213 Ga0105239_10000252 3300010375 Bacteria 80006
214 Ga0105239_10001074 3300010375 Bacteria 37985
215 Ga0105239_10021740 3300010375 Bacteria 7072
216 Ga0105239_10042684 3300010375 Bacteria 4969
217 Ga0105239_10143887 3300010375 Bacteria 2658
218 Ga0105239_10146496 3300010375 Bacteria 2634
219 Ga0105246_10684583 3300011119 Bacteria 897
220 Ga0105246_10794954 3300011119 Bacteria 839
221 Ga0157373_10012126 3300013100 Bacteria 6335
222 Ga0157373_10016610 3300013100 Bacteria 5366
223 Ga0157373_10032389 3300013100 Bacteria 3763
224 Ga0157373_10032587 3300013100 Bacteria 3750
225 Ga0157373_10048751 3300013100 Unclassified 3020
226 Ga0157371_10007530 3300013102 Bacteria 8805
227 Ga0157371_10009681 3300013102 Bacteria 7570
228 Ga0157371_10013530 3300013102 Bacteria 6193
229 Ga0157371_10014129 3300013102 Bacteria 6038
230 Ga0157371_10108747 3300013102 Unclassified 1967
231 Ga0157370_10006582 3300013104 Bacteria 12793
232 Ga0157370_10011323 3300013104 Bacteria 9344
233 Ga0157370_10081542 3300013104 Bacteria 3044
234 Ga0157370_10431861 3300013104 Bacteria 1211
235 Ga0157369_10024734 3300013105 Bacteria 6673
236 Ga0157369_10025573 3300013105 Bacteria 6551
237 Ga0157369_10274277 3300013105 Bacteria 1757
238 Ga0157374_10471708 3300013296 Bacteria 1257
239 Ga0157378_10220608 3300013297 Bacteria 1802
240 Ga0157378_10307575 3300013297 Bacteria 1536
241 Ga0157378_10561088 3300013297 Bacteria 1148
242 Ga0157378_11387635 3300013297 Bacteria 745
243 Ga0157372_10004417 3300013307 Bacteria 14996
244 Ga0157372_10013597 3300013307 Bacteria 8700
245 Ga0157372_10030899 3300013307 Bacteria 5861
246 Ga0157372_10034708 3300013307 Bacteria 5548
247 Ga0157372_10070354 3300013307 Bacteria 3936
248 Ga0157372_10219308 3300013307 Bacteria 2205
249 Ga0157372_10393469 3300013307 Bacteria 1615
250 Ga0157372_10407498 3300013307 Bacteria 1584
251 Ga0157372_10811421 3300013307 Unclassified 1087
252 Ga0157372_10813964 3300013307 Bacteria 1085
253 Ga0157375_10244671 3300013308 Bacteria 1954
254 Ga0157375_11311482 3300013308 Unclassified 851
255 Ga0157375_11447129 3300013308 Bacteria 810
256 Ga0163163_10088748 3300014325 Bacteria 3103
257 Ga0163163_10342377 3300014325 Bacteria 1551
258 Ga0163163_10686223 3300014325 Bacteria 1088
259 Ga0163163_11832991 3300014325 Bacteria 667
260 Ga0163163_11838493 3300014325 Unclassified 666
261 Ga0157380_10060428 3300014326 Bacteria 3029
262 Ga0157380_11053221 3300014326 Bacteria 850
263 Ga0157380_11455505 3300014326 Bacteria 737
264 Ga0157380_13297421 3300014326 Bacteria 516
265 Ga0157379_10123521 3300014968 Bacteria 2329
266 Ga0157379_10197769 3300014968 Unclassified 1817
267 Ga0157379_10863971 3300014968 Unclassified 857
268 Ga0157376_11118885 3300014969 Bacteria 814
269 Ga0157376_12054105 3300014969 Bacteria 609
270 Ga0163161_10719221 3300017792 Unclassified 833
271 Ga0163161_10767701 3300017792 Unclassified 808
272 Ga0209258_100029 3300025242 Bacteria 490648
273 Ga0207425_1037748 3300025245 Bacteria 931
274 Ga0209646_1000031 3300025246 Bacteria 381260
275 Ga0209026_1000019 3300025250 Bacteria 381260
276 Ga0209148_1000089 3300025254 Bacteria 253548
277 Ga0209758_1003209 3300025297 Bacteria 15235
278 Ga0207426_1000445 3300025302 Bacteria 66319
279 Ga0207697_10355355 3300025315 Unclassified 651
280 Ga0207682_10060577 3300025893 Bacteria 1583
281 Ga0207642_10267329 3300025899 Bacteria 978
282 Ga0207688_10625736 3300025901 Unclassified 679
283 Ga0207680_10165044 3300025903 Bacteria 1488
284 Ga0207647_10031932 3300025904 Bacteria 3387
285 Ga0207647_10041580 3300025904 Bacteria 2889
286 Ga0207645_10014557 3300025907 Bacteria 5262
287 Ga0207643_10128235 3300025908 Unclassified 1507
288 Ga0207643_10431782 3300025908 Unclassified 836
289 Ga0207705_10053092 3300025909 Bacteria 2919
290 Ga0207705_10072530 3300025909 Bacteria 2497
291 Ga0207654_10002263 3300025911 Bacteria 9873
292 Ga0207654_10152543 3300025911 Bacteria 1484
293 Ga0207654_10284420 3300025911 Bacteria 1120
294 Ga0207654_10295960 3300025911 Unclassified 1099
295 Ga0207654_10395965 3300025911 Bacteria 959
296 Ga0207654_10785223 3300025911 Bacteria 687
297 Ga0207654_11114581 3300025911 Unclassified 575
298 Ga0207707_10131519 3300025912 Bacteria 2189
299 Ga0207707_10444633 3300025912 Unclassified 1109
300 Ga0207695_10000051 3300025913 Bacteria 399641
301 Ga0207695_10000056 3300025913 Bacteria 382433
302 Ga0207695_10000066 3300025913 Bacteria 334103
303 Ga0207695_10000081 3300025913 Bacteria 284797
304 Ga0207695_10000156 3300025913 Bacteria 204576
305 Ga0207695_10000778 3300025913 Bacteria 60342
306 Ga0207695_10002773 3300025913 Bacteria 25522
307 Ga0207695_10027790 3300025913 Bacteria 6293
308 Ga0207695_10050894 3300025913 Bacteria 4354
309 Ga0207695_10234759 3300025913 Bacteria 1737
310 Ga0207695_10508598 3300025913 Unclassified 1086
311 Ga0207671_10001925 3300025914 Bacteria 23035
312 Ga0207671_10003817 3300025914 Bacteria 14748
313 Ga0207671_10004406 3300025914 Bacteria 13490
314 Ga0207671_10010183 3300025914 Bacteria 7784
315 Ga0207671_10140228 3300025914 Bacteria 1862
316 Ga0207671_10179936 3300025914 Bacteria 1645
317 Ga0207671_10241082 3300025914 Unclassified 1420
318 Ga0207660_10015717 3300025917 Bacteria 5000
319 Ga0207660_10152805 3300025917 Unclassified 1775
320 Ga0207660_10614591 3300025917 Bacteria 885
321 Ga0207660_11216029 3300025917 Bacteria 613
322 Ga0207657_10096842 3300025919 Bacteria 2454
323 Ga0207649_10163071 3300025920 Unclassified 1546
324 Ga0207649_10371679 3300025920 Bacteria 1063
325 Ga0207652_10004292 3300025921 Bacteria 11623
326 Ga0207652_10051391 3300025921 Bacteria 3534
327 Ga0207681_10002248 3300025923 Bacteria 12274
328 Ga0207681_11385049 3300025923 Unclassified 590
329 Ga0207694_10080350 3300025924 Unclassified 2559
330 Ga0207694_10130152 3300025924 Bacteria 2017
331 Ga0207694_10170886 3300025924 Bacteria 1760
332 Ga0207694_10366716 3300025924 Bacteria 1194
333 Ga0207650_10254160 3300025925 Bacteria 1423
334 Ga0207659_10240420 3300025926 Bacteria 1464
335 Ga0207644_11337968 3300025931 Bacteria 602
336 Ga0207690_10622987 3300025932 Bacteria 882
337 Ga0207706_10049802 3300025933 Bacteria 3701
338 Ga0207709_10689611 3300025935 Unclassified 816
339 Ga0207709_11509043 3300025935 Unclassified 558
340 Ga0207669_10223395 3300025937 Unclassified 1384
341 Ga0207704_10457578 3300025938 Bacteria 1020
342 Ga0207704_11775786 3300025938 Bacteria 530
343 Ga0207691_10008993 3300025940 Bacteria 9578
344 Ga0207691_10144191 3300025940 Bacteria 2097
345 Ga0207689_10020682 3300025942 Bacteria 5533
346 Ga0207689_10029163 3300025942 Bacteria 4611
347 Ga0207689_10953540 3300025942 Bacteria 724
348 Ga0207661_10134500 3300025944 Unclassified 2122
349 Ga0207661_10139225 3300025944 Bacteria 2087
350 Ga0207661_10142881 3300025944 Bacteria 2061
351 Ga0207661_10766348 3300025944 Unclassified 888
352 Ga0207661_10908018 3300025944 Bacteria 811
353 Ga0207679_10118129 3300025945 Bacteria 2105
354 Ga0207679_10135709 3300025945 Bacteria 1981
355 Ga0207667_10000713 3300025949 Bacteria 43129
356 Ga0207667_10001674 3300025949 Bacteria 27927
357 Ga0207667_10028437 3300025949 Bacteria 6073
358 Ga0207667_10331045 3300025949 Unclassified 1555
359 Ga0207651_10015820 3300025960 Bacteria 4397
360 Ga0207712_10000260 3300025961 Bacteria 51278
361 Ga0207712_10730842 3300025961 Bacteria 866
362 Ga0207668_10031696 3300025972 Bacteria 3485
363 Ga0207668_10149154 3300025972 Bacteria 1808
364 Ga0207668_10621253 3300025972 Bacteria 943
365 Ga0207640_10118075 3300025981 Unclassified 1894
366 Ga0207640_10122251 3300025981 Bacteria 1867
367 Ga0207640_10139199 3300025981 Bacteria 1767
368 Ga0207640_10243169 3300025981 Bacteria 1392
369 Ga0207640_10862207 3300025981 Bacteria 789
370 Ga0207640_11540678 3300025981 Bacteria 598
371 Ga0207658_10020190 3300025986 Bacteria 4615
372 Ga0207658_10362691 3300025986 Bacteria 1265
373 Ga0207658_10746184 3300025986 Unclassified 886
374 Ga0207639_10012880 3300026041 Bacteria 5835
375 Ga0207639_10017764 3300026041 Bacteria 5044
376 Ga0207639_10071978 3300026041 Bacteria 2706
377 Ga0207639_10902457 3300026041 Unclassified 826
378 Ga0207639_11496900 3300026041 Unclassified 633
379 Ga0207702_10021240 3300026078 Bacteria 5372
380 Ga0207702_10142894 3300026078 Bacteria 2168
381 Ga0207702_11200102 3300026078 Bacteria 753
382 Ga0207702_11369936 3300026078 Bacteria 701
383 Ga0207641_10085654 3300026088 Bacteria 2746
384 Ga0207641_10151070 3300026088 Bacteria 2103
385 Ga0207641_11568499 3300026088 Unclassified 660
386 Ga0207648_10003726 3300026089 Bacteria 15946
387 Ga0207648_10080405 3300026089 Bacteria 2843
388 Ga0207648_10716544 3300026089 Bacteria 928
389 Ga0207648_11376805 3300026089 Bacteria 663
390 Ga0207676_10039845 3300026095 Bacteria 3597
391 Ga0207676_10326167 3300026095 Bacteria 1411
392 Ga0207676_11079115 3300026095 Bacteria 793
393 Ga0207674_10002012 3300026116 Bacteria 25817
394 Ga0207674_10033048 3300026116 Bacteria 5420
395 Ga0207675_100106388 3300026118 Bacteria 2645
396 Ga0207675_100236612 3300026118 Bacteria 1763
397 Ga0207675_100240144 3300026118 Unclassified 1751
398 Ga0207675_100580431 3300026118 Bacteria 1122
399 Ga0207675_101139565 3300026118 Bacteria 800
400 Ga0207675_101218131 3300026118 Unclassified 773
401 Ga0207683_11411006 3300026121 Unclassified 644
402 Ga0207683_11702201 3300026121 Unclassified 580
403 Ga0207698_10004751 3300026142 Bacteria 8310
404 Ga0207698_10024170 3300026142 Bacteria 4260
405 Ga0207698_10038406 3300026142 Bacteria 3537
406 Ga0207698_10043618 3300026142 Bacteria 3362
407 Ga0207698_10134888 3300026142 Bacteria 2116
408 Ga0207698_10468351 3300026142 Unclassified 1220
409 Ga0207698_10559093 3300026142 Unclassified 1123
410 Ga0207698_12012418 3300026142 Bacteria 592
411 Ga0209968_1046814 3300027526 Unclassified 746
412 Ga0209998_10029491 3300027717 Bacteria 1210
413 Ga0268266_10000073 3300028379 Bacteria 232074
414 Ga0268266_10629876 3300028379 Unclassified 1031
415 Ga0268265_10000144 3300028380 Bacteria 90132
416 Ga0268265_10006712 3300028380 Bacteria 7789
417 Ga0268265_11990433 3300028380 Unclassified 588
418 Ga0268264_10000973 3300028381 Bacteria 29345
419 Ga0268264_10004437 3300028381 Bacteria 11970
420 Ga0268264_10051628 3300028381 Bacteria 3427
421 Ga0268264_10090288 3300028381 Unclassified 2640
422 Ga0268264_10126109 3300028381 Unclassified 2262
423 Ga0268264_10546669 3300028381 Bacteria 1135
424 Ga0307517_10075437 3300028786 Bacteria 2957
425 Ga0307517_10169437 3300028786 Bacteria 1440
426 Ga0307511_10000232 3300030521 Bacteria 56875
427 Ga0316179_1078913 3300030734 Bacteria 579
428 Ga0265320_10263333 3300031240 Bacteria 764
429 Ga0307513_10241313 3300031456 Unclassified 1611
430 Ga0307509_10061299 3300031507 Bacteria 3972
431 Ga0307509_10108305 3300031507 Unclassified 2792
432 Ga0307509_10178032 3300031507 Unclassified 1996
433 Ga0307509_10563097 3300031507 Bacteria 816
434 Ga0307408_100001245 3300031548 Bacteria 19112
435 Ga0307408_100059733 3300031548 Bacteria 2776
436 Ga0307408_100102511 3300031548 Bacteria 2183
437 Ga0307408_100166439 3300031548 Bacteria 1756
438 Ga0307408_100197325 3300031548 Bacteria 1626
439 Ga0307508_10000181 3300031616 Bacteria 76433
440 Ga0307516_10146874 3300031730 Bacteria 2123
441 Ga0307405_10032769 3300031731 Bacteria 3074
442 Ga0307405_10073057 3300031731 Bacteria 2213
443 Ga0307413_10004719 3300031824 Bacteria 5982
444 Ga0307413_10044344 3300031824 Bacteria 2628
445 Ga0307413_10234344 3300031824 Bacteria 1350
446 Ga0307413_10976038 3300031824 Bacteria 724
447 Ga0307410_10026490 3300031852 Bacteria 3651
448 Ga0307410_10034501 3300031852 Bacteria 3277
449 Ga0307410_10090396 3300031852 Bacteria 2171
450 Ga0307406_10000404 3300031901 Bacteria 25000
451 Ga0307406_10018903 3300031901 Bacteria 4035
452 Ga0307406_10023017 3300031901 Bacteria 3702
453 Ga0307406_10112503 3300031901 Bacteria 1877
454 Ga0307406_10148922 3300031901 Bacteria 1667
455 Ga0307407_10185961 3300031903 Bacteria 1380
456 Ga0307407_10238443 3300031903 Bacteria 1239
457 Ga0307412_10025250 3300031911 Bacteria 3678
458 Ga0307412_11424086 3300031911 Unclassified 628
459 Ga0307409_100018059 3300031995 Bacteria 4725
460 Ga0307409_100044542 3300031995 Bacteria 3343
461 Ga0307409_100236268 3300031995 Bacteria 1660
462 Ga0307409_100635794 3300031995 Bacteria 1059
463 Ga0307409_101278977 3300031995 Bacteria 758
464 Ga0307416_100117717 3300032002 Bacteria 2359
465 Ga0307416_100179705 3300032002 Bacteria 1981
466 Ga0307416_100215596 3300032002 Bacteria 1836
467 Ga0307416_100382202 3300032002 Bacteria 1439
468 Ga0307416_101432988 3300032002 Bacteria 796
469 Ga0307414_10000052 3300032004 Bacteria 126684
470 Ga0307414_10028364 3300032004 Bacteria 3630
471 Ga0307414_10047632 3300032004 Bacteria 2952
472 Ga0307414_10133539 3300032004 Bacteria 1931
473 Ga0307414_10162000 3300032004 Bacteria 1778
474 Ga0307414_10182668 3300032004 Bacteria 1688
475 Ga0307414_10278391 3300032004 Bacteria 1404
476 Ga0307414_10516010 3300032004 Bacteria 1060
477 Ga0307414_10865549 3300032004 Bacteria 827
478 Ga0307411_10021864 3300032005 Bacteria 3754
479 Ga0307411_10051637 3300032005 Bacteria 2683
480 Ga0307411_10095276 3300032005 Bacteria 2089
481 Ga0307411_10910838 3300032005 Bacteria 782
482 Ga0307415_100193110 3300032126 Bacteria 1608
483 Ga0307415_100313629 3300032126 Bacteria 1304
484 Ga0307415_100502271 3300032126 Bacteria 1060
485 Ga0307415_101324770 3300032126 Unclassified 683
486 Ga0307510_10000637 3300033180 Bacteria 35581
487 Ga0373930_0017728 3300034816 Bacteria 1361
488 Ga0373961_0046634 3300035241 Bacteria 1271
489 Ga0373962_0038271 3300035242 Bacteria 1342
490 Ga0373933_0741535 3300035724 Unclassified 646
491 Ga0395899_0194311 3300037312 Bacteria 1418
492 Ga0395899_0384134 3300037312 Bacteria 932
493 Ga0395899_0386796 3300037312 Bacteria 928
494 Ga0395900_0207469 3300037418 Bacteria 1979
495 Ga0395900_0573779 3300037418 Bacteria 1070
496 Ga0395900_0574665 3300037418 Bacteria 1069
497 Ga0395898_0573709 3300037466 Bacteria 1070
498 Ga0395898_0574615 3300037466 Bacteria 1069
499 Ga0395905_0014608 3300037471 Bacteria 7490
500 Ga0395905_0691188 3300037471 Bacteria 922
501 Ga0436364_0272780 3300037853 Bacteria 1656
502 Ga0395901_0119569 3300038443 Bacteria 2768
503 Ga0395901_0181786 3300038443 Bacteria 2205
504 Ga0395901_0708627 3300038443 Bacteria 1003
505 Ga0439439_0003919 3300041406 Bacteria 3314
506 Ga0439439_0174051 3300041406 Bacteria 618
507 Ga0451837_0175745 3300041494 Bacteria 885
508 Ga0451845_0745347 3300041501 Bacteria 509
509 Ga0451853_0292156 3300041512 Bacteria 1165
510 Ga0439433_0056306 3300041999 Unclassified 933
511 Ga0439433_0223219 3300041999 Bacteria 503
512 Ga0439457_014463 3300042014 Bacteria 1766
513 Ga0439462_0004254 3300042015 Bacteria 3483
514 Ga0439462_0122260 3300042015 Bacteria 724
515 Ga0450923_151684 3300042125 Bacteria 561
516 Ga0450897_043261 3300042128 Bacteria 533
517 Ga0450898_003159 3300042134 Bacteria 2349
518 Ga0439446_0015945 3300042156 Bacteria 2089
519 Ga0450908_052247 3300042184 Bacteria 712
520 Ga0439434_0056500 3300042435 Unclassified 1222
521 Ga0439434_0105984 3300042435 Bacteria 908
522 Ga0450893_0094336 3300042532 Bacteria 604
523 Ga0451577_0020179 3300042876 Bacteria 6119
524 Ga0453683_0067000 3300044673 Bacteria 2244
525 Ga0466961_0034395 3300044693 Bacteria 3253
526 Ga0466963_0088980 3300044694 Bacteria 2100
527 Ga0466964_0009653 3300044706 Bacteria 3636
528 Ga0466964_0139287 3300044706 Bacteria 1113
529 Ga0453684_0059472 3300044712 Bacteria 4926
530 Ga0466971_0040206 3300044719 Bacteria 2100
531 Ga0466968_0052519 3300044735 Bacteria 1744
532 Ga0466970_0214827 3300044765 Bacteria 1072
533 Ga0466959_0005141 3300045049 Bacteria 8913
534 Ga0451576_1503075 3300045051 Bacteria 700
535 Ga0466967_0161903 3300045976 Bacteria 2101
536 Ga0495638_0026894 3300046460 Bacteria 3727
537 Ga0495638_0028140 3300046460 Bacteria 3632
538 Ga0495594_0028657 3300046499 Bacteria 3006
539 Ga0495606_0009808 3300046507 Bacteria 8045
540 Ga0495648_0002315 3300046524 Bacteria 17740
541 Ga0495668_0604032 3300046616 Bacteria 606
542 Ga0495611_0001153 3300046648 Bacteria 13800
543 Ga0495611_0030145 3300046648 Bacteria 2384
544 Ga0495625_0419761 3300046660 Bacteria 832
545 Ga0495625_0560692 3300046660 Bacteria 691
546 Ga0495649_0146982 3300046694 Bacteria 1239
547 Ga0495649_0473505 3300046694 Bacteria 624
548 Ga0495683_0222870 3300047323 Bacteria 840
549 Ga0495687_000179 3300047443 Bacteria 92387
550 Ga0495686_0000010 3300047472 Bacteria 573229
551 Ga0496101_0598287 3300048904 Bacteria 872
552 Ga0496102_1540391 3300048905 Bacteria 583
553 Ga0496105_0257520 3300048908 Bacteria 1412
554 Ga0496106_0284353 3300048909 Bacteria 1325
555 Ga0496106_0728810 3300048909 Bacteria 789
556 Ga0496108_0000454 3300048911 Bacteria 32702
557 Ga0496108_0114107 3300048911 Bacteria 2313
558 Ga0496108_1118980 3300048911 Bacteria 668
559 Ga0496109_0004696 3300048912 Bacteria 11401
560 Ga0496109_0846179 3300048912 Bacteria 853
561 Ga0496110_0009965 3300048913 Bacteria 7708
562 Ga0496111_0068890 3300048914 Bacteria 2572
563 Ga0496111_0115777 3300048914 Bacteria 1977
564 Ga0496111_0525593 3300048914 Bacteria 870
565 Ga0496112_0000336 3300048915 Bacteria 30511
566 Ga0496113_0000286 3300048916 Bacteria 23871
567 Ga0496115_0870958 3300048918 Unclassified 696
568 Ga0496123_0389536 3300048926 Bacteria 637
569 Ga0496126_0735119 3300048929 Bacteria 763
570 Ga0501291_013912 3300049514 Bacteria 1197
571 Ga0501032_0380597 3300049569 Bacteria 908
572 Ga0501033_0011966 3300049570 Bacteria 6629
573 Ga0501033_0522226 3300049570 Bacteria 820
574 Ga0501034_0125286 3300049571 Unclassified 2554
575 Ga0501034_0166402 3300049571 Bacteria 2173
576 Ga0501036_0004307 3300049572 Bacteria 11494
577 Ga0501036_0118762 3300049572 Bacteria 2233
578 Ga0501037_0041022 3300049573 Bacteria 3405
579 Ga0501037_0505749 3300049573 Bacteria 819
580 Ga0501037_0864110 3300049573 Bacteria 594
581 Ga0501039_0320495 3300049575 Bacteria 1218
582 Ga0501039_0360952 3300049575 Unclassified 1141
583 Ga0501043_0033919 3300049579 Bacteria 4016
584 Ga0501043_0142344 3300049579 Unclassified 1877
585 Ga0501046_0033176 3300049580 Bacteria 4174
586 Ga0501046_0264573 3300049580 Bacteria 1263
587 Ga0501047_0053697 3300049581 Bacteria 3897
588 Ga0501047_0067395 3300049581 Bacteria 3449
589 Ga0501047_0093604 3300049581 Bacteria 2884
590 Ga0501048_0006935 3300049582 Bacteria 8608
591 Ga0501048_0218006 3300049582 Bacteria 1353
592 Ga0501048_0221110 3300049582 Bacteria 1343
593 Ga0501067_0028416 3300049583 Bacteria 3098
594 Ga0501068_0115527 3300049584 Bacteria 1671
595 Ga0501068_0992822 3300049584 Bacteria 554
596 Ga0501069_0166456 3300049585 Bacteria 1271
597 Ga0501069_0296809 3300049585 Bacteria 947
598 Ga0501070_0037058 3300049586 Bacteria 4071
599 Ga0501070_0119799 3300049586 Bacteria 2175
600 Ga0501072_0051833 3300049588 Bacteria 3231
601 Ga0501073_0000302 3300049589 Bacteria 32545
602 Ga0501073_1234566 3300049589 Bacteria 513
603 Ga0501074_0000754 3300049590 Bacteria 20343
604 Ga0501074_0163788 3300049590 Bacteria 1588
605 Ga0501075_0063049 3300049591 Bacteria 2795
606 Ga0501076_0199389 3300049592 Bacteria 1634
607 Ga0501076_0662908 3300049592 Bacteria 861
608 Ga0501077_0315025 3300049593 Unclassified 997
609 Ga0501223_032405 3300049663 Bacteria 1017
610 Ga0501227_001545 3300049665 Bacteria 5132
611 Ga0501238_038654 3300049671 Bacteria 699
612 Ga0501242_027402 3300049674 Bacteria 757
613 Ga0501242_047035 3300049674 Bacteria 624
614 Ga0501247_080045 3300049677 Bacteria 526
615 Ga0501249_167419 3300049679 Bacteria 561
616 Ga0501219_000106 3300049703 Bacteria 14642
617 Ga0501234_079819 3300049707 Bacteria 575
618 Ga0501079_0044593 3300049741 Bacteria 3422
619 Ga0501080_0045485 3300049742 Bacteria 4086
620 Ga0501080_0646528 3300049742 Bacteria 936
621 Ga0501081_0541720 3300049743 Bacteria 869
622 Ga0501083_0062154 3300049744 Bacteria 2492
623 Ga0501241_003713 3300049758 Bacteria 2878
624 Ga0501268_155552 3300049765 Bacteria 530
625 Ga0501273_018901 3300049770 Bacteria 921
626 Ga0501035_0029492 3300049822 Bacteria 5003
627 Ga0501035_0212737 3300049822 Bacteria 1654
628 Ga0501044_0056382 3300049823 Bacteria 4034
629 Ga0501044_0067956 3300049823 Bacteria 3631
630 Ga0501044_0076382 3300049823 Bacteria 3400
631 Ga0501045_0782509 3300049824 Bacteria 703
632 Ga0501284_00148 3300050005 Bacteria 8332
633 nmdc:mga0k408_184103_c1 3300050493 Unclassified 1246
634 nmdc:mga06z11_1022635_c1 3300050494 Unclassified 504
635 nmdc:mga05p37_142533_c1 3300050507 Bacteria 2935
636 nmdc:mga09592_309398_c1 3300050508 Bacteria 1369
637 nmdc:mga06r32_183164_c1 3300050510 Unclassified 2080
638 nmdc:mga08y16_1172790_c1 3300050511 Bacteria 740
639 nmdc:mga08y16_593501_c1 3300050511 Bacteria 1117
640 nmdc:mga08y16_68970_c1 3300050511 Bacteria 3686
641 Ga0500578_0469291 3300053086 Unclassified 713
642 Ga0500643_102255 3300053087 Bacteria 777
643 Ga0500644_0000117 3300053088 Bacteria 49928
644 Ga0500644_0048729 3300053088 Bacteria 1443
645 Ga0500646_0001812 3300053090 Bacteria 5619
646 Ga0500583_0002281 3300053092 Bacteria 5722
647 Ga0500569_000434 3300053109 Bacteria 6833
648 Ga0500594_0081157 3300053118 Bacteria 970
649 Ga0500607_050200 3300053121 Bacteria 2224
650 Ga0500608_133717 3300053122 Bacteria 1109
651 Ga0500608_269706 3300053122 Bacteria 651
652 Ga0500642_0132452 3300053130 Bacteria 1168
653 Ga0500652_059722 3300053131 Bacteria 1568
654 Ga0500652_243122 3300053131 Bacteria 716
655 Ga0500655_012047 3300053133 Bacteria 1571
656 Ga0500658_0006812 3300053134 Bacteria 4227
657 Ga0500559_0000580 3300053136 Bacteria 25109
658 Ga0500559_0032244 3300053136 Bacteria 2251
659 Ga0500561_0226260 3300053137 Bacteria 594
660 Ga0500568_0018171 3300053139 Bacteria 3084
661 Ga0500577_0003665 3300053142 Bacteria 4005
662 Ga0500577_0279760 3300053142 Bacteria 727
663 Ga0500588_0001757 3300053146 Bacteria 4212
664 Ga0500590_032355 3300053148 Bacteria 2713
665 Ga0500590_247765 3300053148 Bacteria 711
666 Ga0500604_0323582 3300053151 Bacteria 535
667 Ga0500616_0137764 3300053153 Bacteria 1144
668 Ga0500622_0003896 3300053156 Bacteria 9662
669 Ga0500633_0001931 3300053160 Bacteria 4099
670 Ga0500636_0005080 3300053177 Bacteria 7470
671 Ga0500637_0050787 3300053178 Bacteria 2363
672 Ga0500637_0217632 3300053178 Bacteria 1081
673 Ga0501084_0065651 3300054114 Bacteria 3037
674 Ga0501084_0207862 3300054114 Bacteria 1652
675 Ga0500661_004973 3300055283 Bacteria 2491
676 Ga0501082_0127210 3300060353 Bacteria 2210
677 Ga0501082_1880680 3300060353 Bacteria 522
678 Ga0466962_0053217 3300061719 Bacteria 1935

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100318598 Ga0070670_1003185982 117
2 3300005343 Ga0070687_101246530 Ga0070687_1012465301 117
3 3300005347 Ga0070668_100009533 Ga0070668_1000095332 117
4 3300005353 Ga0070669_100000286 Ga0070669_10000028622 117
5 3300005444 Ga0070694_100111413 Ga0070694_1001114132 117
6 3300005543 Ga0070672_100270486 Ga0070672_1002704862 117
7 3300005577 Ga0068857_100023721 Ga0068857_1000237214 117
8 3300005719 Ga0068861_100048923 Ga0068861_1000489232 117
9 3300005840 Ga0068870_10106797 Ga0068870_101067972 117
10 3300005844 Ga0068862_100000640 Ga0068862_10000064023 117
11 3300006881 Ga0068865_100206320 Ga0068865_1002063202 117
12 3300009094 Ga0111539_10961127 Ga0111539_109611272 117
13 3300009148 Ga0105243_10144367 Ga0105243_101443671 117
14 3300009553 Ga0105249_10000186 Ga0105249_1000018611 117
15 3300025315 Ga0207697_10355355 Ga0207697_103553551 117
16 3300025908 Ga0207643_10128235 Ga0207643_101282352 117
17 3300025923 Ga0207681_10002248 Ga0207681_100022484 117
18 3300025933 Ga0207706_10049802 Ga0207706_100498022 117
19 3300025935 Ga0207709_10689611 Ga0207709_106896112 117
20 3300025961 Ga0207712_10000260 Ga0207712_100002604 117
21 3300025972 Ga0207668_10031696 Ga0207668_100316962 117
22 3300026116 Ga0207674_10033048 Ga0207674_100330481 117
23 3300026118 Ga0207675_100106388 Ga0207675_1001063882 117
24 3300028380 Ga0268265_10000144 Ga0268265_1000014473 117
25 3300028381 Ga0268264_10051628 Ga0268264_100516281 117
26 3300050511 nmdc:mga08y16_68970_c1 nmdc:mga08y16_68970_c1_1927_2316 117
27 3300005341 Ga0070691_10050069 Ga0070691_100500693 119
28 3300025914 Ga0207671_10241082 Ga0207671_102410822 119
29 3300049570 Ga0501033_0522226 Ga0501033_0522226_161_526 120
30 3300049572 Ga0501036_0118762 Ga0501036_0118762_1097_1462 120
31 3300049575 Ga0501039_0320495 Ga0501039_0320495_122_487 120
32 3300049580 Ga0501046_0264573 Ga0501046_0264573_531_896 120
33 3300049582 Ga0501048_0221110 Ga0501048_0221110_713_1078 120
34 3300049590 Ga0501074_0163788 Ga0501074_0163788_53_418 120
35 3300049592 Ga0501076_0662908 Ga0501076_0662908_314_679 120
36 3300049743 Ga0501081_0541720 Ga0501081_0541720_466_831 120
37 3300054114 Ga0501084_0207862 Ga0501084_0207862_1148_1513 120
38 3300060353 Ga0501082_1880680 Ga0501082_1880680_25_390 120
39 iso_pu_bacteria 2884791551 2884797085 122
40 iso_pu_bacteria 2929239360 2929239821 122
41 iso_pu_bacteria 8003151029 8003151999 122
42 3300037853 Ga0436364_0272780 Ga0436364_0272780_947_1324 123
43 3300049592 Ga0501076_0199389 Ga0501076_0199389_186_566 123
44 3300025961 Ga0207712_10730842 Ga0207712_107308422 124
45 3300003316 rootH1_10023398 rootH1_100233988 125
46 3300003320 rootH2_10109333 rootH2_101093332 125
47 3300003323 rootH1_10036348 rootH1_100363482 125
48 3300005327 Ga0070658_10065092 Ga0070658_100650925 125
49 3300005328 Ga0070676_10900583 Ga0070676_109005832 125
50 3300005329 Ga0070683_100001587 Ga0070683_10000158719 125
51 3300005329 Ga0070683_100250941 Ga0070683_1002509413 125
52 3300005329 Ga0070683_100783335 Ga0070683_1007833352 125
53 3300005329 Ga0070683_100866395 Ga0070683_1008663952 125
54 3300005329 Ga0070683_102103663 Ga0070683_1021036631 125
55 3300005331 Ga0070670_100056793 Ga0070670_1000567932 125
56 3300005331 Ga0070670_100151928 Ga0070670_1001519282 125
57 3300005331 Ga0070670_101202821 Ga0070670_1012028212 125
58 3300005333 Ga0070677_10052159 Ga0070677_100521592 125
59 3300005334 Ga0068869_100057460 Ga0068869_1000574604 125
60 3300005334 Ga0068869_100933983 Ga0068869_1009339831 125
61 3300005335 Ga0070666_10097033 Ga0070666_100970333 125
62 3300005335 Ga0070666_10390710 Ga0070666_103907102 125
63 3300005336 Ga0070680_100027158 Ga0070680_1000271584 125
64 3300005337 Ga0070682_100021600 Ga0070682_1000216005 125
65 3300005337 Ga0070682_100051139 Ga0070682_1000511392 125
66 3300005337 Ga0070682_100352787 Ga0070682_1003527872 125
67 3300005338 Ga0068868_100616176 Ga0068868_1006161761 125
68 3300005338 Ga0068868_101215262 Ga0068868_1012152622 125
69 3300005339 Ga0070660_100092212 Ga0070660_1000922123 125
70 3300005340 Ga0070689_100856546 Ga0070689_1008565461 125
71 3300005341 Ga0070691_10005121 Ga0070691_100051214 125
72 3300005343 Ga0070687_100661212 Ga0070687_1006612121 125
73 3300005344 Ga0070661_101386690 Ga0070661_1013866901 125
74 3300005347 Ga0070668_100028705 Ga0070668_1000287053 125
75 3300005347 Ga0070668_101624260 Ga0070668_1016242601 125
76 3300005353 Ga0070669_101560518 Ga0070669_1015605182 125
77 3300005354 Ga0070675_100408204 Ga0070675_1004082042 125
78 3300005355 Ga0070671_100922881 Ga0070671_1009228811 125
79 3300005364 Ga0070673_100162996 Ga0070673_1001629962 125
80 3300005366 Ga0070659_100463640 Ga0070659_1004636402 125
81 3300005367 Ga0070667_100099848 Ga0070667_1000998481 125
82 3300005367 Ga0070667_100467128 Ga0070667_1004671282 125
83 3300005437 Ga0070710_10132057 Ga0070710_101320572 125
84 3300005439 Ga0070711_100661884 Ga0070711_1006618842 125
85 3300005440 Ga0070705_100405228 Ga0070705_1004052282 125
86 3300005445 Ga0070708_100034768 Ga0070708_1000347685 125
87 3300005455 Ga0070663_101515561 Ga0070663_1015155611 125
88 3300005455 Ga0070663_101916499 Ga0070663_1019164991 125
89 3300005456 Ga0070678_100268594 Ga0070678_1002685942 125
90 3300005456 Ga0070678_100872159 Ga0070678_1008721592 125
91 3300005456 Ga0070678_101500986 Ga0070678_1015009861 125
92 3300005458 Ga0070681_10021141 Ga0070681_100211417 125
93 3300005458 Ga0070681_10325793 Ga0070681_103257932 125
94 3300005458 Ga0070681_10768457 Ga0070681_107684571 125
95 3300005459 Ga0068867_100275001 Ga0068867_1002750013 125
96 3300005459 Ga0068867_100302167 Ga0068867_1003021671 125
97 3300005459 Ga0068867_100507484 Ga0068867_1005074842 125
98 3300005530 Ga0070679_100000398 Ga0070679_10000039824 125
99 3300005530 Ga0070679_100159173 Ga0070679_1001591733 125
100 3300005535 Ga0070684_100033876 Ga0070684_1000338762 125
101 3300005535 Ga0070684_100215644 Ga0070684_1002156444 125
102 3300005535 Ga0070684_100240773 Ga0070684_1002407733 125
103 3300005535 Ga0070684_101293294 Ga0070684_1012932942 125
104 3300005539 Ga0068853_100002293 Ga0068853_1000022939 125
105 3300005539 Ga0068853_100042107 Ga0068853_1000421075 125
106 3300005539 Ga0068853_100054056 Ga0068853_1000540563 125
107 3300005539 Ga0068853_100095837 Ga0068853_1000958373 125
108 3300005543 Ga0070672_100148086 Ga0070672_1001480862 125
109 3300005548 Ga0070665_100000002 Ga0070665_100000002460 125
110 3300005548 Ga0070665_100338470 Ga0070665_1003384702 125
111 3300005549 Ga0070704_102138276 Ga0070704_1021382761 125
112 3300005563 Ga0068855_100000303 Ga0068855_10000030340 125
113 3300005563 Ga0068855_100055326 Ga0068855_1000553265 125
114 3300005563 Ga0068855_100066058 Ga0068855_1000660584 125
115 3300005563 Ga0068855_100070130 Ga0068855_1000701303 125
116 3300005563 Ga0068855_100310751 Ga0068855_1003107513 125
117 3300005563 Ga0068855_100818299 Ga0068855_1008182992 125
118 3300005564 Ga0070664_100040078 Ga0070664_1000400783 125
119 3300005564 Ga0070664_100365483 Ga0070664_1003654832 125
120 3300005577 Ga0068857_100009853 Ga0068857_1000098537 125
121 3300005577 Ga0068857_100599898 Ga0068857_1005998982 125
122 3300005578 Ga0068854_100048807 Ga0068854_1000488075 125
123 3300005578 Ga0068854_100199560 Ga0068854_1001995602 125
124 3300005578 Ga0068854_100240485 Ga0068854_1002404851 125
125 3300005578 Ga0068854_100466724 Ga0068854_1004667242 125
126 3300005578 Ga0068854_100767449 Ga0068854_1007674492 125
127 3300005578 Ga0068854_101356387 Ga0068854_1013563871 125
128 3300005578 Ga0068854_101418168 Ga0068854_1014181681 125
129 3300005614 Ga0068856_100018889 Ga0068856_1000188896 125
130 3300005614 Ga0068856_100062498 Ga0068856_1000624982 125
131 3300005614 Ga0068856_100142153 Ga0068856_1001421533 125
132 3300005616 Ga0068852_100000744 Ga0068852_1000007445 125
133 3300005616 Ga0068852_100016599 Ga0068852_1000165992 125
134 3300005616 Ga0068852_100025486 Ga0068852_1000254862 125
135 3300005616 Ga0068852_100101947 Ga0068852_1001019475 125
136 3300005616 Ga0068852_100395602 Ga0068852_1003956022 125
137 3300005617 Ga0068859_100240106 Ga0068859_1002401063 125
138 3300005617 Ga0068859_100400910 Ga0068859_1004009102 125
139 3300005617 Ga0068859_102466703 Ga0068859_1024667031 125
140 3300005618 Ga0068864_100062502 Ga0068864_1000625025 125
141 3300005618 Ga0068864_101292180 Ga0068864_1012921802 125
142 3300005718 Ga0068866_10065788 Ga0068866_100657882 125
143 3300005718 Ga0068866_10108731 Ga0068866_101087312 125
144 3300005719 Ga0068861_101315335 Ga0068861_1013153352 125
145 3300005834 Ga0068851_10151435 Ga0068851_101514352 125
146 3300005840 Ga0068870_10539382 Ga0068870_105393822 125
147 3300005840 Ga0068870_10557603 Ga0068870_105576031 125
148 3300005841 Ga0068863_100136868 Ga0068863_1001368683 125
149 3300005841 Ga0068863_101900279 Ga0068863_1019002791 125
150 3300005842 Ga0068858_100661564 Ga0068858_1006615642 125
151 3300005843 Ga0068860_100000003 Ga0068860_10000000376 125
152 3300005843 Ga0068860_100001341 Ga0068860_10000134120 125
153 3300005843 Ga0068860_100005037 Ga0068860_10000503712 125
154 3300005843 Ga0068860_100196827 Ga0068860_1001968272 125
155 3300005843 Ga0068860_100348020 Ga0068860_1003480203 125
156 3300005843 Ga0068860_102257620 Ga0068860_1022576201 125
157 3300005843 Ga0068860_102502556 Ga0068860_1025025561 125
158 3300005844 Ga0068862_100009867 Ga0068862_1000098675 125
159 3300005844 Ga0068862_100385499 Ga0068862_1003854991 125
160 3300005983 Ga0081540_1002061 Ga0081540_10020616 125
161 3300006195 Ga0075366_10236151 Ga0075366_102361512 125
162 3300006237 Ga0097621_100393569 Ga0097621_1003935692 125
163 3300006237 Ga0097621_100638313 Ga0097621_1006383132 125
164 3300006237 Ga0097621_100664668 Ga0097621_1006646682 125
165 3300006237 Ga0097621_101442364 Ga0097621_1014423641 125
166 3300006237 Ga0097621_101709230 Ga0097621_1017092301 125
167 3300006358 Ga0068871_100881961 Ga0068871_1008819612 125
168 3300006881 Ga0068865_100523722 Ga0068865_1005237222 125
169 3300006931 Ga0097620_100240104 Ga0097620_1002401043 125
170 3300006931 Ga0097620_100400904 Ga0097620_1004009042 125
171 3300006931 Ga0097620_102466855 Ga0097620_1024668551 125
172 3300009093 Ga0105240_10000367 Ga0105240_1000036774 125
173 3300009093 Ga0105240_10004312 Ga0105240_100043122 125
174 3300009093 Ga0105240_10005773 Ga0105240_1000577318 125
175 3300009093 Ga0105240_10019425 Ga0105240_100194257 125
176 3300009093 Ga0105240_10031491 Ga0105240_100314917 125
177 3300009093 Ga0105240_10034497 Ga0105240_100344972 125
178 3300009093 Ga0105240_10043465 Ga0105240_100434652 125
179 3300009093 Ga0105240_10061895 Ga0105240_100618954 125
180 3300009093 Ga0105240_10161623 Ga0105240_101616232 125
181 3300009093 Ga0105240_10221553 Ga0105240_102215532 125
182 3300009093 Ga0105240_10311888 Ga0105240_103118883 125
183 3300009174 Ga0105241_10014751 Ga0105241_100147514 125
184 3300009174 Ga0105241_10030253 Ga0105241_100302535 125
185 3300009174 Ga0105241_10152724 Ga0105241_101527243 125
186 3300009174 Ga0105241_10266752 Ga0105241_102667523 125
187 3300009174 Ga0105241_10483136 Ga0105241_104831362 125
188 3300009174 Ga0105241_10581552 Ga0105241_105815522 125
189 3300009174 Ga0105241_10921903 Ga0105241_109219032 125
190 3300009174 Ga0105241_11088108 Ga0105241_110881081 125
191 3300009176 Ga0105242_10073196 Ga0105242_100731963 125
192 3300009545 Ga0105237_10004885 Ga0105237_100048855 125
193 3300009545 Ga0105237_10023054 Ga0105237_100230546 125
194 3300009545 Ga0105237_10061850 Ga0105237_100618502 125
195 3300009545 Ga0105237_10066020 Ga0105237_100660205 125
196 3300009545 Ga0105237_10162414 Ga0105237_101624143 125
197 3300009545 Ga0105237_10167094 Ga0105237_101670943 125
198 3300009551 Ga0105238_10005360 Ga0105238_100053606 125
199 3300009551 Ga0105238_10059649 Ga0105238_100596493 125
200 3300009551 Ga0105238_10137755 Ga0105238_101377552 125
201 3300009551 Ga0105238_10140744 Ga0105238_101407443 125
202 3300009551 Ga0105238_10187971 Ga0105238_101879712 125
203 3300009551 Ga0105238_10516926 Ga0105238_105169262 125
204 3300009551 Ga0105238_10873947 Ga0105238_108739472 125
205 3300009553 Ga0105249_10601511 Ga0105249_106015112 125
206 3300009553 Ga0105249_10883124 Ga0105249_108831242 125
207 3300010375 Ga0105239_10000252 Ga0105239_1000025239 125
208 3300010375 Ga0105239_10001074 Ga0105239_1000107423 125
209 3300010375 Ga0105239_10021740 Ga0105239_100217404 125
210 3300010375 Ga0105239_10042684 Ga0105239_100426846 125
211 3300010375 Ga0105239_10143887 Ga0105239_101438873 125
212 3300010375 Ga0105239_10146496 Ga0105239_101464963 125
213 3300011119 Ga0105246_10794954 Ga0105246_107949541 125
214 3300013100 Ga0157373_10012126 Ga0157373_100121265 125
215 3300013100 Ga0157373_10016610 Ga0157373_100166106 125
216 3300013100 Ga0157373_10032389 Ga0157373_100323895 125
217 3300013100 Ga0157373_10032587 Ga0157373_100325875 125
218 3300013100 Ga0157373_10048751 Ga0157373_100487515 125
219 3300013102 Ga0157371_10007530 Ga0157371_100075306 125
220 3300013102 Ga0157371_10009681 Ga0157371_100096816 125
221 3300013102 Ga0157371_10013530 Ga0157371_100135305 125
222 3300013102 Ga0157371_10014129 Ga0157371_100141295 125
223 3300013102 Ga0157371_10108747 Ga0157371_101087472 125
224 3300013104 Ga0157370_10006582 Ga0157370_1000658210 125
225 3300013104 Ga0157370_10011323 Ga0157370_100113234 125
226 3300013104 Ga0157370_10081542 Ga0157370_100815422 125
227 3300013104 Ga0157370_10431861 Ga0157370_104318613 125
228 3300013105 Ga0157369_10024734 Ga0157369_100247347 125
229 3300013105 Ga0157369_10025573 Ga0157369_100255732 125
230 3300013105 Ga0157369_10274277 Ga0157369_102742773 125
231 3300013296 Ga0157374_10471708 Ga0157374_104717081 125
232 3300013297 Ga0157378_10220608 Ga0157378_102206083 125
233 3300013297 Ga0157378_10307575 Ga0157378_103075752 125
234 3300013297 Ga0157378_11387635 Ga0157378_113876351 125
235 3300013307 Ga0157372_10004417 Ga0157372_100044174 125
236 3300013307 Ga0157372_10013597 Ga0157372_100135977 125
237 3300013307 Ga0157372_10030899 Ga0157372_100308994 125
238 3300013307 Ga0157372_10034708 Ga0157372_100347085 125
239 3300013307 Ga0157372_10070354 Ga0157372_100703543 125
240 3300013307 Ga0157372_10219308 Ga0157372_102193082 125
241 3300013307 Ga0157372_10393469 Ga0157372_103934693 125
242 3300013307 Ga0157372_10407498 Ga0157372_104074982 125
243 3300013307 Ga0157372_10811421 Ga0157372_108114213 125
244 3300013308 Ga0157375_10244671 Ga0157375_102446712 125
245 3300013308 Ga0157375_11311482 Ga0157375_113114822 125
246 3300014325 Ga0163163_10686223 Ga0163163_106862231 125
247 3300014325 Ga0163163_11832991 Ga0163163_118329912 125
248 3300014325 Ga0163163_11838493 Ga0163163_118384931 125
249 3300014326 Ga0157380_10060428 Ga0157380_100604284 125
250 3300014326 Ga0157380_11053221 Ga0157380_110532212 125
251 3300014326 Ga0157380_11455505 Ga0157380_114555053 125
252 3300014326 Ga0157380_13297421 Ga0157380_132974211 125
253 3300014968 Ga0157379_10197769 Ga0157379_101977692 125
254 3300014969 Ga0157376_12054105 Ga0157376_120541052 125
255 3300017792 Ga0163161_10767701 Ga0163161_107677012 125
256 3300025893 Ga0207682_10060577 Ga0207682_100605771 125
257 3300025899 Ga0207642_10267329 Ga0207642_102673292 125
258 3300025901 Ga0207688_10625736 Ga0207688_106257362 125
259 3300025903 Ga0207680_10165044 Ga0207680_101650443 125
260 3300025904 Ga0207647_10031932 Ga0207647_100319324 125
261 3300025904 Ga0207647_10041580 Ga0207647_100415804 125
262 3300025907 Ga0207645_10014557 Ga0207645_100145576 125
263 3300025908 Ga0207643_10431782 Ga0207643_104317822 125
264 3300025909 Ga0207705_10053092 Ga0207705_100530922 125
265 3300025909 Ga0207705_10072530 Ga0207705_100725304 125
266 3300025911 Ga0207654_10002263 Ga0207654_100022638 125
267 3300025911 Ga0207654_10152543 Ga0207654_101525432 125
268 3300025911 Ga0207654_10284420 Ga0207654_102844202 125
269 3300025911 Ga0207654_10295960 Ga0207654_102959602 125
270 3300025911 Ga0207654_10395965 Ga0207654_103959652 125
271 3300025911 Ga0207654_10785223 Ga0207654_107852232 125
272 3300025911 Ga0207654_11114581 Ga0207654_111145811 125
273 3300025912 Ga0207707_10131519 Ga0207707_101315192 125
274 3300025912 Ga0207707_10444633 Ga0207707_104446333 125
275 3300025913 Ga0207695_10000051 Ga0207695_1000005146 125
276 3300025913 Ga0207695_10000056 Ga0207695_10000056196 125
277 3300025913 Ga0207695_10000066 Ga0207695_1000006687 125
278 3300025913 Ga0207695_10000081 Ga0207695_1000008146 125
279 3300025913 Ga0207695_10000156 Ga0207695_1000015622 125
280 3300025913 Ga0207695_10000778 Ga0207695_100007782 125
281 3300025913 Ga0207695_10002773 Ga0207695_100027735 125
282 3300025913 Ga0207695_10027790 Ga0207695_100277905 125
283 3300025913 Ga0207695_10050894 Ga0207695_100508943 125
284 3300025913 Ga0207695_10234759 Ga0207695_102347592 125
285 3300025913 Ga0207695_10508598 Ga0207695_105085982 125
286 3300025914 Ga0207671_10001925 Ga0207671_1000192513 125
287 3300025914 Ga0207671_10003817 Ga0207671_100038171 125
288 3300025914 Ga0207671_10004406 Ga0207671_1000440614 125
289 3300025914 Ga0207671_10010183 Ga0207671_100101838 125
290 3300025914 Ga0207671_10140228 Ga0207671_101402283 125
291 3300025914 Ga0207671_10179936 Ga0207671_101799362 125
292 3300025917 Ga0207660_10015717 Ga0207660_100157176 125
293 3300025917 Ga0207660_10152805 Ga0207660_101528052 125
294 3300025919 Ga0207657_10096842 Ga0207657_100968423 125
295 3300025920 Ga0207649_10163071 Ga0207649_101630713 125
296 3300025921 Ga0207652_10004292 Ga0207652_100042925 125
297 3300025921 Ga0207652_10051391 Ga0207652_100513914 125
298 3300025923 Ga0207681_11385049 Ga0207681_113850492 125
299 3300025924 Ga0207694_10080350 Ga0207694_100803502 125
300 3300025924 Ga0207694_10130152 Ga0207694_101301523 125
301 3300025924 Ga0207694_10170886 Ga0207694_101708862 125
302 3300025924 Ga0207694_10366716 Ga0207694_103667162 125
303 3300025925 Ga0207650_10254160 Ga0207650_102541602 125
304 3300025926 Ga0207659_10240420 Ga0207659_102404203 125
305 3300025931 Ga0207644_11337968 Ga0207644_113379682 125
306 3300025935 Ga0207709_11509043 Ga0207709_115090431 125
307 3300025937 Ga0207669_10223395 Ga0207669_102233952 125
308 3300025938 Ga0207704_10457578 Ga0207704_104575781 125
309 3300025938 Ga0207704_11775786 Ga0207704_117757861 125
310 3300025940 Ga0207691_10008993 Ga0207691_100089937 125
311 3300025940 Ga0207691_10144191 Ga0207691_101441913 125
312 3300025942 Ga0207689_10020682 Ga0207689_100206824 125
313 3300025942 Ga0207689_10029163 Ga0207689_100291634 125
314 3300025942 Ga0207689_10953540 Ga0207689_109535402 125
315 3300025944 Ga0207661_10134500 Ga0207661_101345002 125
316 3300025944 Ga0207661_10139225 Ga0207661_101392251 125
317 3300025944 Ga0207661_10142881 Ga0207661_101428813 125
318 3300025944 Ga0207661_10766348 Ga0207661_107663482 125
319 3300025944 Ga0207661_10908018 Ga0207661_109080181 125
320 3300025945 Ga0207679_10135709 Ga0207679_101357092 125
321 3300025949 Ga0207667_10000713 Ga0207667_1000071333 125
322 3300025949 Ga0207667_10001674 Ga0207667_100016746 125
323 3300025949 Ga0207667_10028437 Ga0207667_100284376 125
324 3300025949 Ga0207667_10331045 Ga0207667_103310452 125
325 3300025960 Ga0207651_10015820 Ga0207651_100158205 125
326 3300025972 Ga0207668_10149154 Ga0207668_101491542 125
327 3300025972 Ga0207668_10621253 Ga0207668_106212531 125
328 3300025981 Ga0207640_10118075 Ga0207640_101180751 125
329 3300025981 Ga0207640_10122251 Ga0207640_101222512 125
330 3300025981 Ga0207640_10139199 Ga0207640_101391992 125
331 3300025981 Ga0207640_10243169 Ga0207640_102431693 125
332 3300025981 Ga0207640_10862207 Ga0207640_108622072 125
333 3300025986 Ga0207658_10020190 Ga0207658_100201906 125
334 3300025986 Ga0207658_10746184 Ga0207658_107461842 125
335 3300026041 Ga0207639_10012880 Ga0207639_100128803 125
336 3300026041 Ga0207639_10017764 Ga0207639_100177644 125
337 3300026041 Ga0207639_10071978 Ga0207639_100719783 125
338 3300026041 Ga0207639_10902457 Ga0207639_109024571 125
339 3300026041 Ga0207639_11496900 Ga0207639_114969001 125
340 3300026078 Ga0207702_10021240 Ga0207702_100212406 125
341 3300026078 Ga0207702_10142894 Ga0207702_101428943 125
342 3300026078 Ga0207702_11200102 Ga0207702_112001022 125
343 3300026078 Ga0207702_11369936 Ga0207702_113699362 125
344 3300026088 Ga0207641_11568499 Ga0207641_115684992 125
345 3300026089 Ga0207648_10003726 Ga0207648_1000372610 125
346 3300026089 Ga0207648_10080405 Ga0207648_100804054 125
347 3300026089 Ga0207648_10716544 Ga0207648_107165442 125
348 3300026095 Ga0207676_10039845 Ga0207676_100398455 125
349 3300026116 Ga0207674_10002012 Ga0207674_1000201220 125
350 3300026118 Ga0207675_100236612 Ga0207675_1002366122 125
351 3300026118 Ga0207675_100240144 Ga0207675_1002401443 125
352 3300026118 Ga0207675_100580431 Ga0207675_1005804312 125
353 3300026118 Ga0207675_101139565 Ga0207675_1011395652 125
354 3300026118 Ga0207675_101218131 Ga0207675_1012181312 125
355 3300026121 Ga0207683_11411006 Ga0207683_114110061 125
356 3300026121 Ga0207683_11702201 Ga0207683_117022011 125
357 3300026142 Ga0207698_10004751 Ga0207698_100047512 125
358 3300026142 Ga0207698_10024170 Ga0207698_100241702 125
359 3300026142 Ga0207698_10038406 Ga0207698_100384064 125
360 3300026142 Ga0207698_10043618 Ga0207698_100436184 125
361 3300026142 Ga0207698_10134888 Ga0207698_101348884 125
362 3300026142 Ga0207698_10468351 Ga0207698_104683512 125
363 3300026142 Ga0207698_10559093 Ga0207698_105590931 125
364 3300026142 Ga0207698_12012418 Ga0207698_120124181 125
365 3300027526 Ga0209968_1046814 Ga0209968_10468141 125
366 3300028379 Ga0268266_10000073 Ga0268266_1000007325 125
367 3300028379 Ga0268266_10629876 Ga0268266_106298761 125
368 3300028380 Ga0268265_10006712 Ga0268265_100067126 125
369 3300028380 Ga0268265_11990433 Ga0268265_119904331 125
370 3300028381 Ga0268264_10000973 Ga0268264_100009738 125
371 3300028381 Ga0268264_10004437 Ga0268264_1000443715 125
372 3300028381 Ga0268264_10090288 Ga0268264_100902882 125
373 3300028381 Ga0268264_10126109 Ga0268264_101261092 125
374 3300028381 Ga0268264_10546669 Ga0268264_105466692 125
375 3300028786 Ga0307517_10075437 Ga0307517_100754374 125
376 3300028786 Ga0307517_10169437 Ga0307517_101694373 125
377 3300030521 Ga0307511_10000232 Ga0307511_100002325 125
378 3300031240 Ga0265320_10263333 Ga0265320_102633332 125
379 3300031456 Ga0307513_10241313 Ga0307513_102413133 125
380 3300031507 Ga0307509_10108305 Ga0307509_101083052 125
381 3300031507 Ga0307509_10178032 Ga0307509_101780323 125
382 3300031507 Ga0307509_10563097 Ga0307509_105630972 125
383 3300031548 Ga0307408_100001245 Ga0307408_10000124515 125
384 3300031548 Ga0307408_100059733 Ga0307408_1000597332 125
385 3300031548 Ga0307408_100102511 Ga0307408_1001025111 125
386 3300031548 Ga0307408_100197325 Ga0307408_1001973253 125
387 3300031616 Ga0307508_10000181 Ga0307508_1000018125 125
388 3300031730 Ga0307516_10146874 Ga0307516_101468742 125
389 3300031731 Ga0307405_10032769 Ga0307405_100327692 125
390 3300031824 Ga0307413_10004719 Ga0307413_100047193 125
391 3300031824 Ga0307413_10234344 Ga0307413_102343442 125
392 3300031852 Ga0307410_10034501 Ga0307410_100345012 125
393 3300031901 Ga0307406_10000404 Ga0307406_100004041 125
394 3300031901 Ga0307406_10023017 Ga0307406_100230172 125
395 3300031903 Ga0307407_10185961 Ga0307407_101859612 125
396 3300031903 Ga0307407_10238443 Ga0307407_102384432 125
397 3300031911 Ga0307412_10025250 Ga0307412_100252503 125
398 3300031995 Ga0307409_100018059 Ga0307409_1000180593 125
399 3300031995 Ga0307409_101278977 Ga0307409_1012789772 125
400 3300032002 Ga0307416_100179705 Ga0307416_1001797051 125
401 3300032002 Ga0307416_101432988 Ga0307416_1014329881 125
402 3300032004 Ga0307414_10000052 Ga0307414_10000052115 125
403 3300032004 Ga0307414_10028364 Ga0307414_100283643 125
404 3300032004 Ga0307414_10047632 Ga0307414_100476322 125
405 3300032004 Ga0307414_10133539 Ga0307414_101335393 125
406 3300032004 Ga0307414_10162000 Ga0307414_101620003 125
407 3300032004 Ga0307414_10182668 Ga0307414_101826682 125
408 3300032004 Ga0307414_10865549 Ga0307414_108655491 125
409 3300032005 Ga0307411_10051637 Ga0307411_100516371 125
410 3300032005 Ga0307411_10910838 Ga0307411_109108382 125
411 3300032126 Ga0307415_100502271 Ga0307415_1005022711 125
412 3300033180 Ga0307510_10000637 Ga0307510_1000063726 125
413 3300037312 Ga0395899_0194311 Ga0395899_0194311_392_769 125
414 3300037312 Ga0395899_0384134 Ga0395899_0384134_219_596 125
415 3300037312 Ga0395899_0386796 Ga0395899_0386796_292_669 125
416 3300037418 Ga0395900_0207469 Ga0395900_0207469_1499_1876 125
417 3300037418 Ga0395900_0573779 Ga0395900_0573779_302_679 125
418 3300037418 Ga0395900_0574665 Ga0395900_0574665_392_769 125
419 3300037466 Ga0395898_0573709 Ga0395898_0573709_392_769 125
420 3300037466 Ga0395898_0574615 Ga0395898_0574615_392_769 125
421 3300037471 Ga0395905_0014608 Ga0395905_0014608_899_1276 125
422 3300037471 Ga0395905_0691188 Ga0395905_0691188_254_631 125
423 3300038443 Ga0395901_0119569 Ga0395901_0119569_655_1032 125
424 3300038443 Ga0395901_0181786 Ga0395901_0181786_1141_1518 125
425 3300038443 Ga0395901_0708627 Ga0395901_0708627_302_679 125
426 3300041494 Ga0451837_0175745 Ga0451837_0175745_49_426 125
427 3300041501 Ga0451845_0745347 Ga0451845_0745347_81_464 125
428 3300041512 Ga0451853_0292156 Ga0451853_0292156_512_889 125
429 3300044673 Ga0453683_0067000 Ga0453683_0067000_1377_1754 125
430 3300044693 Ga0466961_0034395 Ga0466961_0034395_710_1090 125
431 3300044694 Ga0466963_0088980 Ga0466963_0088980_15_401 125
432 3300044706 Ga0466964_0009653 Ga0466964_0009653_2140_2517 125
433 3300044706 Ga0466964_0139287 Ga0466964_0139287_36_416 125
434 3300044712 Ga0453684_0059472 Ga0453684_0059472_2204_2581 125
435 3300044719 Ga0466971_0040206 Ga0466971_0040206_1155_1535 125
436 3300044735 Ga0466968_0052519 Ga0466968_0052519_1292_1669 125
437 3300044765 Ga0466970_0214827 Ga0466970_0214827_247_624 125
438 3300045049 Ga0466959_0005141 Ga0466959_0005141_529_909 125
439 3300045976 Ga0466967_0161903 Ga0466967_0161903_131_517 125
440 3300046460 Ga0495638_0026894 Ga0495638_0026894_2085_2465 125
441 3300046460 Ga0495638_0028140 Ga0495638_0028140_2016_2396 125
442 3300046507 Ga0495606_0009808 Ga0495606_0009808_5670_6050 125
443 3300046524 Ga0495648_0002315 Ga0495648_0002315_359_739 125
444 3300046616 Ga0495668_0604032 Ga0495668_0604032_193_570 125
445 3300046648 Ga0495611_0001153 Ga0495611_0001153_574_954 125
446 3300046648 Ga0495611_0030145 Ga0495611_0030145_1872_2252 125
447 3300046660 Ga0495625_0419761 Ga0495625_0419761_164_541 125
448 3300046660 Ga0495625_0560692 Ga0495625_0560692_193_573 125
449 3300046694 Ga0495649_0146982 Ga0495649_0146982_709_1086 125
450 3300046694 Ga0495649_0473505 Ga0495649_0473505_97_477 125
451 3300047323 Ga0495683_0222870 Ga0495683_0222870_382_762 125
452 3300047443 Ga0495687_000179 Ga0495687_000179_2222_2602 125
453 3300047472 Ga0495686_0000010 Ga0495686_0000010_336771_337148 125
454 3300048918 Ga0496115_0870958 Ga0496115_0870958_26_406 125
455 3300048926 Ga0496123_0389536 Ga0496123_0389536_11_388 125
456 3300048929 Ga0496126_0735119 Ga0496126_0735119_101_481 125
457 3300049569 Ga0501032_0380597 Ga0501032_0380597_11_397 125
458 3300049570 Ga0501033_0011966 Ga0501033_0011966_1938_2324 125
459 3300049571 Ga0501034_0125286 Ga0501034_0125286_1679_2056 125
460 3300049571 Ga0501034_0166402 Ga0501034_0166402_1188_1574 125
461 3300049572 Ga0501036_0004307 Ga0501036_0004307_6977_7354 125
462 3300049573 Ga0501037_0041022 Ga0501037_0041022_2603_2980 125
463 3300049573 Ga0501037_0864110 Ga0501037_0864110_110_496 125
464 3300049575 Ga0501039_0360952 Ga0501039_0360952_270_647 125
465 3300049579 Ga0501043_0033919 Ga0501043_0033919_87_473 125
466 3300049579 Ga0501043_0142344 Ga0501043_0142344_1281_1658 125
467 3300049580 Ga0501046_0033176 Ga0501046_0033176_681_1058 125
468 3300049581 Ga0501047_0053697 Ga0501047_0053697_770_1156 125
469 3300049581 Ga0501047_0067395 Ga0501047_0067395_2853_3230 125
470 3300049582 Ga0501048_0006935 Ga0501048_0006935_5423_5800 125
471 3300049582 Ga0501048_0218006 Ga0501048_0218006_873_1259 125
472 3300049583 Ga0501067_0028416 Ga0501067_0028416_254_631 125
473 3300049584 Ga0501068_0115527 Ga0501068_0115527_866_1243 125
474 3300049585 Ga0501069_0166456 Ga0501069_0166456_688_1065 125
475 3300049586 Ga0501070_0037058 Ga0501070_0037058_848_1225 125
476 3300049589 Ga0501073_0000302 Ga0501073_0000302_18550_18927 125
477 3300049590 Ga0501074_0000754 Ga0501074_0000754_18266_18643 125
478 3300049593 Ga0501077_0315025 Ga0501077_0315025_432_809 125
479 3300049663 Ga0501223_032405 Ga0501223_032405_79_456 125
480 3300049665 Ga0501227_001545 Ga0501227_001545_2010_2387 125
481 3300049674 Ga0501242_027402 Ga0501242_027402_266_649 125
482 3300049674 Ga0501242_047035 Ga0501242_047035_224_601 125
483 3300049677 Ga0501247_080045 Ga0501247_080045_67_450 125
484 3300049679 Ga0501249_167419 Ga0501249_167419_84_467 125
485 3300049707 Ga0501234_079819 Ga0501234_079819_19_402 125
486 3300049744 Ga0501083_0062154 Ga0501083_0062154_1466_1843 125
487 3300049770 Ga0501273_018901 Ga0501273_018901_392_775 125
488 3300049822 Ga0501035_0029492 Ga0501035_0029492_3442_3819 125
489 3300049823 Ga0501044_0056382 Ga0501044_0056382_3400_3786 125
490 3300049823 Ga0501044_0076382 Ga0501044_0076382_183_560 125
491 3300050493 nmdc:mga0k408_184103_c1 nmdc:mga0k408_184103_c1_536_913 125
492 3300050494 nmdc:mga06z11_1022635_c1 nmdc:mga06z11_1022635_c1_36_413 125
493 3300053086 Ga0500578_0469291 Ga0500578_0469291_125_505 125
494 3300053087 Ga0500643_102255 Ga0500643_102255_253_633 125
495 3300053088 Ga0500644_0048729 Ga0500644_0048729_937_1317 125
496 3300053090 Ga0500646_0001812 Ga0500646_0001812_1778_2155 125
497 3300053092 Ga0500583_0002281 Ga0500583_0002281_1654_2034 125
498 3300053122 Ga0500608_269706 Ga0500608_269706_108_488 125
499 3300053130 Ga0500642_0132452 Ga0500642_0132452_17_397 125
500 3300053131 Ga0500652_243122 Ga0500652_243122_145_522 125
501 3300053133 Ga0500655_012047 Ga0500655_012047_156_536 125
502 3300053136 Ga0500559_0000580 Ga0500559_0000580_3786_4163 125
503 3300053139 Ga0500568_0018171 Ga0500568_0018171_617_997 125
504 3300053142 Ga0500577_0279760 Ga0500577_0279760_210_590 125
505 3300053146 Ga0500588_0001757 Ga0500588_0001757_483_860 125
506 3300053148 Ga0500590_247765 Ga0500590_247765_178_558 125
507 3300053151 Ga0500604_0323582 Ga0500604_0323582_102_479 125
508 3300053156 Ga0500622_0003896 Ga0500622_0003896_7173_7553 125
509 3300053178 Ga0500637_0050787 Ga0500637_0050787_1403_1783 125
510 3300053178 Ga0500637_0217632 Ga0500637_0217632_294_674 125
511 3300054114 Ga0501084_0065651 Ga0501084_0065651_2078_2455 125
512 3300060353 Ga0501082_0127210 Ga0501082_0127210_301_678 125
513 3300061719 Ga0466962_0053217 Ga0466962_0053217_670_1050 125
514 3300002738 JGI25154J39366_1000006 JGI25154J39366_100000697 126
515 3300002741 JGI25157J39369_1003000 JGI25157J39369_10030005 126
516 3300003215 JGI25153J46596_10000827 JGI25153J46596_1000082711 126
517 3300003323 rootH1_10001241 rootH1_100012416 126
518 3300003354 JGI25160J50197_1004979 JGI25160J50197_10049797 126
519 3300003761 Ga0055535_1004403 Ga0055535_10044034 126
520 3300003762 Ga0055542_1003719 Ga0055542_10037196 126
521 3300005262 Ga0065165_1010013 Ga0065165_10100133 126
522 3300005327 Ga0070658_10064572 Ga0070658_100645723 126
523 3300005330 Ga0070690_100580825 Ga0070690_1005808252 126
524 3300005336 Ga0070680_100151810 Ga0070680_1001518102 126
525 3300005367 Ga0070667_100560104 Ga0070667_1005601042 126
526 3300005471 Ga0070698_100030250 Ga0070698_1000302502 126
527 3300005518 Ga0070699_100012095 Ga0070699_1000120952 126
528 3300005535 Ga0070684_100443289 Ga0070684_1004432892 126
529 3300005546 Ga0070696_100053796 Ga0070696_1000537963 126
530 3300005564 Ga0070664_100075140 Ga0070664_1000751402 126
531 3300005578 Ga0068854_102209361 Ga0068854_1022093611 126
532 3300005618 Ga0068864_100092332 Ga0068864_1000923322 126
533 3300005618 Ga0068864_100137090 Ga0068864_1001370902 126
534 3300005841 Ga0068863_100019900 Ga0068863_1000199007 126
535 3300005841 Ga0068863_100268162 Ga0068863_1002681622 126
536 3300005842 Ga0068858_100711816 Ga0068858_1007118162 126
537 3300005843 Ga0068860_100890582 Ga0068860_1008905822 126
538 3300006844 Ga0075428_100093090 Ga0075428_1000930904 126
539 3300006844 Ga0075428_100412552 Ga0075428_1004125522 126
540 3300006847 Ga0075431_100391686 Ga0075431_1003916862 126
541 3300006931 Ga0097620_100419814 Ga0097620_1004198142 126
542 3300009094 Ga0111539_10289205 Ga0111539_102892052 126
543 3300009094 Ga0111539_11414110 Ga0111539_114141102 126
544 3300009094 Ga0111539_12901970 Ga0111539_129019701 126
545 3300009147 Ga0114129_10102207 Ga0114129_101022074 126
546 3300009147 Ga0114129_11297970 Ga0114129_112979702 126
547 3300009545 Ga0105237_10858237 Ga0105237_108582371 126
548 3300011119 Ga0105246_10684583 Ga0105246_106845832 126
549 3300013297 Ga0157378_10561088 Ga0157378_105610881 126
550 3300013307 Ga0157372_10813964 Ga0157372_108139642 126
551 3300013308 Ga0157375_11447129 Ga0157375_114471291 126
552 3300014325 Ga0163163_10088748 Ga0163163_100887482 126
553 3300014325 Ga0163163_10342377 Ga0163163_103423772 126
554 3300014968 Ga0157379_10123521 Ga0157379_101235211 126
555 3300014968 Ga0157379_10863971 Ga0157379_108639712 126
556 3300014969 Ga0157376_11118885 Ga0157376_111188852 126
557 3300017792 Ga0163161_10719221 Ga0163161_107192212 126
558 3300025242 Ga0209258_100029 Ga0209258_100029304 126
559 3300025245 Ga0207425_1037748 Ga0207425_10377482 126
560 3300025246 Ga0209646_1000031 Ga0209646_1000031129 126
561 3300025250 Ga0209026_1000019 Ga0209026_1000019129 126
562 3300025254 Ga0209148_1000089 Ga0209148_1000089212 126
563 3300025297 Ga0209758_1003209 Ga0209758_100320911 126
564 3300025302 Ga0207426_1000445 Ga0207426_100044518 126
565 3300025917 Ga0207660_10614591 Ga0207660_106145912 126
566 3300025917 Ga0207660_11216029 Ga0207660_112160292 126
567 3300025920 Ga0207649_10371679 Ga0207649_103716791 126
568 3300025932 Ga0207690_10622987 Ga0207690_106229872 126
569 3300025945 Ga0207679_10118129 Ga0207679_101181292 126
570 3300025981 Ga0207640_11540678 Ga0207640_115406781 126
571 3300025986 Ga0207658_10362691 Ga0207658_103626912 126
572 3300026088 Ga0207641_10085654 Ga0207641_100856543 126
573 3300026088 Ga0207641_10151070 Ga0207641_101510702 126
574 3300026089 Ga0207648_11376805 Ga0207648_113768051 126
575 3300026095 Ga0207676_10326167 Ga0207676_103261672 126
576 3300026095 Ga0207676_11079115 Ga0207676_110791152 126
577 3300027717 Ga0209998_10029491 Ga0209998_100294912 126
578 3300030734 Ga0316179_1078913 Ga0316179_10789132 126
579 3300031507 Ga0307509_10061299 Ga0307509_100612994 126
580 3300031548 Ga0307408_100166439 Ga0307408_1001664392 126
581 3300031731 Ga0307405_10073057 Ga0307405_100730571 126
582 3300031824 Ga0307413_10044344 Ga0307413_100443442 126
583 3300031824 Ga0307413_10976038 Ga0307413_109760382 126
584 3300031852 Ga0307410_10026490 Ga0307410_100264904 126
585 3300031852 Ga0307410_10090396 Ga0307410_100903962 126
586 3300031901 Ga0307406_10018903 Ga0307406_100189035 126
587 3300031901 Ga0307406_10112503 Ga0307406_101125032 126
588 3300031901 Ga0307406_10148922 Ga0307406_101489222 126
589 3300031911 Ga0307412_11424086 Ga0307412_114240862 126
590 3300031995 Ga0307409_100044542 Ga0307409_1000445424 126
591 3300031995 Ga0307409_100236268 Ga0307409_1002362682 126
592 3300031995 Ga0307409_100635794 Ga0307409_1006357941 126
593 3300032002 Ga0307416_100117717 Ga0307416_1001177171 126
594 3300032002 Ga0307416_100215596 Ga0307416_1002155961 126
595 3300032002 Ga0307416_100382202 Ga0307416_1003822022 126
596 3300032004 Ga0307414_10278391 Ga0307414_102783912 126
597 3300032004 Ga0307414_10516010 Ga0307414_105160101 126
598 3300032005 Ga0307411_10021864 Ga0307411_100218644 126
599 3300032005 Ga0307411_10095276 Ga0307411_100952762 126
600 3300032126 Ga0307415_100193110 Ga0307415_1001931101 126
601 3300032126 Ga0307415_100313629 Ga0307415_1003136292 126
602 3300032126 Ga0307415_101324770 Ga0307415_1013247702 126
603 3300034816 Ga0373930_0017728 Ga0373930_0017728_243_632 126
604 3300035241 Ga0373961_0046634 Ga0373961_0046634_736_1125 126
605 3300035242 Ga0373962_0038271 Ga0373962_0038271_411_800 126
606 3300035724 Ga0373933_0741535 Ga0373933_0741535_253_633 126
607 3300041406 Ga0439439_0003919 Ga0439439_0003919_1051_1452 126
608 3300041406 Ga0439439_0174051 Ga0439439_0174051_28_417 126
609 3300041999 Ga0439433_0056306 Ga0439433_0056306_153_554 126
610 3300041999 Ga0439433_0223219 Ga0439433_0223219_30_419 126
611 3300042014 Ga0439457_014463 Ga0439457_014463_599_1000 126
612 3300042015 Ga0439462_0004254 Ga0439462_0004254_2758_3159 126
613 3300042015 Ga0439462_0122260 Ga0439462_0122260_59_448 126
614 3300042125 Ga0450923_151684 Ga0450923_151684_48_449 126
615 3300042128 Ga0450897_043261 Ga0450897_043261_111_500 126
616 3300042134 Ga0450898_003159 Ga0450898_003159_935_1324 126
617 3300042156 Ga0439446_0015945 Ga0439446_0015945_1219_1620 126
618 3300042184 Ga0450908_052247 Ga0450908_052247_271_660 126
619 3300042435 Ga0439434_0056500 Ga0439434_0056500_378_779 126
620 3300042435 Ga0439434_0105984 Ga0439434_0105984_358_747 126
621 3300042532 Ga0450893_0094336 Ga0450893_0094336_173_562 126
622 3300042876 Ga0451577_0020179 Ga0451577_0020179_4310_4735 126
623 3300045051 Ga0451576_1503075 Ga0451576_1503075_115_504 126
624 3300046499 Ga0495594_0028657 Ga0495594_0028657_2280_2669 126
625 3300048904 Ga0496101_0598287 Ga0496101_0598287_397_786 126
626 3300048905 Ga0496102_1540391 Ga0496102_1540391_133_522 126
627 3300048908 Ga0496105_0257520 Ga0496105_0257520_23_412 126
628 3300048909 Ga0496106_0284353 Ga0496106_0284353_568_957 126
629 3300048909 Ga0496106_0728810 Ga0496106_0728810_157_546 126
630 3300048911 Ga0496108_0000454 Ga0496108_0000454_14861_15250 126
631 3300048911 Ga0496108_0114107 Ga0496108_0114107_1717_2106 126
632 3300048911 Ga0496108_1118980 Ga0496108_1118980_29_418 126
633 3300048912 Ga0496109_0004696 Ga0496109_0004696_654_1043 126
634 3300048912 Ga0496109_0846179 Ga0496109_0846179_100_489 126
635 3300048913 Ga0496110_0009965 Ga0496110_0009965_6772_7161 126
636 3300048914 Ga0496111_0068890 Ga0496111_0068890_1444_1833 126
637 3300048914 Ga0496111_0115777 Ga0496111_0115777_1549_1938 126
638 3300048914 Ga0496111_0525593 Ga0496111_0525593_367_756 126
639 3300048915 Ga0496112_0000336 Ga0496112_0000336_20859_21248 126
640 3300048916 Ga0496113_0000286 Ga0496113_0000286_8853_9242 126
641 3300049514 Ga0501291_013912 Ga0501291_013912_219_608 126
642 3300049573 Ga0501037_0505749 Ga0501037_0505749_341_721 126
643 3300049581 Ga0501047_0093604 Ga0501047_0093604_2269_2649 126
644 3300049584 Ga0501068_0992822 Ga0501068_0992822_120_509 126
645 3300049585 Ga0501069_0296809 Ga0501069_0296809_530_919 126
646 3300049586 Ga0501070_0119799 Ga0501070_0119799_1453_1842 126
647 3300049588 Ga0501072_0051833 Ga0501072_0051833_1467_1856 126
648 3300049589 Ga0501073_1234566 Ga0501073_1234566_26_415 126
649 3300049591 Ga0501075_0063049 Ga0501075_0063049_1846_2235 126
650 3300049671 Ga0501238_038654 Ga0501238_038654_193_573 126
651 3300049703 Ga0501219_000106 Ga0501219_000106_1404_1784 126
652 3300049741 Ga0501079_0044593 Ga0501079_0044593_2533_2922 126
653 3300049742 Ga0501080_0045485 Ga0501080_0045485_2364_2753 126
654 3300049742 Ga0501080_0646528 Ga0501080_0646528_352_741 126
655 3300049758 Ga0501241_003713 Ga0501241_003713_2000_2380 126
656 3300049765 Ga0501268_155552 Ga0501268_155552_69_458 126
657 3300049822 Ga0501035_0212737 Ga0501035_0212737_511_891 126
658 3300049823 Ga0501044_0067956 Ga0501044_0067956_1446_1826 126
659 3300049824 Ga0501045_0782509 Ga0501045_0782509_222_611 126
660 3300050005 Ga0501284_00148 Ga0501284_00148_3142_3522 126
661 3300050507 nmdc:mga05p37_142533_c1 nmdc:mga05p37_142533_c1_1478_1867 126
662 3300050508 nmdc:mga09592_309398_c1 nmdc:mga09592_309398_c1_184_573 126
663 3300050510 nmdc:mga06r32_183164_c1 nmdc:mga06r32_183164_c1_1574_1963 126
664 3300050511 nmdc:mga08y16_1172790_c1 nmdc:mga08y16_1172790_c1_30_410 126
665 3300050511 nmdc:mga08y16_593501_c1 nmdc:mga08y16_593501_c1_408_797 126
666 3300053088 Ga0500644_0000117 Ga0500644_0000117_36756_37136 126
667 3300053109 Ga0500569_000434 Ga0500569_000434_546_926 126
668 3300053118 Ga0500594_0081157 Ga0500594_0081157_107_487 126
669 3300053121 Ga0500607_050200 Ga0500607_050200_989_1369 126
670 3300053122 Ga0500608_133717 Ga0500608_133717_531_911 126
671 3300053131 Ga0500652_059722 Ga0500652_059722_1107_1487 126
672 3300053134 Ga0500658_0006812 Ga0500658_0006812_3210_3590 126
673 3300053136 Ga0500559_0032244 Ga0500559_0032244_1642_2022 126
674 3300053137 Ga0500561_0226260 Ga0500561_0226260_62_442 126
675 3300053142 Ga0500577_0003665 Ga0500577_0003665_663_1043 126
676 3300053148 Ga0500590_032355 Ga0500590_032355_533_913 126
677 3300053153 Ga0500616_0137764 Ga0500616_0137764_409_789 126
678 3300053160 Ga0500633_0001931 Ga0500633_0001931_3528_3908 126
679 3300053177 Ga0500636_0005080 Ga0500636_0005080_3134_3514 126
680 3300055283 Ga0500661_004973 Ga0500661_004973_201_623 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

27

145

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9826 2 124
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9743 1 122
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9683 5 124
3hgb-assembly1.cif.gz_A crystal structure of glycine cleavage system protein h from mycobacterium tuberculosis 0.9594 2 123
2ka7-assembly1.cif.gz_A nmr solution structure of tm0212 at 40 c 0.9558 7 124
ID Description Score Start End Superfamily
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9677 5 124 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9676 5 123 2.40.50.100
af_A4IC11_1_107_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9527 20 124 2.40.50.100
af_Q4E4F5_6_138_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9444 5 124 2.40.50.100
af_K7TZ76_31_128_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9393 37 124 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A3E1Y9Y3-F1-model_v4 Glycine cleavage system H protein 1.003 1 126 GO:0005829
GO:0005960
GO:0019464
AF-A0A7D4ULF5-F1-model_v4 Glycine cleavage system H protein 1.003 1 126 GO:0005829
GO:0005960
GO:0019464
AF-I4AGP6-F1-model_v4 Glycine cleavage system H protein 1.003 1 125 GO:0005829
GO:0005960
GO:0019464
AF-A0A3M7TI61-F1-model_v4 Glycine cleavage system H protein 1 1 125 GO:0005829
GO:0005960
GO:0019464
AF-A0A1H9G454-F1-model_v4 Glycine cleavage system H protein 0.9972 1 126 GO:0005829
GO:0005960
GO:0019464

Feature Viewer

pLDDT pTM Quality
97.18 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map