F474584

General Info

Members Datasets Scaffolds Average Seq Length
677 242 1354 134

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10329969|Ga0163163_103299692
Length 149
Sequence MDMEVDLPPPFKTVMAEKIKLEVVTPERRVLEEPVEMVTVPGLNGELGILPGHTPLISQVRTGVLTYVQDGKSSQLHVSGGFVEVRDDHVSVLAEVAERPEEIDVASARSSRERLEKQLSGWTGSEDDLELARTELARSEVRLQLASRA

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
183 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
187 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
188 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
205 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
206 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
207 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
208 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
209 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
210 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
211 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
212 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
213 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
214 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
215 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
216 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
217 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
218 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
219 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
220 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
221 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
222 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
223 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
226 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
227 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
228 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
229 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
230 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
231 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
232 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.25
Rhizosphere 96.31
Stem 0
Stem Tuber 0
Unclassified 9.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10329969 3300014325 Unclassified 1580
2 MRS1b_contig_387228 2162886011 Bacteria 1247
3 CNAas_1001193 3300000532 Bacteria 2338
4 rootL2_10018895 3300003322 Bacteria 1723
5 Ga0065714_10064422 3300005288 Bacteria 270668
6 Ga0065704_10087453 3300005289 Bacteria 3025
7 Ga0065712_10005811 3300005290 Bacteria 4804
8 Ga0065712_10067728 3300005290 Bacteria 178215
9 Ga0065715_10001035 3300005293 Bacteria 10438
10 Ga0065715_10017757 3300005293 Bacteria 2823
11 Ga0065715_10089178 3300005293 Bacteria 13073
12 Ga0065715_10104815 3300005293 Bacteria 2933
13 Ga0065715_10147699 3300005293 Bacteria 1767
14 Ga0065715_10381529 3300005293 Bacteria 907
15 Ga0065707_10001162 3300005295 Bacteria 16406
16 Ga0065707_10100764 3300005295 Bacteria 2902
17 Ga0065707_10305069 3300005295 Bacteria 996
18 Ga0065707_10370192 3300005295 Bacteria 891
19 Ga0070676_10099276 3300005328 Bacteria 1796
20 Ga0070690_100024044 3300005330 Bacteria 3744
21 Ga0070690_100184047 3300005330 Bacteria 1445
22 Ga0070670_100211497 3300005331 Bacteria 1686
23 Ga0068869_100003088 3300005334 Bacteria 10143
24 Ga0068869_100201555 3300005334 Bacteria 1569
25 Ga0068869_101603832 3300005334 Unclassified 579
26 Ga0070666_10075043 3300005335 Bacteria 2306
27 Ga0070666_10077653 3300005335 Bacteria 2266
28 Ga0070682_100063495 3300005337 Bacteria 2342
29 Ga0070682_100523424 3300005337 Bacteria 923
30 Ga0070682_100897049 3300005337 Unclassified 728
31 Ga0068868_100120648 3300005338 Bacteria 2138
32 Ga0068868_100941500 3300005338 Bacteria 787
33 Ga0068868_101529197 3300005338 Unclassified 625
34 Ga0070689_100042748 3300005340 Bacteria 3480
35 Ga0070689_100319146 3300005340 Bacteria 1297
36 Ga0070689_100548418 3300005340 Bacteria 996
37 Ga0070689_102038311 3300005340 Bacteria 525
38 Ga0070687_100603229 3300005343 Bacteria 754
39 Ga0070687_100672115 3300005343 Bacteria 720
40 Ga0070687_100734576 3300005343 Bacteria 693
41 Ga0070661_100927675 3300005344 Bacteria 720
42 Ga0070668_100525383 3300005347 Bacteria 1027
43 Ga0070675_100048186 3300005354 Bacteria 3493
44 Ga0070675_100071606 3300005354 Bacteria 2876
45 Ga0070675_100543904 3300005354 Bacteria 1050
46 Ga0070675_101159265 3300005354 Bacteria 711
47 Ga0070671_100281350 3300005355 Bacteria 1415
48 Ga0070671_100340637 3300005355 Bacteria 1279
49 Ga0070671_100346801 3300005355 Bacteria 1267
50 Ga0070671_101863307 3300005355 Bacteria 535
51 Ga0070674_100613152 3300005356 Bacteria 921
52 Ga0070673_100004810 3300005364 Bacteria 8587
53 Ga0070673_100060566 3300005364 Bacteria 3000
54 Ga0070673_100422067 3300005364 Bacteria 1196
55 Ga0070673_100959072 3300005364 Bacteria 795
56 Ga0070688_100014268 3300005365 Bacteria 4499
57 Ga0070688_100409563 3300005365 Bacteria 1005
58 Ga0070659_100994593 3300005366 Bacteria 736
59 Ga0070667_100017988 3300005367 Bacteria 5858
60 Ga0070703_10000034 3300005406 Bacteria 66916
61 Ga0070713_100235660 3300005436 Bacteria 1665
62 Ga0070701_10105611 3300005438 Bacteria 1566
63 Ga0070701_10365375 3300005438 Bacteria 905
64 Ga0070705_100000814 3300005440 Bacteria 17531
65 Ga0070705_100081439 3300005440 Bacteria 1989
66 Ga0070705_100121867 3300005440 Bacteria 1685
67 Ga0070705_100170123 3300005440 Bacteria 1466
68 Ga0070705_100205856 3300005440 Bacteria 1353
69 Ga0070705_100251102 3300005440 Bacteria 1242
70 Ga0070705_100518322 3300005440 Bacteria 908
71 Ga0070700_100146484 3300005441 Bacteria 1610
72 Ga0070694_100163889 3300005444 Bacteria 1633
73 Ga0070694_100174605 3300005444 Bacteria 1585
74 Ga0070694_100201804 3300005444 Bacteria 1483
75 Ga0070694_100227073 3300005444 Bacteria 1403
76 Ga0070694_100435113 3300005444 Bacteria 1033
77 Ga0070694_100575174 3300005444 Bacteria 905
78 Ga0070694_101303591 3300005444 Unclassified 611
79 Ga0070708_100241205 3300005445 Bacteria 1697
80 Ga0070708_100403597 3300005445 Bacteria 1289
81 Ga0070708_101233635 3300005445 Bacteria 699
82 Ga0070678_100012035 3300005456 Bacteria 5361
83 Ga0070678_100199046 3300005456 Bacteria 1652
84 Ga0070662_100148224 3300005457 Bacteria 1824
85 Ga0070681_10000700 3300005458 Bacteria 27818
86 Ga0070681_10010507 3300005458 Bacteria 9142
87 Ga0068867_100008010 3300005459 Bacteria 7466
88 Ga0068867_100076113 3300005459 Bacteria 2519
89 Ga0068867_100128729 3300005459 Bacteria 1965
90 Ga0068867_100403724 3300005459 Bacteria 1153
91 Ga0068867_100439528 3300005459 Bacteria 1109
92 Ga0068867_100472133 3300005459 Bacteria 1073
93 Ga0070685_10005003 3300005466 Bacteria 6712
94 Ga0070685_10324979 3300005466 Bacteria 1044
95 Ga0070706_100000061 3300005467 Bacteria 130709
96 Ga0070706_100045716 3300005467 Bacteria 4043
97 Ga0070706_100202517 3300005467 Bacteria 1854
98 Ga0070706_100540599 3300005467 Bacteria 1084
99 Ga0070706_100677690 3300005467 Bacteria 957
100 Ga0070706_100907766 3300005467 Unclassified 814
101 Ga0070707_100331788 3300005468 Bacteria 1478
102 Ga0070707_100336771 3300005468 Bacteria 1466
103 Ga0070698_100005684 3300005471 Bacteria 13649
104 Ga0070698_100061507 3300005471 Bacteria 3789
105 Ga0070698_100148595 3300005471 Bacteria 2292
106 Ga0070698_100203334 3300005471 Bacteria 1916
107 Ga0070698_100261779 3300005471 Bacteria 1662
108 Ga0070698_100283486 3300005471 Bacteria 1588
109 Ga0070699_100000034 3300005518 Bacteria 135576
110 Ga0070699_100181174 3300005518 Bacteria 1869
111 Ga0070699_100455107 3300005518 Bacteria 1161
112 Ga0070699_100749672 3300005518 Bacteria 893
113 Ga0070699_101507209 3300005518 Bacteria 617
114 Ga0070679_100000642 3300005530 Bacteria 29738
115 Ga0070679_100236813 3300005530 Bacteria 1784
116 Ga0070679_101599184 3300005530 Unclassified 599
117 Ga0070697_100279544 3300005536 Bacteria 1432
118 Ga0070697_100386422 3300005536 Bacteria 1213
119 Ga0070697_100562240 3300005536 Bacteria 1001
120 Ga0070697_100726475 3300005536 Bacteria 877
121 Ga0070697_101366816 3300005536 Unclassified 632
122 Ga0068853_100282672 3300005539 Bacteria 1530
123 Ga0068853_100911838 3300005539 Bacteria 844
124 Ga0068853_102468203 3300005539 Unclassified 503
125 Ga0070672_100005452 3300005543 Bacteria 8432
126 Ga0070672_100167986 3300005543 Bacteria 1823
127 Ga0070686_100483456 3300005544 Bacteria 958
128 Ga0070686_100662520 3300005544 Bacteria 829
129 Ga0070695_100015790 3300005545 Bacteria 4562
130 Ga0070695_100058765 3300005545 Bacteria 2487
131 Ga0070695_100126135 3300005545 Bacteria 1758
132 Ga0070695_100224466 3300005545 Bacteria 1355
133 Ga0070695_100324320 3300005545 Bacteria 1146
134 Ga0070695_100481177 3300005545 Unclassified 957
135 Ga0070695_100635114 3300005545 Bacteria 842
136 Ga0070695_100930280 3300005545 Unclassified 704
137 Ga0070696_100000032 3300005546 Bacteria 64257
138 Ga0070696_100012636 3300005546 Bacteria 5669
139 Ga0070696_100204613 3300005546 Bacteria 1475
140 Ga0070696_100446134 3300005546 Bacteria 1020
141 Ga0070696_100501285 3300005546 Bacteria 966
142 Ga0070696_100532855 3300005546 Bacteria 938
143 Ga0070696_100662821 3300005546 Unclassified 847
144 Ga0070693_100012867 3300005547 Bacteria 4247
145 Ga0070693_100030282 3300005547 Bacteria 2958
146 Ga0070693_100107545 3300005547 Bacteria 1710
147 Ga0070693_100230264 3300005547 Bacteria 1219
148 Ga0070693_100607738 3300005547 Bacteria 790
149 Ga0070693_101096511 3300005547 Bacteria 607
150 Ga0070665_100102031 3300005548 Bacteria 2872
151 Ga0070665_101994405 3300005548 Bacteria 586
152 Ga0070704_100118033 3300005549 Bacteria 2032
153 Ga0070704_100185238 3300005549 Bacteria 1669
154 Ga0070704_100843192 3300005549 Bacteria 821
155 Ga0070664_100204071 3300005564 Bacteria 1765
156 Ga0070664_100487184 3300005564 Bacteria 1135
157 Ga0070664_100907378 3300005564 Bacteria 826
158 Ga0070664_101404867 3300005564 Bacteria 660
159 Ga0068857_100065113 3300005577 Bacteria 3240
160 Ga0068857_100417794 3300005577 Bacteria 1250
161 Ga0068857_100437686 3300005577 Bacteria 1221
162 Ga0068857_100847530 3300005577 Bacteria 874
163 Ga0068857_100939433 3300005577 Bacteria 830
164 Ga0068857_102204908 3300005577 Unclassified 541
165 Ga0068854_100031756 3300005578 Bacteria 3671
166 Ga0068854_100159000 3300005578 Bacteria 1748
167 Ga0068854_100261723 3300005578 Bacteria 1385
168 Ga0068854_100315607 3300005578 Bacteria 1269
169 Ga0068854_100570060 3300005578 Bacteria 963
170 Ga0068854_101253880 3300005578 Bacteria 666
171 Ga0068856_100018249 3300005614 Bacteria 6802
172 Ga0070702_100007385 3300005615 Bacteria 5261
173 Ga0070702_100126600 3300005615 Bacteria 1607
174 Ga0070702_100198819 3300005615 Bacteria 1325
175 Ga0070702_100257473 3300005615 Unclassified 1186
176 Ga0070702_100273761 3300005615 Bacteria 1156
177 Ga0070702_100660868 3300005615 Bacteria 792
178 Ga0068852_100235251 3300005616 Bacteria 1748
179 Ga0068852_100287657 3300005616 Bacteria 1586
180 Ga0068859_100021635 3300005617 Bacteria 6454
181 Ga0068859_100129088 3300005617 Bacteria 2598
182 Ga0068859_100171699 3300005617 Bacteria 2249
183 Ga0068859_100299357 3300005617 Bacteria 1702
184 Ga0068859_100309194 3300005617 Bacteria 1674
185 Ga0068859_100391939 3300005617 Bacteria 1485
186 Ga0068859_100420631 3300005617 Bacteria 1432
187 Ga0068859_100750835 3300005617 Bacteria 1064
188 Ga0068859_101639726 3300005617 Unclassified 710
189 Ga0068859_101655970 3300005617 Bacteria 707
190 Ga0068859_101696500 3300005617 Bacteria 698
191 Ga0068859_102925499 3300005617 Unclassified 523
192 Ga0068864_100008432 3300005618 Bacteria 8504
193 Ga0068864_100069260 3300005618 Bacteria 3068
194 Ga0068864_100313920 3300005618 Bacteria 1470
195 Ga0068864_100371293 3300005618 Bacteria 1354
196 Ga0068864_100520631 3300005618 Unclassified 1146
197 Ga0068866_10005919 3300005718 Bacteria 5082
198 Ga0068861_100155248 3300005719 Bacteria 1882
199 Ga0068861_100206413 3300005719 Bacteria 1652
200 Ga0068861_100207166 3300005719 Bacteria 1650
201 Ga0068861_100279928 3300005719 Bacteria 1436
202 Ga0068861_100295012 3300005719 Bacteria 1402
203 Ga0068861_100932847 3300005719 Unclassified 824
204 Ga0068861_101652539 3300005719 Unclassified 632
205 Ga0068870_10021351 3300005840 Bacteria 3166
206 Ga0068870_10101306 3300005840 Bacteria 1628
207 Ga0068870_10161139 3300005840 Bacteria 1330
208 Ga0068870_10408771 3300005840 Bacteria 885
209 Ga0068870_10510774 3300005840 Bacteria 802
210 Ga0068863_100042837 3300005841 Bacteria 4300
211 Ga0068863_100118365 3300005841 Bacteria 2525
212 Ga0068863_100243863 3300005841 Bacteria 1734
213 Ga0068863_100526782 3300005841 Bacteria 1165
214 Ga0068863_100677434 3300005841 Bacteria 1024
215 Ga0068858_100039997 3300005842 Bacteria 4348
216 Ga0068858_100051756 3300005842 Bacteria 3800
217 Ga0068858_100212587 3300005842 Bacteria 1830
218 Ga0068858_100330802 3300005842 Bacteria 1457
219 Ga0068858_100445976 3300005842 Bacteria 1247
220 Ga0068858_100512334 3300005842 Bacteria 1160
221 Ga0068858_100976306 3300005842 Bacteria 830
222 Ga0068860_100036723 3300005843 Bacteria 4692
223 Ga0068860_100064245 3300005843 Bacteria 3486
224 Ga0068860_100066548 3300005843 Bacteria 3423
225 Ga0068860_100125495 3300005843 Bacteria 2460
226 Ga0068860_100490268 3300005843 Bacteria 1226
227 Ga0068860_100845948 3300005843 Bacteria 929
228 Ga0068860_101147769 3300005843 Bacteria 797
229 Ga0068862_100012647 3300005844 Bacteria 6984
230 Ga0068862_100709988 3300005844 Bacteria 975
231 Ga0068862_101122692 3300005844 Bacteria 782
232 Ga0068862_101400111 3300005844 Bacteria 702
233 Ga0081539_10000586 3300005985 Bacteria 74721
234 Ga0070715_10497458 3300006163 Bacteria 697
235 Ga0070715_10743395 3300006163 Bacteria 590
236 Ga0070715_10837208 3300006163 Bacteria 561
237 Ga0070716_100861090 3300006173 Unclassified 706
238 Ga0070712_100083913 3300006175 Bacteria 2315
239 Ga0097621_100007358 3300006237 Bacteria 7874
240 Ga0097621_100072216 3300006237 Bacteria 2854
241 Ga0097621_100096570 3300006237 Bacteria 2480
242 Ga0097621_100459694 3300006237 Bacteria 1148
243 Ga0068871_100009507 3300006358 Bacteria 7050
244 Ga0068871_100030390 3300006358 Bacteria 4253
245 Ga0068871_100122566 3300006358 Bacteria 2197
246 Ga0068871_100325484 3300006358 Bacteria 1354
247 Ga0068871_100450143 3300006358 Bacteria 1154
248 Ga0068871_101963331 3300006358 Unclassified 557
249 Ga0075428_100001759 3300006844 Bacteria 23115
250 Ga0075428_100129421 3300006844 Bacteria 2747
251 Ga0075430_100005700 3300006846 Bacteria 10508
252 Ga0075431_100176561 3300006847 Bacteria 2194
253 Ga0075433_10043559 3300006852 Bacteria 3896
254 Ga0075433_10070561 3300006852 Bacteria 3071
255 Ga0075433_10078106 3300006852 Bacteria 2917
256 Ga0075433_10156268 3300006852 Bacteria 2029
257 Ga0075433_10557201 3300006852 Bacteria 1007
258 Ga0075433_11281053 3300006852 Unclassified 635
259 Ga0075434_100104571 3300006871 Bacteria 2841
260 Ga0075434_101595044 3300006871 Bacteria 661
261 Ga0075434_101733107 3300006871 Bacteria 632
262 Ga0075434_102392736 3300006871 Unclassified 530
263 Ga0075429_100096403 3300006880 Bacteria 2580
264 Ga0075429_101515248 3300006880 Unclassified 583
265 Ga0068865_100056231 3300006881 Bacteria 2740
266 Ga0068865_100585302 3300006881 Unclassified 941
267 Ga0075436_100018923 3300006914 Bacteria 4716
268 Ga0097620_100021635 3300006931 Bacteria 6454
269 Ga0097620_100129081 3300006931 Bacteria 2598
270 Ga0097620_100171692 3300006931 Bacteria 2249
271 Ga0097620_100299346 3300006931 Bacteria 1702
272 Ga0097620_100309202 3300006931 Bacteria 1674
273 Ga0097620_100391906 3300006931 Bacteria 1485
274 Ga0097620_100420660 3300006931 Bacteria 1432
275 Ga0097620_100750832 3300006931 Bacteria 1064
276 Ga0097620_101639457 3300006931 Unclassified 710
277 Ga0097620_101656164 3300006931 Bacteria 707
278 Ga0097620_101696270 3300006931 Bacteria 698
279 Ga0097620_102925289 3300006931 Unclassified 523
280 Ga0075435_100000584 3300007076 Bacteria 22297
281 Ga0075435_100211133 3300007076 Bacteria 1647
282 Ga0075435_100408898 3300007076 Bacteria 1168
283 Ga0075435_100627644 3300007076 Bacteria 932
284 Ga0099794_10605151 3300007265 Bacteria 580
285 Ga0105251_10133269 3300009011 Bacteria 1126
286 Ga0105251_10169548 3300009011 Bacteria 984
287 Ga0105251_10320270 3300009011 Bacteria 705
288 Ga0105244_10407938 3300009036 Bacteria 625
289 Ga0105250_10178152 3300009092 Bacteria 891
290 Ga0111539_10006030 3300009094 Bacteria 15659
291 Ga0111539_10015623 3300009094 Bacteria 9438
292 Ga0111539_11394327 3300009094 Bacteria 813
293 Ga0105245_10011560 3300009098 Bacteria 7688
294 Ga0105245_10315299 3300009098 Bacteria 1539
295 Ga0105245_10419075 3300009098 Bacteria 1342
296 Ga0105245_10578861 3300009098 Bacteria 1147
297 Ga0105245_10741222 3300009098 Bacteria 1018
298 Ga0105247_10239353 3300009101 Bacteria 1236
299 Ga0114129_10006197 3300009147 Bacteria 16970
300 Ga0114129_10011602 3300009147 Bacteria 12544
301 Ga0114129_10059296 3300009147 Bacteria 5352
302 Ga0114129_10284114 3300009147 Bacteria 2210
303 Ga0114129_10631262 3300009147 Bacteria 1385
304 Ga0114129_10811011 3300009147 Bacteria 1193
305 Ga0114129_11037160 3300009147 Bacteria 1030
306 Ga0114129_11134149 3300009147 Bacteria 977
307 Ga0114129_11551647 3300009147 Bacteria 812
308 Ga0105243_10008067 3300009148 Bacteria 8084
309 Ga0105243_10022573 3300009148 Bacteria 4785
310 Ga0105243_10476600 3300009148 Bacteria 1177
311 Ga0105243_10478062 3300009148 Unclassified 1175
312 Ga0105243_10568032 3300009148 Bacteria 1087
313 Ga0105241_10117322 3300009174 Bacteria 2139
314 Ga0105241_10124896 3300009174 Bacteria 2077
315 Ga0105241_10145935 3300009174 Bacteria 1931
316 Ga0105241_10485095 3300009174 Bacteria 1099
317 Ga0105241_10929721 3300009174 Bacteria 809
318 Ga0105241_11186699 3300009174 Bacteria 722
319 Ga0105241_11332903 3300009174 Bacteria 685
320 Ga0105241_11946821 3300009174 Bacteria 577
321 Ga0105241_12351808 3300009174 Unclassified 531
322 Ga0105241_12636896 3300009174 Unclassified 505
323 Ga0105242_10003451 3300009176 Bacteria 12287
324 Ga0105242_10035538 3300009176 Bacteria 3996
325 Ga0105242_10105543 3300009176 Bacteria 2393
326 Ga0105242_10179021 3300009176 Bacteria 1869
327 Ga0105242_12814139 3300009176 Bacteria 537
328 Ga0105248_10003128 3300009177 Bacteria 18316
329 Ga0105248_10019796 3300009177 Bacteria 7454
330 Ga0105248_10038024 3300009177 Bacteria 5384
331 Ga0105248_10611799 3300009177 Bacteria 1229
332 Ga0105248_11338791 3300009177 Bacteria 810
333 Ga0105248_11496524 3300009177 Bacteria 764
334 Ga0105248_12775276 3300009177 Bacteria 559
335 Ga0105237_10143148 3300009545 Bacteria 2385
336 Ga0105237_10225858 3300009545 Bacteria 1873
337 Ga0105237_10696254 3300009545 Bacteria 1023
338 Ga0105238_10015857 3300009551 Bacteria 7627
339 Ga0105238_10046310 3300009551 Bacteria 4390
340 Ga0105249_10021667 3300009553 Bacteria 5754
341 Ga0105249_10269656 3300009553 Bacteria 1695
342 Ga0105249_10610009 3300009553 Bacteria 1146
343 Ga0105249_10977976 3300009553 Bacteria 915
344 Ga0105239_10048878 3300010375 Bacteria 4637
345 Ga0105239_10104419 3300010375 Bacteria 3137
346 Ga0105239_10133046 3300010375 Bacteria 2767
347 Ga0105239_11593699 3300010375 Bacteria 755
348 Ga0105246_10097824 3300011119 Bacteria 2130
349 Ga0105246_10407037 3300011119 Bacteria 1131
350 Ga0105246_10460489 3300011119 Bacteria 1071
351 Ga0105246_11484732 3300011119 Bacteria 636
352 Ga0157374_10185124 3300013296 Bacteria 2036
353 Ga0157374_10230153 3300013296 Bacteria 1820
354 Ga0157378_10005313 3300013297 Bacteria 11311
355 Ga0157378_10096515 3300013297 Bacteria 2694
356 Ga0157378_10104812 3300013297 Bacteria 2585
357 Ga0157378_10580311 3300013297 Bacteria 1130
358 Ga0157378_11212784 3300013297 Bacteria 794
359 Ga0157378_11809081 3300013297 Bacteria 659
360 Ga0157378_12383084 3300013297 Unclassified 581
361 Ga0157378_12625338 3300013297 Unclassified 556
362 Ga0163162_10004310 3300013306 Bacteria 13699
363 Ga0163162_10048474 3300013306 Bacteria 4257
364 Ga0163162_10183257 3300013306 Bacteria 2220
365 Ga0163162_13148521 3300013306 Unclassified 530
366 Ga0157372_10442065 3300013307 Bacteria 1516
367 Ga0157372_10857230 3300013307 Bacteria 1054
368 Ga0157372_11585386 3300013307 Bacteria 754
369 Ga0157375_10039063 3300013308 Bacteria 4564
370 Ga0157375_10652002 3300013308 Bacteria 1209
371 Ga0157375_11759679 3300013308 Bacteria 734
372 Ga0157375_11931108 3300013308 Bacteria 701
373 Ga0157375_11982096 3300013308 Unclassified 692
374 Ga0157375_13167087 3300013308 Unclassified 549
375 Ga0157375_13725902 3300013308 Unclassified 507
376 Ga0163163_10000686 3300014325 Bacteria 28785
377 Ga0163163_10006591 3300014325 Bacteria 10167
378 Ga0163163_10087519 3300014325 Bacteria 3125
379 Ga0163163_10276462 3300014325 Bacteria 1730
380 Ga0163163_10346477 3300014325 Bacteria 1541
381 Ga0163163_11071424 3300014325 Bacteria 869
382 Ga0157380_10005993 3300014326 Bacteria 8506
383 Ga0157380_10222812 3300014326 Bacteria 1688
384 Ga0157380_10342284 3300014326 Bacteria 1395
385 Ga0157377_10417485 3300014745 Bacteria 918
386 Ga0157377_10592069 3300014745 Bacteria 790
387 Ga0157379_10680066 3300014968 Bacteria 965
388 Ga0157376_10052777 3300014969 Bacteria 3382
389 Ga0157376_10087655 3300014969 Bacteria 2687
390 Ga0157376_11568763 3300014969 Bacteria 692
391 Ga0182007_10039627 3300015262 Bacteria 1576
392 Ga0163161_10120493 3300017792 Bacteria 1971
393 Ga0163161_11224925 3300017792 Bacteria 650
394 Ga0207697_10003076 3300025315 Bacteria 8361
395 Ga0207653_10000015 3300025885 Bacteria 150553
396 Ga0207653_10077805 3300025885 Bacteria 1143
397 Ga0207642_10010798 3300025899 Bacteria 3235
398 Ga0207642_10498691 3300025899 Unclassified 745
399 Ga0207688_10224562 3300025901 Bacteria 1132
400 Ga0207688_10886782 3300025901 Bacteria 565
401 Ga0207680_10100429 3300025903 Bacteria 1858
402 Ga0207680_10223865 3300025903 Bacteria 1291
403 Ga0207647_10300230 3300025904 Bacteria 915
404 Ga0207699_10000017 3300025906 Bacteria 189613
405 Ga0207645_10120826 3300025907 Bacteria 1700
406 Ga0207645_10223645 3300025907 Bacteria 1241
407 Ga0207643_10025610 3300025908 Bacteria 3261
408 Ga0207643_10101923 3300025908 Bacteria 1684
409 Ga0207684_10000138 3300025910 Bacteria 132416
410 Ga0207684_10048380 3300025910 Bacteria 3607
411 Ga0207684_10540256 3300025910 Bacteria 997
412 Ga0207684_10684955 3300025910 Bacteria 872
413 Ga0207654_10189127 3300025911 Bacteria 1348
414 Ga0207654_10451899 3300025911 Bacteria 901
415 Ga0207654_10467177 3300025911 Bacteria 887
416 Ga0207654_10886248 3300025911 Bacteria 647
417 Ga0207707_10000016 3300025912 Bacteria 256002
418 Ga0207707_10889691 3300025912 Unclassified 737
419 Ga0207671_11193491 3300025914 Bacteria 595
420 Ga0207693_10147960 3300025915 Bacteria 1847
421 Ga0207660_11219565 3300025917 Bacteria 612
422 Ga0207662_10060730 3300025918 Bacteria 2268
423 Ga0207662_10067207 3300025918 Bacteria 2161
424 Ga0207662_10174438 3300025918 Bacteria 1380
425 Ga0207662_10191982 3300025918 Unclassified 1318
426 Ga0207652_10002213 3300025921 Bacteria 16596
427 Ga0207652_10131931 3300025921 Bacteria 2229
428 Ga0207646_10052128 3300025922 Bacteria 3661
429 Ga0207646_10098442 3300025922 Bacteria 2621
430 Ga0207646_10162336 3300025922 Bacteria 2016
431 Ga0207646_10401509 3300025922 Bacteria 1238
432 Ga0207646_10486195 3300025922 Bacteria 1113
433 Ga0207646_10549804 3300025922 Bacteria 1038
434 Ga0207646_10740746 3300025922 Unclassified 877
435 Ga0207646_11436207 3300025922 Unclassified 599
436 Ga0207681_10133227 3300025923 Bacteria 1840
437 Ga0207681_10646081 3300025923 Bacteria 877
438 Ga0207681_11804503 3300025923 Unclassified 510
439 Ga0207694_10004103 3300025924 Bacteria 11452
440 Ga0207694_10046453 3300025924 Bacteria 3356
441 Ga0207650_10121873 3300025925 Bacteria 2031
442 Ga0207650_10142510 3300025925 Bacteria 1885
443 Ga0207659_10952033 3300025926 Bacteria 738
444 Ga0207687_10048828 3300025927 Bacteria 2941
445 Ga0207687_10404817 3300025927 Bacteria 1123
446 Ga0207687_10971152 3300025927 Bacteria 728
447 Ga0207687_11813837 3300025927 Unclassified 522
448 Ga0207700_10224871 3300025928 Bacteria 1593
449 Ga0207644_10001651 3300025931 Bacteria 14383
450 Ga0207644_10158304 3300025931 Bacteria 1758
451 Ga0207644_10335835 3300025931 Bacteria 1224
452 Ga0207644_11219836 3300025931 Unclassified 632
453 Ga0207706_10264905 3300025933 Bacteria 1500
454 Ga0207706_10674707 3300025933 Bacteria 884
455 Ga0207706_10773178 3300025933 Unclassified 817
456 Ga0207686_10000236 3300025934 Bacteria 42150
457 Ga0207686_10008251 3300025934 Bacteria 5619
458 Ga0207686_10101168 3300025934 Bacteria 1925
459 Ga0207686_10197766 3300025934 Bacteria 1438
460 Ga0207686_10256751 3300025934 Bacteria 1279
461 Ga0207709_10002142 3300025935 Bacteria 12651
462 Ga0207709_10016742 3300025935 Bacteria 4081
463 Ga0207709_10262147 3300025935 Bacteria 1268
464 Ga0207709_10828072 3300025935 Bacteria 749
465 Ga0207670_10003722 3300025936 Bacteria 8096
466 Ga0207670_10337024 3300025936 Bacteria 1191
467 Ga0207665_10018177 3300025939 Bacteria 4620
468 Ga0207691_10012123 3300025940 Bacteria 8264
469 Ga0207691_10103448 3300025940 Bacteria 2539
470 Ga0207691_10297873 3300025940 Bacteria 1386
471 Ga0207691_10619793 3300025940 Bacteria 915
472 Ga0207711_10038977 3300025941 Bacteria 4040
473 Ga0207711_10087088 3300025941 Bacteria 2739
474 Ga0207711_10114513 3300025941 Bacteria 2401
475 Ga0207711_10441743 3300025941 Bacteria 1211
476 Ga0207689_10015151 3300025942 Bacteria 6534
477 Ga0207689_10139323 3300025942 Bacteria 1998
478 Ga0207689_10335568 3300025942 Bacteria 1255
479 Ga0207689_10354631 3300025942 Unclassified 1220
480 Ga0207689_11316601 3300025942 Unclassified 607
481 Ga0207679_10094662 3300025945 Bacteria 2320
482 Ga0207679_10374551 3300025945 Bacteria 1247
483 Ga0207679_10550666 3300025945 Bacteria 1035
484 Ga0207679_11180824 3300025945 Bacteria 702
485 Ga0207651_10054777 3300025960 Bacteria 2735
486 Ga0207651_10690624 3300025960 Bacteria 898
487 Ga0207712_10004600 3300025961 Bacteria 8716
488 Ga0207712_10253879 3300025961 Bacteria 1423
489 Ga0207712_10993943 3300025961 Bacteria 744
490 Ga0207668_10367141 3300025972 Bacteria 1208
491 Ga0207640_10070188 3300025981 Bacteria 2355
492 Ga0207640_10265280 3300025981 Bacteria 1340
493 Ga0207640_11040831 3300025981 Unclassified 722
494 Ga0207658_10259629 3300025986 Bacteria 1480
495 Ga0207677_10026416 3300026023 Bacteria 3640
496 Ga0207703_10016983 3300026035 Bacteria 5676
497 Ga0207703_10070778 3300026035 Bacteria 2879
498 Ga0207703_10409182 3300026035 Bacteria 1260
499 Ga0207639_10062136 3300026041 Bacteria 2886
500 Ga0207639_10070140 3300026041 Bacteria 2737
501 Ga0207639_10326232 3300026041 Bacteria 1364
502 Ga0207639_12188648 3300026041 Unclassified 514
503 Ga0207708_10193922 3300026075 Bacteria 1618
504 Ga0207708_10485803 3300026075 Bacteria 1033
505 Ga0207708_10513986 3300026075 Bacteria 1005
506 Ga0207702_10019467 3300026078 Bacteria 5616
507 Ga0207641_10549369 3300026088 Bacteria 1126
508 Ga0207641_10711718 3300026088 Bacteria 989
509 Ga0207641_11541589 3300026088 Bacteria 666
510 Ga0207648_10007949 3300026089 Bacteria 10345
511 Ga0207648_10115922 3300026089 Bacteria 2354
512 Ga0207648_10160125 3300026089 Bacteria 1988
513 Ga0207648_10198027 3300026089 Bacteria 1781
514 Ga0207648_10260252 3300026089 Bacteria 1548
515 Ga0207648_10499592 3300026089 Bacteria 1113
516 Ga0207648_11186126 3300026089 Bacteria 717
517 Ga0207676_10005624 3300026095 Bacteria 8871
518 Ga0207676_10028298 3300026095 Bacteria 4184
519 Ga0207676_10263034 3300026095 Bacteria 1558
520 Ga0207676_10337235 3300026095 Bacteria 1389
521 Ga0207676_10346543 3300026095 Bacteria 1372
522 Ga0207676_11030558 3300026095 Unclassified 812
523 Ga0207676_11350312 3300026095 Bacteria 708
524 Ga0207674_10085210 3300026116 Bacteria 3156
525 Ga0207674_10193767 3300026116 Bacteria 1982
526 Ga0207674_10258950 3300026116 Bacteria 1687
527 Ga0207675_100011415 3300026118 Bacteria 8312
528 Ga0207675_100048252 3300026118 Bacteria 3975
529 Ga0207675_100190477 3300026118 Bacteria 1967
530 Ga0207675_100211993 3300026118 Bacteria 1863
531 Ga0207675_100580884 3300026118 Bacteria 1122
532 Ga0207675_100600069 3300026118 Bacteria 1104
533 Ga0207675_100625235 3300026118 Bacteria 1081
534 Ga0207675_100640024 3300026118 Unclassified 1069
535 Ga0207675_101541603 3300026118 Bacteria 685
536 Ga0207675_102365277 3300026118 Bacteria 544
537 Ga0207683_10081929 3300026121 Bacteria 2865
538 Ga0207683_10961848 3300026121 Bacteria 793
539 Ga0207698_10183451 3300026142 Bacteria 1856
540 Ga0207698_10724209 3300026142 Bacteria 992
541 Ga0207698_10897982 3300026142 Bacteria 893
542 Ga0207698_11519669 3300026142 Bacteria 685
543 Ga0207428_10003452 3300027907 Bacteria 15343
544 Ga0207428_10045450 3300027907 Bacteria 3536
545 Ga0268266_10903092 3300028379 Unclassified 854
546 Ga0268265_10052668 3300028380 Bacteria 3079
547 Ga0268265_10219419 3300028380 Bacteria 1663
548 Ga0268265_11119847 3300028380 Bacteria 782
549 Ga0268265_11864247 3300028380 Bacteria 608
550 Ga0268264_10013194 3300028381 Bacteria 6799
551 Ga0268264_10035201 3300028381 Bacteria 4122
552 Ga0268264_10096698 3300028381 Bacteria 2558
553 Ga0268264_10141767 3300028381 Bacteria 2144
554 Ga0268264_10168422 3300028381 Bacteria 1979
555 Ga0268264_10420999 3300028381 Bacteria 1288
556 Ga0307513_10667720 3300031456 Unclassified 746
557 Ga0307410_10204484 3300031852 Bacteria 1510
558 Ga0307410_10352300 3300031852 Bacteria 1177
559 Ga0307410_11629981 3300031852 Bacteria 571
560 Ga0307412_10021597 3300031911 Bacteria 3935
561 Ga0307412_10698635 3300031911 Bacteria 870
562 Ga0307416_100001814 3300032002 Bacteria 11867
563 Ga0307416_100301068 3300032002 Bacteria 1594
564 Ga0307416_100876020 3300032002 Bacteria 997
565 Ga0307414_10001545 3300032004 Bacteria 11955
566 Ga0307411_10079896 3300032005 Bacteria 2247
567 Ga0307411_10110133 3300032005 Bacteria 1968
568 Ga0307415_100003242 3300032126 Bacteria 8257
569 Ga0307415_100151830 3300032126 Bacteria 1784
570 Ga0373940_0150203 3300035088 Bacteria 742
571 Ga0373949_0025290 3300035090 Bacteria 1385
572 Ga0373949_0108077 3300035090 Bacteria 769
573 Ga0373941_0006947 3300035115 Bacteria 2749
574 Ga0373931_0093702 3300035691 Bacteria 1678
575 Ga0373931_0666176 3300035691 Bacteria 685
576 Ga0395900_1248122 3300037418 Bacteria 658
577 Ga0395898_0059894 3300037466 Bacteria 3702
578 Ga0395901_0268121 3300038443 Bacteria 1776
579 Ga0242422_01620 3300038699 Bacteria 1553
580 Ga0242420_001768 3300038996 Bacteria 2965
581 Ga0436365_0414010 3300039437 Unclassified 869
582 Ga0436362_0761155 3300039453 Unclassified 715
583 Ga0439439_0084193 3300041406 Bacteria 863
584 Ga0439455_0008046 3300042012 Bacteria 2250
585 Ga0439459_0062355 3300042438 Bacteria 845
586 Ga0453684_2145309 3300044712 Unclassified 559
587 Ga0451576_0647620 3300045051 Bacteria 1110
588 Ga0451576_0650274 3300045051 Bacteria 1108
589 Ga0451576_1260559 3300045051 Bacteria 771
590 Ga0495669_0315673 3300046684 Bacteria 754
591 Ga0496102_0030736 3300048905 Bacteria 4809
592 Ga0496103_0020529 3300048906 Bacteria 3969
593 Ga0496104_0170309 3300048907 Bacteria 2088
594 Ga0496106_0193591 3300048909 Bacteria 1617
595 Ga0496107_0090857 3300048910 Bacteria 2231
596 Ga0496107_1262338 3300048910 Bacteria 529
597 Ga0496108_0199464 3300048911 Bacteria 1736
598 Ga0496108_0594672 3300048911 Bacteria 964
599 Ga0496108_1747193 3300048911 Bacteria 511
600 Ga0496109_0309269 3300048912 Bacteria 1491
601 Ga0496109_0520659 3300048912 Bacteria 1122
602 Ga0496109_0850829 3300048912 Bacteria 850
603 Ga0496110_0172130 3300048913 Unclassified 1965
604 Ga0496110_1081817 3300048913 Unclassified 710
605 Ga0496110_1922293 3300048913 Bacteria 502
606 Ga0496111_0815467 3300048914 Bacteria 675
607 Ga0496112_1196971 3300048915 Bacteria 677
608 Ga0496112_1593250 3300048915 Bacteria 566
609 Ga0496113_0461386 3300048916 Bacteria 1021
610 Ga0496113_1111003 3300048916 Bacteria 620
611 Ga0496113_1555203 3300048916 Bacteria 510
612 Ga0496114_0989335 3300048917 Bacteria 724
613 Ga0501296_041470 3300049519 Bacteria 650
614 Ga0501298_004180 3300049521 Bacteria 2265
615 Ga0501299_004077 3300049522 Bacteria 2160
616 Ga0501300_003680 3300049523 Bacteria 2282
617 Ga0501303_016099 3300049526 Bacteria 754
618 Ga0501206_076056 3300049653 Bacteria 576
619 Ga0501217_002790 3300049661 Bacteria 3478
620 Ga0501223_014303 3300049663 Bacteria 1574
621 Ga0501223_050149 3300049663 Unclassified 810
622 Ga0501223_129169 3300049663 Unclassified 538
623 Ga0501227_004037 3300049665 Bacteria 3160
624 Ga0501227_020658 3300049665 Bacteria 1513
625 Ga0501233_000680 3300049668 Bacteria 5598
626 Ga0501235_006355 3300049669 Bacteria 2572
627 Ga0501235_014602 3300049669 Bacteria 1730
628 Ga0501239_007147 3300049672 Bacteria 1163
629 Ga0501243_030695 3300049675 Bacteria 916
630 Ga0501251_012059 3300049681 Bacteria 1039
631 Ga0501252_014927 3300049682 Bacteria 965
632 Ga0501253_001697 3300049683 Bacteria 2314
633 Ga0501253_007813 3300049683 Bacteria 1511
634 Ga0501255_011119 3300049684 Bacteria 1031
635 Ga0501257_013123 3300049686 Bacteria 1898
636 Ga0501259_001014 3300049688 Bacteria 4670
637 Ga0501259_069303 3300049688 Unclassified 753
638 Ga0501261_002506 3300049690 Bacteria 2250
639 Ga0501261_020060 3300049690 Bacteria 953
640 Ga0501225_0030340 3300049705 Bacteria 1487
641 Ga0501234_000197 3300049707 Bacteria 8540
642 Ga0501234_004035 3300049707 Bacteria 2305
643 Ga0501268_004877 3300049765 Bacteria 1907
644 Ga0501271_020143 3300049768 Bacteria 770
645 Ga0501273_016694 3300049770 Bacteria 964
646 Ga0501274_017491 3300049771 Bacteria 719
647 Ga0501280_022978 3300049776 Bacteria 939
648 Ga0501283_012533 3300049779 Bacteria 1275
649 Ga0501212_006528 3300049851 Bacteria 1575
650 nmdc:mga05p37_1027260_c1 3300050507 Bacteria 872
651 nmdc:mga05p37_385355_c1 3300050507 Bacteria 1641
652 nmdc:mga05p37_753570_c1 3300050507 Bacteria 1073
653 nmdc:mga05p37_853769_c1 3300050507 Bacteria 988
654 nmdc:mga05p37_86616_c1 3300050507 Bacteria 3861
655 nmdc:mga05p37_973759_c1 3300050507 Bacteria 905
656 nmdc:mga09592_1360130_c1 3300050508 Unclassified 582
657 nmdc:mga09592_349629_c1 3300050508 Bacteria 1279
658 nmdc:mga09592_496770_c1 3300050508 Bacteria 1051
659 nmdc:mga0qj67_211122_c1 3300050509 Bacteria 1577
660 nmdc:mga06r32_251209_c1 3300050510 Bacteria 1756
661 nmdc:mga06r32_818286_c1 3300050510 Bacteria 891
662 nmdc:mga08y16_10234_c1 3300050511 Bacteria 9843
663 nmdc:mga08y16_87625_c1 3300050511 Bacteria 3244
664 nmdc:mga0n895_1194404_c1 3300050512 Unclassified 735
665 nmdc:mga0n895_183748_c1 3300050512 Bacteria 2122
666 nmdc:mga0n895_644435_c1 3300050512 Unclassified 1059
667 nmdc:mga0rr50_174815_c1 3300050513 Bacteria 1752
668 nmdc:mga0rr50_46_c1 3300050513 Bacteria 74452
669 nmdc:mga0rr50_521418_c1 3300050513 Bacteria 1011
670 nmdc:mga08x19_132712_c1 3300050514 Bacteria 1676
671 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
672 nmdc:mga0a205_100626_c1 3300050515 Bacteria 2789
673 nmdc:mga0a205_266786_c1 3300050515 Bacteria 1589
674 nmdc:mga0a205_417433_c1 3300050515 Bacteria 1204
675 nmdc:mga0a205_71606_c1 3300050515 Bacteria 3348
676 nmdc:mga0a205_75977_c1 3300050515 Bacteria 3246
677 Ga0530510_0334508 3300061734 Bacteria 1136
678 Ga0163163_10329969
679 MRS1b_contig_387228
680 CNAas_1001193
681 rootL2_10018895
682 Ga0065714_10064422
683 Ga0065704_10087453
684 Ga0065712_10005811
685 Ga0065712_10067728
686 Ga0065715_10001035
687 Ga0065715_10017757
688 Ga0065715_10089178
689 Ga0065715_10104815
690 Ga0065715_10147699
691 Ga0065715_10381529
692 Ga0065707_10001162
693 Ga0065707_10100764
694 Ga0065707_10305069
695 Ga0065707_10370192
696 Ga0070676_10099276
697 Ga0070690_100024044
698 Ga0070690_100184047
699 Ga0070670_100211497
700 Ga0068869_100003088
701 Ga0068869_100201555
702 Ga0068869_101603832
703 Ga0070666_10075043
704 Ga0070666_10077653
705 Ga0070682_100063495
706 Ga0070682_100523424
707 Ga0070682_100897049
708 Ga0068868_100120648
709 Ga0068868_100941500
710 Ga0068868_101529197
711 Ga0070689_100042748
712 Ga0070689_100319146
713 Ga0070689_100548418
714 Ga0070689_102038311
715 Ga0070687_100603229
716 Ga0070687_100672115
717 Ga0070687_100734576
718 Ga0070661_100927675
719 Ga0070668_100525383
720 Ga0070675_100048186
721 Ga0070675_100071606
722 Ga0070675_100543904
723 Ga0070675_101159265
724 Ga0070671_100281350
725 Ga0070671_100340637
726 Ga0070671_100346801
727 Ga0070671_101863307
728 Ga0070674_100613152
729 Ga0070673_100004810
730 Ga0070673_100060566
731 Ga0070673_100422067
732 Ga0070673_100959072
733 Ga0070688_100014268
734 Ga0070688_100409563
735 Ga0070659_100994593
736 Ga0070667_100017988
737 Ga0070703_10000034
738 Ga0070713_100235660
739 Ga0070701_10105611
740 Ga0070701_10365375
741 Ga0070705_100000814
742 Ga0070705_100081439
743 Ga0070705_100121867
744 Ga0070705_100170123
745 Ga0070705_100205856
746 Ga0070705_100251102
747 Ga0070705_100518322
748 Ga0070700_100146484
749 Ga0070694_100163889
750 Ga0070694_100174605
751 Ga0070694_100201804
752 Ga0070694_100227073
753 Ga0070694_100435113
754 Ga0070694_100575174
755 Ga0070694_101303591
756 Ga0070708_100241205
757 Ga0070708_100403597
758 Ga0070708_101233635
759 Ga0070678_100012035
760 Ga0070678_100199046
761 Ga0070662_100148224
762 Ga0070681_10000700
763 Ga0070681_10010507
764 Ga0068867_100008010
765 Ga0068867_100076113
766 Ga0068867_100128729
767 Ga0068867_100403724
768 Ga0068867_100439528
769 Ga0068867_100472133
770 Ga0070685_10005003
771 Ga0070685_10324979
772 Ga0070706_100000061
773 Ga0070706_100045716
774 Ga0070706_100202517
775 Ga0070706_100540599
776 Ga0070706_100677690
777 Ga0070706_100907766
778 Ga0070707_100331788
779 Ga0070707_100336771
780 Ga0070698_100005684
781 Ga0070698_100061507
782 Ga0070698_100148595
783 Ga0070698_100203334
784 Ga0070698_100261779
785 Ga0070698_100283486
786 Ga0070699_100000034
787 Ga0070699_100181174
788 Ga0070699_100455107
789 Ga0070699_100749672
790 Ga0070699_101507209
791 Ga0070679_100000642
792 Ga0070679_100236813
793 Ga0070679_101599184
794 Ga0070697_100279544
795 Ga0070697_100386422
796 Ga0070697_100562240
797 Ga0070697_100726475
798 Ga0070697_101366816
799 Ga0068853_100282672
800 Ga0068853_100911838
801 Ga0068853_102468203
802 Ga0070672_100005452
803 Ga0070672_100167986
804 Ga0070686_100483456
805 Ga0070686_100662520
806 Ga0070695_100015790
807 Ga0070695_100058765
808 Ga0070695_100126135
809 Ga0070695_100224466
810 Ga0070695_100324320
811 Ga0070695_100481177
812 Ga0070695_100635114
813 Ga0070695_100930280
814 Ga0070696_100000032
815 Ga0070696_100012636
816 Ga0070696_100204613
817 Ga0070696_100446134
818 Ga0070696_100501285
819 Ga0070696_100532855
820 Ga0070696_100662821
821 Ga0070693_100012867
822 Ga0070693_100030282
823 Ga0070693_100107545
824 Ga0070693_100230264
825 Ga0070693_100607738
826 Ga0070693_101096511
827 Ga0070665_100102031
828 Ga0070665_101994405
829 Ga0070704_100118033
830 Ga0070704_100185238
831 Ga0070704_100843192
832 Ga0070664_100204071
833 Ga0070664_100487184
834 Ga0070664_100907378
835 Ga0070664_101404867
836 Ga0068857_100065113
837 Ga0068857_100417794
838 Ga0068857_100437686
839 Ga0068857_100847530
840 Ga0068857_100939433
841 Ga0068857_102204908
842 Ga0068854_100031756
843 Ga0068854_100159000
844 Ga0068854_100261723
845 Ga0068854_100315607
846 Ga0068854_100570060
847 Ga0068854_101253880
848 Ga0068856_100018249
849 Ga0070702_100007385
850 Ga0070702_100126600
851 Ga0070702_100198819
852 Ga0070702_100257473
853 Ga0070702_100273761
854 Ga0070702_100660868
855 Ga0068852_100235251
856 Ga0068852_100287657
857 Ga0068859_100021635
858 Ga0068859_100129088
859 Ga0068859_100171699
860 Ga0068859_100299357
861 Ga0068859_100309194
862 Ga0068859_100391939
863 Ga0068859_100420631
864 Ga0068859_100750835
865 Ga0068859_101639726
866 Ga0068859_101655970
867 Ga0068859_101696500
868 Ga0068859_102925499
869 Ga0068864_100008432
870 Ga0068864_100069260
871 Ga0068864_100313920
872 Ga0068864_100371293
873 Ga0068864_100520631
874 Ga0068866_10005919
875 Ga0068861_100155248
876 Ga0068861_100206413
877 Ga0068861_100207166
878 Ga0068861_100279928
879 Ga0068861_100295012
880 Ga0068861_100932847
881 Ga0068861_101652539
882 Ga0068870_10021351
883 Ga0068870_10101306
884 Ga0068870_10161139
885 Ga0068870_10408771
886 Ga0068870_10510774
887 Ga0068863_100042837
888 Ga0068863_100118365
889 Ga0068863_100243863
890 Ga0068863_100526782
891 Ga0068863_100677434
892 Ga0068858_100039997
893 Ga0068858_100051756
894 Ga0068858_100212587
895 Ga0068858_100330802
896 Ga0068858_100445976
897 Ga0068858_100512334
898 Ga0068858_100976306
899 Ga0068860_100036723
900 Ga0068860_100064245
901 Ga0068860_100066548
902 Ga0068860_100125495
903 Ga0068860_100490268
904 Ga0068860_100845948
905 Ga0068860_101147769
906 Ga0068862_100012647
907 Ga0068862_100709988
908 Ga0068862_101122692
909 Ga0068862_101400111
910 Ga0081539_10000586
911 Ga0070715_10497458
912 Ga0070715_10743395
913 Ga0070715_10837208
914 Ga0070716_100861090
915 Ga0070712_100083913
916 Ga0097621_100007358
917 Ga0097621_100072216
918 Ga0097621_100096570
919 Ga0097621_100459694
920 Ga0068871_100009507
921 Ga0068871_100030390
922 Ga0068871_100122566
923 Ga0068871_100325484
924 Ga0068871_100450143
925 Ga0068871_101963331
926 Ga0075428_100001759
927 Ga0075428_100129421
928 Ga0075430_100005700
929 Ga0075431_100176561
930 Ga0075433_10043559
931 Ga0075433_10070561
932 Ga0075433_10078106
933 Ga0075433_10156268
934 Ga0075433_10557201
935 Ga0075433_11281053
936 Ga0075434_100104571
937 Ga0075434_101595044
938 Ga0075434_101733107
939 Ga0075434_102392736
940 Ga0075429_100096403
941 Ga0075429_101515248
942 Ga0068865_100056231
943 Ga0068865_100585302
944 Ga0075436_100018923
945 Ga0097620_100021635
946 Ga0097620_100129081
947 Ga0097620_100171692
948 Ga0097620_100299346
949 Ga0097620_100309202
950 Ga0097620_100391906
951 Ga0097620_100420660
952 Ga0097620_100750832
953 Ga0097620_101639457
954 Ga0097620_101656164
955 Ga0097620_101696270
956 Ga0097620_102925289
957 Ga0075435_100000584
958 Ga0075435_100211133
959 Ga0075435_100408898
960 Ga0075435_100627644
961 Ga0099794_10605151
962 Ga0105251_10133269
963 Ga0105251_10169548
964 Ga0105251_10320270
965 Ga0105244_10407938
966 Ga0105250_10178152
967 Ga0111539_10006030
968 Ga0111539_10015623
969 Ga0111539_11394327
970 Ga0105245_10011560
971 Ga0105245_10315299
972 Ga0105245_10419075
973 Ga0105245_10578861
974 Ga0105245_10741222
975 Ga0105247_10239353
976 Ga0114129_10006197
977 Ga0114129_10011602
978 Ga0114129_10059296
979 Ga0114129_10284114
980 Ga0114129_10631262
981 Ga0114129_10811011
982 Ga0114129_11037160
983 Ga0114129_11134149
984 Ga0114129_11551647
985 Ga0105243_10008067
986 Ga0105243_10022573
987 Ga0105243_10476600
988 Ga0105243_10478062
989 Ga0105243_10568032
990 Ga0105241_10117322
991 Ga0105241_10124896
992 Ga0105241_10145935
993 Ga0105241_10485095
994 Ga0105241_10929721
995 Ga0105241_11186699
996 Ga0105241_11332903
997 Ga0105241_11946821
998 Ga0105241_12351808
999 Ga0105241_12636896
1000 Ga0105242_10003451
1001 Ga0105242_10035538
1002 Ga0105242_10105543
1003 Ga0105242_10179021
1004 Ga0105242_12814139
1005 Ga0105248_10003128
1006 Ga0105248_10019796
1007 Ga0105248_10038024
1008 Ga0105248_10611799
1009 Ga0105248_11338791
1010 Ga0105248_11496524
1011 Ga0105248_12775276
1012 Ga0105237_10143148
1013 Ga0105237_10225858
1014 Ga0105237_10696254
1015 Ga0105238_10015857
1016 Ga0105238_10046310
1017 Ga0105249_10021667
1018 Ga0105249_10269656
1019 Ga0105249_10610009
1020 Ga0105249_10977976
1021 Ga0105239_10048878
1022 Ga0105239_10104419
1023 Ga0105239_10133046
1024 Ga0105239_11593699
1025 Ga0105246_10097824
1026 Ga0105246_10407037
1027 Ga0105246_10460489
1028 Ga0105246_11484732
1029 Ga0157374_10185124
1030 Ga0157374_10230153
1031 Ga0157378_10005313
1032 Ga0157378_10096515
1033 Ga0157378_10104812
1034 Ga0157378_10580311
1035 Ga0157378_11212784
1036 Ga0157378_11809081
1037 Ga0157378_12383084
1038 Ga0157378_12625338
1039 Ga0163162_10004310
1040 Ga0163162_10048474
1041 Ga0163162_10183257
1042 Ga0163162_13148521
1043 Ga0157372_10442065
1044 Ga0157372_10857230
1045 Ga0157372_11585386
1046 Ga0157375_10039063
1047 Ga0157375_10652002
1048 Ga0157375_11759679
1049 Ga0157375_11931108
1050 Ga0157375_11982096
1051 Ga0157375_13167087
1052 Ga0157375_13725902
1053 Ga0163163_10000686
1054 Ga0163163_10006591
1055 Ga0163163_10087519
1056 Ga0163163_10276462
1057 Ga0163163_10346477
1058 Ga0163163_11071424
1059 Ga0157380_10005993
1060 Ga0157380_10222812
1061 Ga0157380_10342284
1062 Ga0157377_10417485
1063 Ga0157377_10592069
1064 Ga0157379_10680066
1065 Ga0157376_10052777
1066 Ga0157376_10087655
1067 Ga0157376_11568763
1068 Ga0182007_10039627
1069 Ga0163161_10120493
1070 Ga0163161_11224925
1071 Ga0207697_10003076
1072 Ga0207653_10000015
1073 Ga0207653_10077805
1074 Ga0207642_10010798
1075 Ga0207642_10498691
1076 Ga0207688_10224562
1077 Ga0207688_10886782
1078 Ga0207680_10100429
1079 Ga0207680_10223865
1080 Ga0207647_10300230
1081 Ga0207699_10000017
1082 Ga0207645_10120826
1083 Ga0207645_10223645
1084 Ga0207643_10025610
1085 Ga0207643_10101923
1086 Ga0207684_10000138
1087 Ga0207684_10048380
1088 Ga0207684_10540256
1089 Ga0207684_10684955
1090 Ga0207654_10189127
1091 Ga0207654_10451899
1092 Ga0207654_10467177
1093 Ga0207654_10886248
1094 Ga0207707_10000016
1095 Ga0207707_10889691
1096 Ga0207671_11193491
1097 Ga0207693_10147960
1098 Ga0207660_11219565
1099 Ga0207662_10060730
1100 Ga0207662_10067207
1101 Ga0207662_10174438
1102 Ga0207662_10191982
1103 Ga0207652_10002213
1104 Ga0207652_10131931
1105 Ga0207646_10052128
1106 Ga0207646_10098442
1107 Ga0207646_10162336
1108 Ga0207646_10401509
1109 Ga0207646_10486195
1110 Ga0207646_10549804
1111 Ga0207646_10740746
1112 Ga0207646_11436207
1113 Ga0207681_10133227
1114 Ga0207681_10646081
1115 Ga0207681_11804503
1116 Ga0207694_10004103
1117 Ga0207694_10046453
1118 Ga0207650_10121873
1119 Ga0207650_10142510
1120 Ga0207659_10952033
1121 Ga0207687_10048828
1122 Ga0207687_10404817
1123 Ga0207687_10971152
1124 Ga0207687_11813837
1125 Ga0207700_10224871
1126 Ga0207644_10001651
1127 Ga0207644_10158304
1128 Ga0207644_10335835
1129 Ga0207644_11219836
1130 Ga0207706_10264905
1131 Ga0207706_10674707
1132 Ga0207706_10773178
1133 Ga0207686_10000236
1134 Ga0207686_10008251
1135 Ga0207686_10101168
1136 Ga0207686_10197766
1137 Ga0207686_10256751
1138 Ga0207709_10002142
1139 Ga0207709_10016742
1140 Ga0207709_10262147
1141 Ga0207709_10828072
1142 Ga0207670_10003722
1143 Ga0207670_10337024
1144 Ga0207665_10018177
1145 Ga0207691_10012123
1146 Ga0207691_10103448
1147 Ga0207691_10297873
1148 Ga0207691_10619793
1149 Ga0207711_10038977
1150 Ga0207711_10087088
1151 Ga0207711_10114513
1152 Ga0207711_10441743
1153 Ga0207689_10015151
1154 Ga0207689_10139323
1155 Ga0207689_10335568
1156 Ga0207689_10354631
1157 Ga0207689_11316601
1158 Ga0207679_10094662
1159 Ga0207679_10374551
1160 Ga0207679_10550666
1161 Ga0207679_11180824
1162 Ga0207651_10054777
1163 Ga0207651_10690624
1164 Ga0207712_10004600
1165 Ga0207712_10253879
1166 Ga0207712_10993943
1167 Ga0207668_10367141
1168 Ga0207640_10070188
1169 Ga0207640_10265280
1170 Ga0207640_11040831
1171 Ga0207658_10259629
1172 Ga0207677_10026416
1173 Ga0207703_10016983
1174 Ga0207703_10070778
1175 Ga0207703_10409182
1176 Ga0207639_10062136
1177 Ga0207639_10070140
1178 Ga0207639_10326232
1179 Ga0207639_12188648
1180 Ga0207708_10193922
1181 Ga0207708_10485803
1182 Ga0207708_10513986
1183 Ga0207702_10019467
1184 Ga0207641_10549369
1185 Ga0207641_10711718
1186 Ga0207641_11541589
1187 Ga0207648_10007949
1188 Ga0207648_10115922
1189 Ga0207648_10160125
1190 Ga0207648_10198027
1191 Ga0207648_10260252
1192 Ga0207648_10499592
1193 Ga0207648_11186126
1194 Ga0207676_10005624
1195 Ga0207676_10028298
1196 Ga0207676_10263034
1197 Ga0207676_10337235
1198 Ga0207676_10346543
1199 Ga0207676_11030558
1200 Ga0207676_11350312
1201 Ga0207674_10085210
1202 Ga0207674_10193767
1203 Ga0207674_10258950
1204 Ga0207675_100011415
1205 Ga0207675_100048252
1206 Ga0207675_100190477
1207 Ga0207675_100211993
1208 Ga0207675_100580884
1209 Ga0207675_100600069
1210 Ga0207675_100625235
1211 Ga0207675_100640024
1212 Ga0207675_101541603
1213 Ga0207675_102365277
1214 Ga0207683_10081929
1215 Ga0207683_10961848
1216 Ga0207698_10183451
1217 Ga0207698_10724209
1218 Ga0207698_10897982
1219 Ga0207698_11519669
1220 Ga0207428_10003452
1221 Ga0207428_10045450
1222 Ga0268266_10903092
1223 Ga0268265_10052668
1224 Ga0268265_10219419
1225 Ga0268265_11119847
1226 Ga0268265_11864247
1227 Ga0268264_10013194
1228 Ga0268264_10035201
1229 Ga0268264_10096698
1230 Ga0268264_10141767
1231 Ga0268264_10168422
1232 Ga0268264_10420999
1233 Ga0307513_10667720
1234 Ga0307410_10204484
1235 Ga0307410_10352300
1236 Ga0307410_11629981
1237 Ga0307412_10021597
1238 Ga0307412_10698635
1239 Ga0307416_100001814
1240 Ga0307416_100301068
1241 Ga0307416_100876020
1242 Ga0307414_10001545
1243 Ga0307411_10079896
1244 Ga0307411_10110133
1245 Ga0307415_100003242
1246 Ga0307415_100151830
1247 Ga0373940_0150203
1248 Ga0373949_0025290
1249 Ga0373949_0108077
1250 Ga0373941_0006947
1251 Ga0373931_0093702
1252 Ga0373931_0666176
1253 Ga0395900_1248122
1254 Ga0395898_0059894
1255 Ga0395901_0268121
1256 Ga0242422_01620
1257 Ga0242420_001768
1258 Ga0436365_0414010
1259 Ga0436362_0761155
1260 Ga0439439_0084193
1261 Ga0439455_0008046
1262 Ga0439459_0062355
1263 Ga0453684_2145309
1264 Ga0451576_0647620
1265 Ga0451576_0650274
1266 Ga0451576_1260559
1267 Ga0495669_0315673
1268 Ga0496102_0030736
1269 Ga0496103_0020529
1270 Ga0496104_0170309
1271 Ga0496106_0193591
1272 Ga0496107_0090857
1273 Ga0496107_1262338
1274 Ga0496108_0199464
1275 Ga0496108_0594672
1276 Ga0496108_1747193
1277 Ga0496109_0309269
1278 Ga0496109_0520659
1279 Ga0496109_0850829
1280 Ga0496110_0172130
1281 Ga0496110_1081817
1282 Ga0496110_1922293
1283 Ga0496111_0815467
1284 Ga0496112_1196971
1285 Ga0496112_1593250
1286 Ga0496113_0461386
1287 Ga0496113_1111003
1288 Ga0496113_1555203
1289 Ga0496114_0989335
1290 Ga0501296_041470
1291 Ga0501298_004180
1292 Ga0501299_004077
1293 Ga0501300_003680
1294 Ga0501303_016099
1295 Ga0501206_076056
1296 Ga0501217_002790
1297 Ga0501223_014303
1298 Ga0501223_050149
1299 Ga0501223_129169
1300 Ga0501227_004037
1301 Ga0501227_020658
1302 Ga0501233_000680
1303 Ga0501235_006355
1304 Ga0501235_014602
1305 Ga0501239_007147
1306 Ga0501243_030695
1307 Ga0501251_012059
1308 Ga0501252_014927
1309 Ga0501253_001697
1310 Ga0501253_007813
1311 Ga0501255_011119
1312 Ga0501257_013123
1313 Ga0501259_001014
1314 Ga0501259_069303
1315 Ga0501261_002506
1316 Ga0501261_020060
1317 Ga0501225_0030340
1318 Ga0501234_000197
1319 Ga0501234_004035
1320 Ga0501268_004877
1321 Ga0501271_020143
1322 Ga0501273_016694
1323 Ga0501274_017491
1324 Ga0501280_022978
1325 Ga0501283_012533
1326 Ga0501212_006528
1327 nmdc:mga05p37_1027260_c1
1328 nmdc:mga05p37_385355_c1
1329 nmdc:mga05p37_753570_c1
1330 nmdc:mga05p37_853769_c1
1331 nmdc:mga05p37_86616_c1
1332 nmdc:mga05p37_973759_c1
1333 nmdc:mga09592_1360130_c1
1334 nmdc:mga09592_349629_c1
1335 nmdc:mga09592_496770_c1
1336 nmdc:mga0qj67_211122_c1
1337 nmdc:mga06r32_251209_c1
1338 nmdc:mga06r32_818286_c1
1339 nmdc:mga08y16_10234_c1
1340 nmdc:mga08y16_87625_c1
1341 nmdc:mga0n895_1194404_c1
1342 nmdc:mga0n895_183748_c1
1343 nmdc:mga0n895_644435_c1
1344 nmdc:mga0rr50_174815_c1
1345 nmdc:mga0rr50_46_c1
1346 nmdc:mga0rr50_521418_c1
1347 nmdc:mga08x19_132712_c1
1348 nmdc:mga08x19_3_c1
1349 nmdc:mga0a205_100626_c1
1350 nmdc:mga0a205_266786_c1
1351 nmdc:mga0a205_417433_c1
1352 nmdc:mga0a205_71606_c1
1353 nmdc:mga0a205_75977_c1
1354 Ga0530510_0334508

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

19

97

0.98

PF00401

ATP-synt_DE

ATP synthase, Delta/Epsilon chain, long alpha-helix domain

101

147

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hkk-assembly2.cif.gz_P caldalaklibacillus thermarum f1-atpase (wild type) 0.9437 5 133
5dn6-assembly1.cif.gz_I atp synthase from paracoccus denitrificans 0.9403 10 80
5ik2-assembly1.cif.gz_H caldalaklibacillus thermarum f1-atpase (epsilon mutant) 0.9373 5 133
6fkh-assembly1.cif.gz_e chloroplast f1fo conformation 2 0.9313 5 134
1h8e-assembly1.cif.gz_H (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied) 0.9189 5 87
ID Description Score Start End Superfamily
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9651 3 89 2.60.15.10
1aqtA01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9581 4 88 2.60.15.10
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9578 4 89 2.60.15.10
af_Q2FWF1_1_89_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9567 3 89 2.60.15.10
af_A0A0R0KXY9_13_77_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9468 26 89 2.60.15.10
ID Description Score Start End GO Terms
AF-A0A7W0NUT7-F1-model_v4 ATP synthase F1 subunit epsilon 0.9853 5 82 GO:0012505
GO:0045261
GO:0046933
AF-A6DUD6-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9842 4 86 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A554I9M7-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9832 1 133 GO:0005524
GO:0005886
GO:0045261
GO:0046933
AF-X0WCW9-F1-model_v4 ATP synthase F1 complex delta/epsilon subunit N-terminal domain-containing protein 0.9826 4 105 GO:0045261
GO:0046933
AF-A0A251V6S5-F1-model_v4 H(+)-transporting two-sector ATPase (Putative ATPase, F1 complex, delta/epsilon subunit) 0.9826 2 85 GO:0015986
GO:0045261
GO:0046933

Map