F474555

General Info

Members Datasets Scaffolds Average Seq Length
676 277 1352 193

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0471263|Ga0501074_0471263_222_785
Length 187
Sequence MNRTDGAIARLVDQLLKELGEDTFREGLERTPERVEKALRFLTGGYHMKVEDVFNEALFVEDYDEMVVVKDIDYFSLCEHHLIPFFGKAHIAYMPRTKIPRLVEMFARRLQVQERLTTQIANTLNEVLQPRGVAVVMEAVHLCMIMRGVEKQNSKAVTSAMLGAFRDRPETRAEFMELIKAGRGLQI

Samples

Sample ID Description Type Environment
1 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
175 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
176 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
177 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
194 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
195 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.81
Nodule 0
Rhizoplane 2.66
Rhizosphere 94.08
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501074_0471263 3300049590 Bacteria 890
2 Ga0065704_10126539 3300005289 Bacteria 1688
3 Ga0065704_10472806 3300005289 Bacteria 688
4 Ga0065712_10068147 3300005290 Bacteria 13862
5 Ga0065715_10126820 3300005293 Bacteria 2101
6 Ga0065715_10244593 3300005293 Bacteria 1188
7 Ga0065707_10103471 3300005295 Bacteria 2734
8 Ga0065707_10441847 3300005295 Bacteria 800
9 Ga0070676_10171294 3300005328 Bacteria 1404
10 Ga0070670_100007326 3300005331 Bacteria 9363
11 Ga0070670_100010006 3300005331 Bacteria 8094
12 Ga0070670_100018179 3300005331 Bacteria 6032
13 Ga0070677_10014538 3300005333 Bacteria 2772
14 Ga0070677_10220000 3300005333 Bacteria 927
15 Ga0068869_100000131 3300005334 Bacteria 36287
16 Ga0070666_10190961 3300005335 Bacteria 1439
17 Ga0070680_100000164 3300005336 Bacteria 41936
18 Ga0070680_100596646 3300005336 Bacteria 948
19 Ga0070682_100022084 3300005337 Bacteria 3764
20 Ga0068868_100130625 3300005338 Bacteria 2055
21 Ga0068868_100675641 3300005338 Bacteria 922
22 Ga0068868_100708443 3300005338 Bacteria 901
23 Ga0070660_100000513 3300005339 Bacteria 25878
24 Ga0070689_100040820 3300005340 Bacteria 3559
25 Ga0070689_100065775 3300005340 Bacteria 2824
26 Ga0070691_10017137 3300005341 Bacteria 3334
27 Ga0070691_10073629 3300005341 Bacteria 1661
28 Ga0070691_10150781 3300005341 Bacteria 1192
29 Ga0070687_100091989 3300005343 Bacteria 1680
30 Ga0070661_100019714 3300005344 Bacteria 4806
31 Ga0070692_10001601 3300005345 Bacteria 8320
32 Ga0070669_100116805 3300005353 Bacteria 2031
33 Ga0070669_100431994 3300005353 Unclassified 1082
34 Ga0070675_100219883 3300005354 Bacteria 1654
35 Ga0070675_101219418 3300005354 Archaea 693
36 Ga0070671_100055390 3300005355 Bacteria 3299
37 Ga0070674_100000165 3300005356 Bacteria 30575
38 Ga0070674_101374292 3300005356 Bacteria 632
39 Ga0070673_100024362 3300005364 Bacteria 4437
40 Ga0070673_100408021 3300005364 Bacteria 1216
41 Ga0070659_100000632 3300005366 Bacteria 25732
42 Ga0070667_100362605 3300005367 Bacteria 1314
43 Ga0070703_10005330 3300005406 Bacteria 3593
44 Ga0070703_10014608 3300005406 Bacteria 2238
45 Ga0070709_10143824 3300005434 Bacteria 1641
46 Ga0070701_10010183 3300005438 Bacteria 4147
47 Ga0070701_10026665 3300005438 Bacteria 2820
48 Ga0070711_100097829 3300005439 Bacteria 2129
49 Ga0070705_100000131 3300005440 Bacteria 43858
50 Ga0070705_100004573 3300005440 Bacteria 6736
51 Ga0070705_100022036 3300005440 Bacteria 3398
52 Ga0070705_100035150 3300005440 Bacteria 2807
53 Ga0070705_100198908 3300005440 Bacteria 1372
54 Ga0070700_100239875 3300005441 Bacteria 1295
55 Ga0070694_100000051 3300005444 Bacteria 54318
56 Ga0070694_100018462 3300005444 Bacteria 4426
57 Ga0070694_100018974 3300005444 Bacteria 4370
58 Ga0070694_100080425 3300005444 Bacteria 2264
59 Ga0070694_100101519 3300005444 Bacteria 2035
60 Ga0070694_100441449 3300005444 Bacteria 1026
61 Ga0070708_100005114 3300005445 Bacteria 10383
62 Ga0070708_100028584 3300005445 Bacteria 4799
63 Ga0070708_100094710 3300005445 Bacteria 2725
64 Ga0070708_100313094 3300005445 Bacteria 1479
65 Ga0070708_100478450 3300005445 Bacteria 1175
66 Ga0070708_101116044 3300005445 Bacteria 738
67 Ga0070663_100001225 3300005455 Bacteria 14094
68 Ga0070678_100013530 3300005456 Bacteria 5121
69 Ga0070662_100004719 3300005457 Bacteria 8638
70 Ga0070662_100303076 3300005457 Bacteria 1298
71 Ga0070681_10020228 3300005458 Bacteria 6672
72 Ga0070681_10286341 3300005458 Bacteria 1558
73 Ga0068867_100009288 3300005459 Bacteria 6940
74 Ga0068867_100149955 3300005459 Bacteria 1831
75 Ga0070706_100003451 3300005467 Bacteria 15570
76 Ga0070706_100018032 3300005467 Bacteria 6511
77 Ga0070706_100068314 3300005467 Bacteria 3286
78 Ga0070706_100111099 3300005467 Bacteria 2551
79 Ga0070706_100137817 3300005467 Bacteria 2277
80 Ga0070706_100363492 3300005467 Bacteria 1348
81 Ga0070706_100412851 3300005467 Bacteria 1257
82 Ga0070706_100794879 3300005467 Bacteria 876
83 Ga0070707_100011493 3300005468 Bacteria 8256
84 Ga0070707_100031172 3300005468 Bacteria 5078
85 Ga0070707_100155973 3300005468 Bacteria 2224
86 Ga0070707_100180090 3300005468 Bacteria 2060
87 Ga0070707_100367579 3300005468 Bacteria 1397
88 Ga0070707_100369904 3300005468 Bacteria 1393
89 Ga0070707_100419650 3300005468 Bacteria 1298
90 Ga0070707_100431555 3300005468 Bacteria 1278
91 Ga0070707_100476422 3300005468 Bacteria 1210
92 Ga0070698_100013087 3300005471 Bacteria 8782
93 Ga0070698_100016136 3300005471 Bacteria 7887
94 Ga0070698_100084214 3300005471 Bacteria 3168
95 Ga0070698_100117857 3300005471 Bacteria 2617
96 Ga0070698_100260085 3300005471 Bacteria 1668
97 Ga0070698_100311304 3300005471 Bacteria 1505
98 Ga0070699_100002290 3300005518 Bacteria 17227
99 Ga0070699_100003071 3300005518 Bacteria 14815
100 Ga0070699_100006696 3300005518 Bacteria 10023
101 Ga0070699_100080930 3300005518 Bacteria 2831
102 Ga0070699_100124705 3300005518 Bacteria 2267
103 Ga0070699_100158119 3300005518 Bacteria 2005
104 Ga0070699_100299113 3300005518 Unclassified 1444
105 Ga0070699_100399404 3300005518 Bacteria 1243
106 Ga0070699_100453789 3300005518 Bacteria 1162
107 Ga0070679_100109740 3300005530 Bacteria 2745
108 Ga0070684_100053681 3300005535 Bacteria 3510
109 Ga0070697_100001348 3300005536 Bacteria 18584
110 Ga0070697_100018859 3300005536 Bacteria 5443
111 Ga0070697_100028283 3300005536 Bacteria 4488
112 Ga0070697_100036672 3300005536 Bacteria 3960
113 Ga0070697_100057980 3300005536 Bacteria 3151
114 Ga0070697_100058425 3300005536 Bacteria 3139
115 Ga0070697_100058447 3300005536 Bacteria 3138
116 Ga0070697_100102935 3300005536 Bacteria 2373
117 Ga0070697_100419696 3300005536 Bacteria 1162
118 Ga0070697_100443737 3300005536 Bacteria 1130
119 Ga0070697_100551424 3300005536 Bacteria 1011
120 Ga0068853_100003329 3300005539 Bacteria 12298
121 Ga0068853_100562724 3300005539 Bacteria 1081
122 Ga0070672_100007971 3300005543 Bacteria 7237
123 Ga0070695_100000405 3300005545 Bacteria 22400
124 Ga0070695_100003269 3300005545 Bacteria 9467
125 Ga0070695_100008708 3300005545 Bacteria 6030
126 Ga0070695_100031176 3300005545 Bacteria 3323
127 Ga0070695_100291192 3300005545 Bacteria 1203
128 Ga0070695_100339267 3300005545 Bacteria 1122
129 Ga0070696_100001112 3300005546 Bacteria 17404
130 Ga0070696_100004606 3300005546 Bacteria 9205
131 Ga0070696_100018347 3300005546 Bacteria 4728
132 Ga0070696_100120331 3300005546 Bacteria 1900
133 Ga0070693_100000502 3300005547 Bacteria 17544
134 Ga0070693_100483785 3300005547 Bacteria 875
135 Ga0070665_100010502 3300005548 Bacteria 9368
136 Ga0070704_100000254 3300005549 Bacteria 23085
137 Ga0070704_100025781 3300005549 Bacteria 3874
138 Ga0070704_100051577 3300005549 Bacteria 2898
139 Ga0070704_100171759 3300005549 Bacteria 1725
140 Ga0070704_100773983 3300005549 Bacteria 856
141 Ga0068855_100008261 3300005563 Bacteria 12583
142 Ga0070664_100037146 3300005564 Bacteria 4093
143 Ga0070664_100222242 3300005564 Bacteria 1690
144 Ga0070664_100576685 3300005564 Bacteria 1042
145 Ga0068857_100268855 3300005577 Bacteria 1566
146 Ga0068854_100000388 3300005578 Bacteria 27607
147 Ga0068856_100005218 3300005614 Bacteria 12818
148 Ga0070702_100011046 3300005615 Bacteria 4480
149 Ga0070702_100015609 3300005615 Bacteria 3881
150 Ga0068852_100705706 3300005616 Bacteria 1019
151 Ga0068859_100024991 3300005617 Bacteria 5996
152 Ga0068859_100291938 3300005617 Bacteria 1724
153 Ga0068864_100001528 3300005618 Bacteria 19040
154 Ga0068864_100952073 3300005618 Bacteria 850
155 Ga0068866_10130884 3300005718 Bacteria 1427
156 Ga0068861_100016720 3300005719 Bacteria 5197
157 Ga0068861_100198131 3300005719 Unclassified 1684
158 Ga0068870_10001928 3300005840 Bacteria 8559
159 Ga0068870_10006203 3300005840 Bacteria 5258
160 Ga0068870_10190915 3300005840 Bacteria 1236
161 Ga0068863_100011183 3300005841 Bacteria 8698
162 Ga0068863_100326506 3300005841 Bacteria 1491
163 Ga0068863_100739466 3300005841 Unclassified 979
164 Ga0068858_100025131 3300005842 Bacteria 5543
165 Ga0068858_100025234 3300005842 Bacteria 5532
166 Ga0068858_100562731 3300005842 Unclassified 1104
167 Ga0068860_100007060 3300005843 Bacteria 11243
168 Ga0068860_100096569 3300005843 Bacteria 2817
169 Ga0068862_100001179 3300005844 Bacteria 24639
170 Ga0068862_100140324 3300005844 Bacteria 2144
171 Ga0068862_100231978 3300005844 Unclassified 1675
172 Ga0068862_100286988 3300005844 Bacteria 1510
173 Ga0068862_100674602 3300005844 Bacteria 999
174 Ga0081455_10099067 3300005937 Bacteria 2345
175 Ga0081539_10000009 3300005985 Bacteria 509286
176 Ga0075365_10000357 3300006038 Bacteria 16457
177 Ga0075365_10090100 3300006038 Bacteria 2088
178 Ga0075363_100032382 3300006048 Bacteria 2715
179 Ga0075364_10016781 3300006051 Bacteria 4561
180 Ga0075432_10042218 3300006058 Bacteria 1595
181 Ga0070715_10176937 3300006163 Bacteria 1067
182 Ga0070716_100070190 3300006173 Bacteria 2056
183 Ga0075362_10037068 3300006177 Bacteria 2136
184 Ga0075362_10305152 3300006177 Bacteria 790
185 Ga0075367_10013934 3300006178 Bacteria 4339
186 Ga0075366_10003405 3300006195 Bacteria 8381
187 Ga0075366_10116955 3300006195 Bacteria 1605
188 Ga0097621_100109242 3300006237 Bacteria 2336
189 Ga0097621_100184123 3300006237 Bacteria 1806
190 Ga0097621_100282247 3300006237 Bacteria 1462
191 Ga0097621_100578096 3300006237 Bacteria 1025
192 Ga0097621_101083032 3300006237 Unclassified 752
193 Ga0075370_10006219 3300006353 Bacteria 5989
194 Ga0068871_100008546 3300006358 Bacteria 7359
195 Ga0068871_100189345 3300006358 Bacteria 1772
196 Ga0075428_100001296 3300006844 Bacteria 26545
197 Ga0075428_100010023 3300006844 Bacteria 10525
198 Ga0075428_100028782 3300006844 Bacteria 6148
199 Ga0075428_100057978 3300006844 Bacteria 4240
200 Ga0075428_100153008 3300006844 Bacteria 2506
201 Ga0075428_101158018 3300006844 Bacteria 816
202 Ga0075430_100002276 3300006846 Bacteria 15900
203 Ga0075430_100011321 3300006846 Bacteria 7566
204 Ga0075430_100041817 3300006846 Bacteria 3877
205 Ga0075430_100076932 3300006846 Bacteria 2797
206 Ga0075430_100169904 3300006846 Bacteria 1814
207 Ga0075430_101019610 3300006846 Bacteria 682
208 Ga0075431_100005147 3300006847 Bacteria 12870
209 Ga0075431_100006964 3300006847 Bacteria 11245
210 Ga0075431_100015947 3300006847 Bacteria 7623
211 Ga0075431_100029998 3300006847 Bacteria 5601
212 Ga0075431_100036511 3300006847 Bacteria 5061
213 Ga0075431_100050170 3300006847 Bacteria 4303
214 Ga0075431_100089215 3300006847 Bacteria 3183
215 Ga0075431_100183069 3300006847 Bacteria 2150
216 Ga0075431_100383545 3300006847 Bacteria 1409
217 Ga0075431_100432717 3300006847 Bacteria 1313
218 Ga0075431_100674761 3300006847 Bacteria 1012
219 Ga0075431_100956139 3300006847 Bacteria 825
220 Ga0075433_10027017 3300006852 Bacteria 4865
221 Ga0075433_10030544 3300006852 Bacteria 4598
222 Ga0075433_10034348 3300006852 Bacteria 4355
223 Ga0075433_10062891 3300006852 Bacteria 3251
224 Ga0075433_10123050 3300006852 Bacteria 2304
225 Ga0075433_10385580 3300006852 Bacteria 1237
226 Ga0075434_100001352 3300006871 Bacteria 20583
227 Ga0075434_100010826 3300006871 Bacteria 8572
228 Ga0075434_100068158 3300006871 Bacteria 3544
229 Ga0075434_100093695 3300006871 Bacteria 3007
230 Ga0075434_100238803 3300006871 Bacteria 1837
231 Ga0075434_100480146 3300006871 Bacteria 1264
232 Ga0075434_100499247 3300006871 Bacteria 1238
233 Ga0075429_100009628 3300006880 Bacteria 8383
234 Ga0075429_100010334 3300006880 Bacteria 8075
235 Ga0075429_100017427 3300006880 Bacteria 6211
236 Ga0075429_100066638 3300006880 Bacteria 3135
237 Ga0075429_100092242 3300006880 Bacteria 2642
238 Ga0075429_100365940 3300006880 Bacteria 1262
239 Ga0075436_100024209 3300006914 Bacteria 4173
240 Ga0075436_100076323 3300006914 Bacteria 2320
241 Ga0075436_100115882 3300006914 Bacteria 1872
242 Ga0097620_100024990 3300006931 Bacteria 5996
243 Ga0097620_100291929 3300006931 Bacteria 1724
244 Ga0075435_100033451 3300007076 Bacteria 4065
245 Ga0075435_100052908 3300007076 Bacteria 3272
246 Ga0075435_100059188 3300007076 Bacteria 3105
247 Ga0075435_100145129 3300007076 Bacteria 1993
248 Ga0075435_100705233 3300007076 Bacteria 877
249 Ga0099794_10007198 3300007265 Bacteria 4555
250 Ga0099794_10008112 3300007265 Bacteria 4349
251 Ga0099794_10036500 3300007265 Bacteria 2324
252 Ga0111539_10001170 3300009094 Bacteria 34759
253 Ga0111539_10021166 3300009094 Bacteria 8009
254 Ga0111539_10041279 3300009094 Bacteria 5548
255 Ga0111539_10042778 3300009094 Bacteria 5436
256 Ga0111539_10111662 3300009094 Bacteria 3207
257 Ga0111539_10733371 3300009094 Bacteria 1150
258 Ga0114129_10001687 3300009147 Bacteria 30118
259 Ga0114129_10002770 3300009147 Bacteria 24422
260 Ga0114129_10003464 3300009147 Bacteria 22183
261 Ga0114129_10003991 3300009147 Bacteria 20841
262 Ga0114129_10014874 3300009147 Bacteria 11086
263 Ga0114129_10031143 3300009147 Bacteria 7544
264 Ga0114129_10042738 3300009147 Bacteria 6379
265 Ga0114129_10063240 3300009147 Bacteria 5169
266 Ga0114129_10072898 3300009147 Bacteria 4785
267 Ga0114129_10125838 3300009147 Bacteria 3524
268 Ga0114129_10323289 3300009147 Bacteria 2050
269 Ga0114129_10370319 3300009147 Bacteria 1894
270 Ga0114129_10605040 3300009147 Bacteria 1420
271 Ga0114129_10774997 3300009147 Bacteria 1226
272 Ga0114129_10889741 3300009147 Bacteria 1129
273 Ga0114129_11053914 3300009147 Bacteria 1021
274 Ga0105243_10023299 3300009148 Bacteria 4712
275 Ga0105243_10502171 3300009148 Bacteria 1149
276 Ga0105241_10001332 3300009174 Bacteria 18756
277 Ga0105241_11032873 3300009174 Bacteria 771
278 Ga0105242_10025266 3300009176 Bacteria 4699
279 Ga0105242_10033633 3300009176 Bacteria 4107
280 Ga0105242_10700715 3300009176 Bacteria 991
281 Ga0105248_10069690 3300009177 Bacteria 3949
282 Ga0105248_10366581 3300009177 Bacteria 1622
283 Ga0105237_11078877 3300009545 Bacteria 810
284 Ga0105249_10086688 3300009553 Bacteria 2920
285 Ga0105249_11154206 3300009553 Bacteria 845
286 Ga0105239_10253804 3300010375 Bacteria 1975
287 Ga0105246_10287561 3300011119 Bacteria 1321
288 Ga0157373_10000676 3300013100 Bacteria 26705
289 Ga0157370_10554704 3300013104 Bacteria 1053
290 Ga0163162_11011443 3300013306 Bacteria 940
291 Ga0163162_11055925 3300013306 Bacteria 919
292 Ga0163162_11535037 3300013306 Bacteria 759
293 Ga0157372_10000488 3300013307 Bacteria 43720
294 Ga0157375_10630040 3300013308 Bacteria 1230
295 Ga0163163_10000034 3300014325 Bacteria 161820
296 Ga0163163_10054674 3300014325 Bacteria 3944
297 Ga0157380_10011406 3300014326 Bacteria 6422
298 Ga0157380_10178130 3300014326 Bacteria 1865
299 Ga0157380_10949969 3300014326 Bacteria 889
300 Ga0157377_10064549 3300014745 Bacteria 2100
301 Ga0157377_10111998 3300014745 Bacteria 1641
302 Ga0157376_10429909 3300014969 Bacteria 1283
303 Ga0157376_10677299 3300014969 Bacteria 1034
304 Ga0207697_10073279 3300025315 Bacteria 1437
305 Ga0207653_10001969 3300025885 Bacteria 6576
306 Ga0207682_10067986 3300025893 Bacteria 1505
307 Ga0207682_10126396 3300025893 Bacteria 1138
308 Ga0207682_10351076 3300025893 Bacteria 695
309 Ga0207642_10077360 3300025899 Bacteria 1605
310 Ga0207642_10347121 3300025899 Bacteria 874
311 Ga0207688_10029236 3300025901 Bacteria 3033
312 Ga0207680_10037752 3300025903 Bacteria 2791
313 Ga0207680_10138562 3300025903 Bacteria 1611
314 Ga0207680_10559924 3300025903 Bacteria 816
315 Ga0207645_10000149 3300025907 Bacteria 54978
316 Ga0207645_10207568 3300025907 Bacteria 1290
317 Ga0207643_10001005 3300025908 Bacteria 16805
318 Ga0207643_10015274 3300025908 Bacteria 4178
319 Ga0207643_10035151 3300025908 Bacteria 2809
320 Ga0207684_10000158 3300025910 Bacteria 115693
321 Ga0207684_10000410 3300025910 Bacteria 57371
322 Ga0207684_10000567 3300025910 Bacteria 45151
323 Ga0207684_10024166 3300025910 Bacteria 5184
324 Ga0207684_10025180 3300025910 Bacteria 5071
325 Ga0207684_10053448 3300025910 Bacteria 3428
326 Ga0207684_10284823 3300025910 Bacteria 1425
327 Ga0207684_10292867 3300025910 Unclassified 1403
328 Ga0207684_10446720 3300025910 Bacteria 1110
329 Ga0207684_10495594 3300025910 Bacteria 1047
330 Ga0207684_11159197 3300025910 Bacteria 641
331 Ga0207654_10021735 3300025911 Bacteria 3415
332 Ga0207707_10000448 3300025912 Bacteria 42902
333 Ga0207671_10692901 3300025914 Bacteria 810
334 Ga0207660_10000157 3300025917 Bacteria 42274
335 Ga0207660_10040156 3300025917 Bacteria 3275
336 Ga0207662_10189372 3300025918 Bacteria 1327
337 Ga0207657_10000332 3300025919 Bacteria 50089
338 Ga0207649_10003081 3300025920 Bacteria 9150
339 Ga0207652_10000519 3300025921 Bacteria 39077
340 Ga0207646_10000188 3300025922 Bacteria 84349
341 Ga0207646_10017521 3300025922 Bacteria 6701
342 Ga0207646_10043371 3300025922 Bacteria 4040
343 Ga0207646_10053321 3300025922 Bacteria 3617
344 Ga0207646_10161662 3300025922 Bacteria 2021
345 Ga0207646_10163720 3300025922 Bacteria 2008
346 Ga0207646_10376597 3300025922 Bacteria 1282
347 Ga0207646_10547486 3300025922 Bacteria 1041
348 Ga0207646_10781211 3300025922 Bacteria 851
349 Ga0207681_10261053 3300025923 Bacteria 1356
350 Ga0207650_10016880 3300025925 Bacteria 5106
351 Ga0207650_10047098 3300025925 Bacteria 3176
352 Ga0207659_10534492 3300025926 Bacteria 995
353 Ga0207687_10062791 3300025927 Bacteria 2628
354 Ga0207644_10053595 3300025931 Bacteria 2903
355 Ga0207690_10010271 3300025932 Bacteria 5560
356 Ga0207706_10002143 3300025933 Bacteria 19305
357 Ga0207706_10064233 3300025933 Bacteria 3232
358 Ga0207686_10064362 3300025934 Bacteria 2335
359 Ga0207686_10366986 3300025934 Bacteria 1088
360 Ga0207709_10018468 3300025935 Bacteria 3907
361 Ga0207709_10370711 3300025935 Bacteria 1086
362 Ga0207670_10027460 3300025936 Bacteria 3598
363 Ga0207670_10204334 3300025936 Bacteria 1502
364 Ga0207669_10019779 3300025937 Bacteria 3514
365 Ga0207704_10226960 3300025938 Bacteria 1386
366 Ga0207691_10013526 3300025940 Bacteria 7805
367 Ga0207691_10146870 3300025940 Unclassified 2075
368 Ga0207689_10000047 3300025942 Bacteria 91275
369 Ga0207689_10023893 3300025942 Bacteria 5127
370 Ga0207679_10007792 3300025945 Bacteria 6806
371 Ga0207679_10128165 3300025945 Bacteria 2031
372 Ga0207679_10170458 3300025945 Bacteria 1791
373 Ga0207667_10002507 3300025949 Bacteria 22890
374 Ga0207651_10007901 3300025960 Bacteria 5699
375 Ga0207651_10044216 3300025960 Bacteria 2979
376 Ga0207712_10142233 3300025961 Bacteria 1843
377 Ga0207712_10185117 3300025961 Bacteria 1639
378 Ga0207712_10625630 3300025961 Bacteria 933
379 Ga0207712_10677654 3300025961 Bacteria 898
380 Ga0207658_10451702 3300025986 Bacteria 1138
381 Ga0207677_10036662 3300026023 Bacteria 3198
382 Ga0207677_10089725 3300026023 Bacteria 2232
383 Ga0207703_10016721 3300026035 Bacteria 5721
384 Ga0207703_10025298 3300026035 Bacteria 4669
385 Ga0207639_10045941 3300026041 Bacteria 3292
386 Ga0207678_10002684 3300026067 Bacteria 16140
387 Ga0207708_10026343 3300026075 Bacteria 4399
388 Ga0207702_10010175 3300026078 Bacteria 7873
389 Ga0207641_10116531 3300026088 Bacteria 2377
390 Ga0207648_10009045 3300026089 Bacteria 9581
391 Ga0207648_10167014 3300026089 Bacteria 1945
392 Ga0207648_10177869 3300026089 Bacteria 1882
393 Ga0207676_10234810 3300026095 Bacteria 1641
394 Ga0207674_10000431 3300026116 Bacteria 54718
395 Ga0207674_10193724 3300026116 Bacteria 1982
396 Ga0207675_100000989 3300026118 Bacteria 28178
397 Ga0207675_100265291 3300026118 Unclassified 1665
398 Ga0207675_100567659 3300026118 Bacteria 1135
399 Ga0207683_10015342 3300026121 Bacteria 6525
400 Ga0209968_1037209 3300027526 Unclassified 825
401 Ga0209982_1052597 3300027552 Bacteria 657
402 Ga0209588_1010208 3300027671 Bacteria 2819
403 Ga0209588_1131761 3300027671 Bacteria 797
404 Ga0209974_10033341 3300027876 Bacteria 1709
405 Ga0209974_10037959 3300027876 Bacteria 1600
406 Ga0207428_10000138 3300027907 Bacteria 98359
407 Ga0207428_10033904 3300027907 Bacteria 4187
408 Ga0207428_10042427 3300027907 Bacteria 3679
409 Ga0207428_10076704 3300027907 Bacteria 2617
410 Ga0207428_10502854 3300027907 Bacteria 880
411 Ga0268265_10005449 3300028380 Bacteria 8695
412 Ga0268265_10065532 3300028380 Bacteria 2804
413 Ga0268265_10214931 3300028380 Unclassified 1678
414 Ga0268264_10087271 3300028381 Bacteria 2682
415 Ga0268264_10367392 3300028381 Bacteria 1374
416 Ga0307406_10293834 3300031901 Bacteria 1245
417 Ga0307407_10226027 3300031903 Bacteria 1268
418 Ga0307412_10416679 3300031911 Bacteria 1098
419 Ga0307409_100155696 3300031995 Bacteria 1991
420 Ga0307409_100793087 3300031995 Bacteria 954
421 Ga0307416_100078218 3300032002 Bacteria 2782
422 Ga0307416_101878669 3300032002 Bacteria 702
423 Ga0373948_0002193 3300034817 Bacteria 2849
424 Ga0373928_0067813 3300035084 Bacteria 876
425 Ga0373951_0013866 3300035091 Bacteria 1812
426 Ga0373932_0085977 3300035112 Bacteria 1001
427 Ga0373939_0046792 3300035114 Bacteria 1326
428 Ga0373957_0114778 3300035120 Bacteria 1087
429 Ga0373960_0007904 3300035121 Bacteria 2533
430 Ga0373955_0183662 3300035172 Bacteria 1242
431 Ga0373955_0562510 3300035172 Bacteria 698
432 Ga0373962_0019800 3300035242 Bacteria 1763
433 Ga0373931_0031664 3300035691 Bacteria 2731
434 Ga0373931_0214711 3300035691 Bacteria 1156
435 Ga0373937_0128969 3300036401 Bacteria 2361
436 Ga0373925_0323053 3300037068 Bacteria 1249
437 Ga0395900_0358571 3300037418 Bacteria 1430
438 Ga0395905_0540116 3300037471 Bacteria 1067
439 Ga0395901_0223828 3300038443 Bacteria 1966
440 Ga0242420_009901 3300038996 Bacteria 1574
441 Ga0436365_0595503 3300039437 Bacteria 2467
442 Ga0436363_1564153 3300039450 Bacteria 677
443 Ga0451853_0817190 3300041512 Bacteria 807
444 Ga0439431_0022258 3300041997 Bacteria 1527
445 Ga0439437_004975 3300042000 Bacteria 1457
446 Ga0439441_053759 3300042001 Bacteria 835
447 Ga0439448_0004176 3300042005 Bacteria 4066
448 Ga0439455_0007771 3300042012 Bacteria 2280
449 Ga0439435_0010658 3300042436 Bacteria 2188
450 Ga0439459_0001438 3300042438 Bacteria 3510
451 Ga0453683_0145896 3300044673 Bacteria 1494
452 Ga0453684_0024987 3300044712 Bacteria 8693
453 Ga0453684_0044458 3300044712 Bacteria 5942
454 Ga0453684_0118800 3300044712 Bacteria 3197
455 Ga0451576_0013928 3300045051 Bacteria 8979
456 Ga0451576_0096177 3300045051 Bacteria 3080
457 Ga0451576_0114735 3300045051 Bacteria 2804
458 Ga0451576_0330853 3300045051 Bacteria 1594
459 Ga0466967_0115201 3300045976 Bacteria 2475
460 Ga0495629_0133906 3300046459 Bacteria 1726
461 Ga0495580_0183515 3300046472 Bacteria 1444
462 Ga0495582_0108882 3300046473 Bacteria 1556
463 Ga0495666_0116869 3300046526 Bacteria 1251
464 Ga0495642_0005919 3300046528 Bacteria 4692
465 Ga0495667_0197717 3300046559 Bacteria 1287
466 Ga0495668_0574097 3300046616 Bacteria 623
467 Ga0495659_0011152 3300046664 Unclassified 2895
468 Ga0495659_0285377 3300046664 Bacteria 694
469 Ga0495647_0060832 3300046681 Bacteria 1490
470 Ga0495658_0149634 3300046683 Bacteria 1433
471 Ga0495658_0177274 3300046683 Bacteria 1321
472 Ga0495669_0002962 3300046684 Bacteria 6980
473 Ga0495669_0049626 3300046684 Bacteria 1880
474 Ga0495670_0141582 3300046691 Bacteria 1258
475 Ga0496100_0024113 3300048903 Bacteria 3706
476 Ga0496101_0002361 3300048904 Bacteria 11581
477 Ga0496102_0025575 3300048905 Bacteria 5257
478 Ga0496104_0028294 3300048907 Bacteria 5195
479 Ga0496105_0117974 3300048908 Bacteria 2189
480 Ga0496106_0118211 3300048909 Bacteria 2069
481 Ga0496106_0210645 3300048909 Bacteria 1548
482 Ga0496106_0738999 3300048909 Bacteria 783
483 Ga0496107_0166343 3300048910 Bacteria 1635
484 Ga0496109_0416837 3300048912 Bacteria 1269
485 Ga0496110_0067211 3300048913 Bacteria 3172
486 Ga0496112_0194668 3300048915 Bacteria 1988
487 Ga0496113_0016688 3300048916 Bacteria 5078
488 Ga0496113_0218903 3300048916 Bacteria 1517
489 Ga0496113_0449151 3300048916 Bacteria 1036
490 Ga0496114_0000662 3300048917 Bacteria 25550
491 Ga0496114_0056948 3300048917 Bacteria 3263
492 Ga0496115_0151968 3300048918 Bacteria 1912
493 Ga0501031_0390137 3300049568 Bacteria 901
494 Ga0501031_0411782 3300049568 Bacteria 874
495 Ga0501032_0091746 3300049569 Bacteria 2015
496 Ga0501033_0033926 3300049570 Bacteria 3831
497 Ga0501033_0054197 3300049570 Bacteria 2968
498 Ga0501036_0106491 3300049572 Bacteria 2371
499 Ga0501036_0108237 3300049572 Bacteria 2350
500 Ga0501036_0667531 3300049572 Bacteria 860
501 Ga0501036_0730994 3300049572 Bacteria 817
502 Ga0501037_0021038 3300049573 Bacteria 4820
503 Ga0501038_0042258 3300049574 Bacteria 3970
504 Ga0501038_0312863 3300049574 Bacteria 1230
505 Ga0501038_0382429 3300049574 Bacteria 1092
506 Ga0501039_0065686 3300049575 Bacteria 2815
507 Ga0501040_0054686 3300049576 Bacteria 2737
508 Ga0501041_0099497 3300049577 Bacteria 1799
509 Ga0501041_0382757 3300049577 Bacteria 890
510 Ga0501042_0045773 3300049578 Bacteria 3119
511 Ga0501042_0096712 3300049578 Bacteria 2122
512 Ga0501043_0189962 3300049579 Bacteria 1598
513 Ga0501043_0207197 3300049579 Bacteria 1520
514 Ga0501046_0118155 3300049580 Bacteria 2020
515 Ga0501046_0138053 3300049580 Bacteria 1846
516 Ga0501048_0042614 3300049582 Bacteria 3249
517 Ga0501068_0257813 3300049584 Bacteria 1112
518 Ga0501071_0085535 3300049587 Bacteria 2312
519 Ga0501071_0093329 3300049587 Bacteria 2213
520 Ga0501071_0215862 3300049587 Bacteria 1443
521 Ga0501072_0046365 3300049588 Bacteria 3421
522 Ga0501072_0110841 3300049588 Bacteria 2184
523 Ga0501072_0116787 3300049588 Bacteria 2125
524 Ga0501072_0150372 3300049588 Bacteria 1856
525 Ga0501072_0263102 3300049588 Bacteria 1373
526 Ga0501072_0335758 3300049588 Bacteria 1200
527 Ga0501074_0070646 3300049590 Bacteria 2510
528 Ga0501074_0154083 3300049590 Bacteria 1642
529 Ga0501074_0360616 3300049590 Bacteria 1031
530 Ga0501074_0875138 3300049590 Bacteria 632
531 Ga0501075_0014805 3300049591 Bacteria 5592
532 Ga0501075_0064467 3300049591 Bacteria 2763
533 Ga0501075_0099371 3300049591 Bacteria 2210
534 Ga0501075_0353548 3300049591 Bacteria 1120
535 Ga0501075_0702156 3300049591 Bacteria 771
536 Ga0501076_0003002 3300049592 Bacteria 11721
537 Ga0501076_0153702 3300049592 Bacteria 1872
538 Ga0501077_0022750 3300049593 Bacteria 3972
539 Ga0501077_0023590 3300049593 Bacteria 3901
540 Ga0501077_0057624 3300049593 Bacteria 2466
541 Ga0501077_0060830 3300049593 Bacteria 2396
542 Ga0501077_0114015 3300049593 Bacteria 1714
543 Ga0501077_0257768 3300049593 Bacteria 1109
544 Ga0501077_0279619 3300049593 Bacteria 1062
545 Ga0501079_0014421 3300049741 Bacteria 6025
546 Ga0501079_0113917 3300049741 Bacteria 2102
547 Ga0501079_0128959 3300049741 Bacteria 1968
548 Ga0501079_0144985 3300049741 Bacteria 1850
549 Ga0501079_0199031 3300049741 Bacteria 1564
550 Ga0501079_0618332 3300049741 Bacteria 853
551 Ga0501080_0022453 3300049742 Bacteria 5846
552 Ga0501080_0266965 3300049742 Bacteria 1558
553 Ga0501080_0396881 3300049742 Bacteria 1241
554 Ga0501080_0486361 3300049742 Bacteria 1104
555 Ga0501080_0521991 3300049742 Bacteria 1060
556 Ga0501080_0649153 3300049742 Unclassified 934
557 Ga0501081_0000139 3300049743 Bacteria 32505
558 Ga0501081_0011338 3300049743 Bacteria 5833
559 Ga0501081_0035591 3300049743 Bacteria 3390
560 Ga0501081_0038536 3300049743 Bacteria 3266
561 Ga0501081_0043067 3300049743 Bacteria 3096
562 Ga0501081_0454228 3300049743 Bacteria 952
563 Ga0501081_0897341 3300049743 Bacteria 668
564 Ga0501083_0156638 3300049744 Bacteria 1491
565 Ga0501083_0269405 3300049744 Bacteria 1108
566 Ga0501035_0212154 3300049822 Bacteria 1656
567 Ga0501045_0013809 3300049824 Bacteria 5711
568 Ga0501045_0017328 3300049824 Bacteria 5112
569 Ga0501045_0546240 3300049824 Bacteria 859
570 Ga0501045_0917479 3300049824 Bacteria 643
571 nmdc:mga03683_21100_c1 3300050489 Bacteria 2507
572 nmdc:mga00v17_275228_c1 3300050491 Bacteria 1093
573 nmdc:mga00v17_8292_c1 3300050491 Bacteria 5589
574 nmdc:mga0yw44_23313_c1 3300050492 Bacteria 3485
575 nmdc:mga0yw44_500328_c1 3300050492 Bacteria 825
576 nmdc:mga0k408_80655_c1 3300050493 Bacteria 1905
577 nmdc:mga06z11_118978_c1 3300050494 Bacteria 1472
578 nmdc:mga07m45_224205_c1 3300050496 Bacteria 1094
579 nmdc:mga05p37_114251_c1 3300050507 Bacteria 3319
580 nmdc:mga05p37_17459_c1 3300050507 Bacteria 8661
581 nmdc:mga05p37_211518_c1 3300050507 Bacteria 2344
582 nmdc:mga05p37_21604_c1 3300050507 Bacteria 7798
583 nmdc:mga05p37_218844_c1 3300050507 Bacteria 2299
584 nmdc:mga05p37_231383_c1 3300050507 Bacteria 2226
585 nmdc:mga05p37_232218_c1 3300050507 Bacteria 2222
586 nmdc:mga05p37_23979_c1 3300050507 Bacteria 7409
587 nmdc:mga05p37_28236_c1 3300050507 Bacteria 6841
588 nmdc:mga05p37_383875_c1 3300050507 Bacteria 1645
589 nmdc:mga05p37_38_c1 3300050507 Bacteria 109166
590 nmdc:mga05p37_40935_c2 3300050507 Bacteria 4737
591 nmdc:mga05p37_478692_c1 3300050507 Bacteria 1435
592 nmdc:mga05p37_66645_c1 3300050507 Bacteria 4428
593 nmdc:mga05p37_69892_c1 3300050507 Bacteria 4319
594 nmdc:mga05p37_73824_c1 3300050507 Bacteria 4198
595 nmdc:mga09592_152332_c1 3300050508 Bacteria 1995
596 nmdc:mga09592_220384_c1 3300050508 Bacteria 1644
597 nmdc:mga09592_22434_c1 3300050508 Bacteria 5209
598 nmdc:mga09592_227552_c1 3300050508 Bacteria 1616
599 nmdc:mga09592_93440_c1 3300050508 Bacteria 2572
600 nmdc:mga09592_962546_c1 3300050508 Bacteria 715
601 nmdc:mga09592_98103_c1 3300050508 Bacteria 2508
602 nmdc:mga0qj67_107845_c1 3300050509 Bacteria 2247
603 nmdc:mga0qj67_11698_c1 3300050509 Bacteria 6584
604 nmdc:mga0qj67_224352_c1 3300050509 Bacteria 1525
605 nmdc:mga0qj67_30194_c1 3300050509 Bacteria 4216
606 nmdc:mga0qj67_521580_c1 3300050509 Bacteria 954
607 nmdc:mga0qj67_926091_c1 3300050509 Bacteria 686
608 nmdc:mga06r32_10522_c1 3300050510 Bacteria 8343
609 nmdc:mga06r32_107178_c1 3300050510 Bacteria 2746
610 nmdc:mga06r32_10829_c1 3300050510 Bacteria 8214
611 nmdc:mga06r32_120361_c1 3300050510 Bacteria 2589
612 nmdc:mga06r32_1333900_c1 3300050510 Bacteria 661
613 nmdc:mga06r32_16781_c1 3300050510 Bacteria 6675
614 nmdc:mga06r32_220436_c1 3300050510 Bacteria 1885
615 nmdc:mga06r32_257370_c1 3300050510 Bacteria 1733
616 nmdc:mga06r32_3028_c1 3300050510 Bacteria 15060
617 nmdc:mga06r32_312726_c1 3300050510 Bacteria 1556
618 nmdc:mga06r32_439732_c1 3300050510 Bacteria 1284
619 nmdc:mga06r32_540530_c1 3300050510 Bacteria 1140
620 nmdc:mga06r32_88164_c1 3300050510 Bacteria 3029
621 nmdc:mga06r32_901397_c1 3300050510 Bacteria 841
622 nmdc:mga06r32_99449_c1 3300050510 Bacteria 2853
623 nmdc:mga08y16_1069626_c1 3300050511 Bacteria 783
624 nmdc:mga08y16_1129022_c1 3300050511 Bacteria 758
625 nmdc:mga08y16_1441_c1 3300050511 Bacteria 23825
626 nmdc:mga08y16_23572_c1 3300050511 Bacteria 6501
627 nmdc:mga08y16_374691_c1 3300050511 Bacteria 1460
628 nmdc:mga08y16_40740_c1 3300050511 Bacteria 4867
629 nmdc:mga08y16_931292_c1 3300050511 Bacteria 853
630 nmdc:mga0n895_187113_c1 3300050512 Bacteria 2102
631 nmdc:mga0n895_21664_c1 3300050512 Bacteria 6016
632 nmdc:mga0n895_218975_c1 3300050512 Bacteria 1933
633 nmdc:mga0n895_3872_c1 3300050512 Bacteria 12151
634 nmdc:mga0n895_484644_c1 3300050512 Bacteria 1247
635 nmdc:mga0n895_542391_c1 3300050512 Bacteria 1169
636 nmdc:mga0n895_58090_c1 3300050512 Bacteria 3814
637 nmdc:mga0n895_659003_c1 3300050512 Bacteria 1045
638 nmdc:mga0n895_746862_c1 3300050512 Bacteria 972
639 nmdc:mga0rr50_102466_c1 3300050513 Bacteria 2252
640 nmdc:mga0rr50_13052_c1 3300050513 Bacteria 5393
641 nmdc:mga0rr50_166858_c1 3300050513 Bacteria 1791
642 nmdc:mga0rr50_27643_c1 3300050513 Bacteria 3976
643 nmdc:mga0rr50_682448_c1 3300050513 Bacteria 877
644 nmdc:mga08x19_127221_c1 3300050514 Bacteria 1712
645 nmdc:mga08x19_142726_c1 3300050514 Bacteria 1618
646 nmdc:mga08x19_16091_c1 3300050514 Bacteria 4558
647 nmdc:mga08x19_451963_c1 3300050514 Bacteria 904
648 nmdc:mga08x19_89270_c1 3300050514 Bacteria 2033
649 nmdc:mga0a205_112513_c1 3300050515 Bacteria 2622
650 nmdc:mga0a205_124760_c1 3300050515 Bacteria 2475
651 nmdc:mga0a205_13653_c1 3300050515 Bacteria 7567
652 nmdc:mga0a205_27192_c1 3300050515 Bacteria 5463
653 nmdc:mga0a205_272359_c1 3300050515 Bacteria 1570
654 nmdc:mga0a205_36479_c1 3300050515 Bacteria 4723
655 nmdc:mga0a205_401499_c1 3300050515 Bacteria 1234
656 nmdc:mga0a205_59482_c1 3300050515 Bacteria 3690
657 nmdc:mga0a205_77221_c1 3300050515 Bacteria 3218
658 Ga0495601_0364635 3300053077 Bacteria 939
659 Ga0500628_030759 3300053129 Bacteria 1163
660 Ga0501084_0011317 3300054114 Bacteria 7388
661 Ga0501084_0011615 3300054114 Bacteria 7288
662 Ga0501084_0015966 3300054114 Bacteria 6232
663 Ga0501084_0042879 3300054114 Bacteria 3785
664 Ga0590071_000535 3300059421 Bacteria 11114
665 Ga0590074_004009 3300059423 Bacteria 2433
666 Ga0590075_020418 3300059424 Bacteria 1648
667 Ga0590075_041181 3300059424 Bacteria 1181
668 Ga0590077_000151 3300059426 Bacteria 19379
669 Ga0501082_0000526 3300060353 Bacteria 34036
670 Ga0501082_0050072 3300060353 Bacteria 3602
671 Ga0501082_0281222 3300060353 Bacteria 1448
672 Ga0530510_0000479 3300061734 Bacteria 25666
673 Ga0530510_0024895 3300061734 Bacteria 4277
674 Ga0530510_0081376 3300061734 Bacteria 2358
675 Ga0530510_0172504 3300061734 Bacteria 1602
676 Ga0530510_0324779 3300061734 Bacteria 1154
677 Ga0501074_0471263
678 Ga0065704_10126539
679 Ga0065704_10472806
680 Ga0065712_10068147
681 Ga0065715_10126820
682 Ga0065715_10244593
683 Ga0065707_10103471
684 Ga0065707_10441847
685 Ga0070676_10171294
686 Ga0070670_100007326
687 Ga0070670_100010006
688 Ga0070670_100018179
689 Ga0070677_10014538
690 Ga0070677_10220000
691 Ga0068869_100000131
692 Ga0070666_10190961
693 Ga0070680_100000164
694 Ga0070680_100596646
695 Ga0070682_100022084
696 Ga0068868_100130625
697 Ga0068868_100675641
698 Ga0068868_100708443
699 Ga0070660_100000513
700 Ga0070689_100040820
701 Ga0070689_100065775
702 Ga0070691_10017137
703 Ga0070691_10073629
704 Ga0070691_10150781
705 Ga0070687_100091989
706 Ga0070661_100019714
707 Ga0070692_10001601
708 Ga0070669_100116805
709 Ga0070669_100431994
710 Ga0070675_100219883
711 Ga0070675_101219418
712 Ga0070671_100055390
713 Ga0070674_100000165
714 Ga0070674_101374292
715 Ga0070673_100024362
716 Ga0070673_100408021
717 Ga0070659_100000632
718 Ga0070667_100362605
719 Ga0070703_10005330
720 Ga0070703_10014608
721 Ga0070709_10143824
722 Ga0070701_10010183
723 Ga0070701_10026665
724 Ga0070711_100097829
725 Ga0070705_100000131
726 Ga0070705_100004573
727 Ga0070705_100022036
728 Ga0070705_100035150
729 Ga0070705_100198908
730 Ga0070700_100239875
731 Ga0070694_100000051
732 Ga0070694_100018462
733 Ga0070694_100018974
734 Ga0070694_100080425
735 Ga0070694_100101519
736 Ga0070694_100441449
737 Ga0070708_100005114
738 Ga0070708_100028584
739 Ga0070708_100094710
740 Ga0070708_100313094
741 Ga0070708_100478450
742 Ga0070708_101116044
743 Ga0070663_100001225
744 Ga0070678_100013530
745 Ga0070662_100004719
746 Ga0070662_100303076
747 Ga0070681_10020228
748 Ga0070681_10286341
749 Ga0068867_100009288
750 Ga0068867_100149955
751 Ga0070706_100003451
752 Ga0070706_100018032
753 Ga0070706_100068314
754 Ga0070706_100111099
755 Ga0070706_100137817
756 Ga0070706_100363492
757 Ga0070706_100412851
758 Ga0070706_100794879
759 Ga0070707_100011493
760 Ga0070707_100031172
761 Ga0070707_100155973
762 Ga0070707_100180090
763 Ga0070707_100367579
764 Ga0070707_100369904
765 Ga0070707_100419650
766 Ga0070707_100431555
767 Ga0070707_100476422
768 Ga0070698_100013087
769 Ga0070698_100016136
770 Ga0070698_100084214
771 Ga0070698_100117857
772 Ga0070698_100260085
773 Ga0070698_100311304
774 Ga0070699_100002290
775 Ga0070699_100003071
776 Ga0070699_100006696
777 Ga0070699_100080930
778 Ga0070699_100124705
779 Ga0070699_100158119
780 Ga0070699_100299113
781 Ga0070699_100399404
782 Ga0070699_100453789
783 Ga0070679_100109740
784 Ga0070684_100053681
785 Ga0070697_100001348
786 Ga0070697_100018859
787 Ga0070697_100028283
788 Ga0070697_100036672
789 Ga0070697_100057980
790 Ga0070697_100058425
791 Ga0070697_100058447
792 Ga0070697_100102935
793 Ga0070697_100419696
794 Ga0070697_100443737
795 Ga0070697_100551424
796 Ga0068853_100003329
797 Ga0068853_100562724
798 Ga0070672_100007971
799 Ga0070695_100000405
800 Ga0070695_100003269
801 Ga0070695_100008708
802 Ga0070695_100031176
803 Ga0070695_100291192
804 Ga0070695_100339267
805 Ga0070696_100001112
806 Ga0070696_100004606
807 Ga0070696_100018347
808 Ga0070696_100120331
809 Ga0070693_100000502
810 Ga0070693_100483785
811 Ga0070665_100010502
812 Ga0070704_100000254
813 Ga0070704_100025781
814 Ga0070704_100051577
815 Ga0070704_100171759
816 Ga0070704_100773983
817 Ga0068855_100008261
818 Ga0070664_100037146
819 Ga0070664_100222242
820 Ga0070664_100576685
821 Ga0068857_100268855
822 Ga0068854_100000388
823 Ga0068856_100005218
824 Ga0070702_100011046
825 Ga0070702_100015609
826 Ga0068852_100705706
827 Ga0068859_100024991
828 Ga0068859_100291938
829 Ga0068864_100001528
830 Ga0068864_100952073
831 Ga0068866_10130884
832 Ga0068861_100016720
833 Ga0068861_100198131
834 Ga0068870_10001928
835 Ga0068870_10006203
836 Ga0068870_10190915
837 Ga0068863_100011183
838 Ga0068863_100326506
839 Ga0068863_100739466
840 Ga0068858_100025131
841 Ga0068858_100025234
842 Ga0068858_100562731
843 Ga0068860_100007060
844 Ga0068860_100096569
845 Ga0068862_100001179
846 Ga0068862_100140324
847 Ga0068862_100231978
848 Ga0068862_100286988
849 Ga0068862_100674602
850 Ga0081455_10099067
851 Ga0081539_10000009
852 Ga0075365_10000357
853 Ga0075365_10090100
854 Ga0075363_100032382
855 Ga0075364_10016781
856 Ga0075432_10042218
857 Ga0070715_10176937
858 Ga0070716_100070190
859 Ga0075362_10037068
860 Ga0075362_10305152
861 Ga0075367_10013934
862 Ga0075366_10003405
863 Ga0075366_10116955
864 Ga0097621_100109242
865 Ga0097621_100184123
866 Ga0097621_100282247
867 Ga0097621_100578096
868 Ga0097621_101083032
869 Ga0075370_10006219
870 Ga0068871_100008546
871 Ga0068871_100189345
872 Ga0075428_100001296
873 Ga0075428_100010023
874 Ga0075428_100028782
875 Ga0075428_100057978
876 Ga0075428_100153008
877 Ga0075428_101158018
878 Ga0075430_100002276
879 Ga0075430_100011321
880 Ga0075430_100041817
881 Ga0075430_100076932
882 Ga0075430_100169904
883 Ga0075430_101019610
884 Ga0075431_100005147
885 Ga0075431_100006964
886 Ga0075431_100015947
887 Ga0075431_100029998
888 Ga0075431_100036511
889 Ga0075431_100050170
890 Ga0075431_100089215
891 Ga0075431_100183069
892 Ga0075431_100383545
893 Ga0075431_100432717
894 Ga0075431_100674761
895 Ga0075431_100956139
896 Ga0075433_10027017
897 Ga0075433_10030544
898 Ga0075433_10034348
899 Ga0075433_10062891
900 Ga0075433_10123050
901 Ga0075433_10385580
902 Ga0075434_100001352
903 Ga0075434_100010826
904 Ga0075434_100068158
905 Ga0075434_100093695
906 Ga0075434_100238803
907 Ga0075434_100480146
908 Ga0075434_100499247
909 Ga0075429_100009628
910 Ga0075429_100010334
911 Ga0075429_100017427
912 Ga0075429_100066638
913 Ga0075429_100092242
914 Ga0075429_100365940
915 Ga0075436_100024209
916 Ga0075436_100076323
917 Ga0075436_100115882
918 Ga0097620_100024990
919 Ga0097620_100291929
920 Ga0075435_100033451
921 Ga0075435_100052908
922 Ga0075435_100059188
923 Ga0075435_100145129
924 Ga0075435_100705233
925 Ga0099794_10007198
926 Ga0099794_10008112
927 Ga0099794_10036500
928 Ga0111539_10001170
929 Ga0111539_10021166
930 Ga0111539_10041279
931 Ga0111539_10042778
932 Ga0111539_10111662
933 Ga0111539_10733371
934 Ga0114129_10001687
935 Ga0114129_10002770
936 Ga0114129_10003464
937 Ga0114129_10003991
938 Ga0114129_10014874
939 Ga0114129_10031143
940 Ga0114129_10042738
941 Ga0114129_10063240
942 Ga0114129_10072898
943 Ga0114129_10125838
944 Ga0114129_10323289
945 Ga0114129_10370319
946 Ga0114129_10605040
947 Ga0114129_10774997
948 Ga0114129_10889741
949 Ga0114129_11053914
950 Ga0105243_10023299
951 Ga0105243_10502171
952 Ga0105241_10001332
953 Ga0105241_11032873
954 Ga0105242_10025266
955 Ga0105242_10033633
956 Ga0105242_10700715
957 Ga0105248_10069690
958 Ga0105248_10366581
959 Ga0105237_11078877
960 Ga0105249_10086688
961 Ga0105249_11154206
962 Ga0105239_10253804
963 Ga0105246_10287561
964 Ga0157373_10000676
965 Ga0157370_10554704
966 Ga0163162_11011443
967 Ga0163162_11055925
968 Ga0163162_11535037
969 Ga0157372_10000488
970 Ga0157375_10630040
971 Ga0163163_10000034
972 Ga0163163_10054674
973 Ga0157380_10011406
974 Ga0157380_10178130
975 Ga0157380_10949969
976 Ga0157377_10064549
977 Ga0157377_10111998
978 Ga0157376_10429909
979 Ga0157376_10677299
980 Ga0207697_10073279
981 Ga0207653_10001969
982 Ga0207682_10067986
983 Ga0207682_10126396
984 Ga0207682_10351076
985 Ga0207642_10077360
986 Ga0207642_10347121
987 Ga0207688_10029236
988 Ga0207680_10037752
989 Ga0207680_10138562
990 Ga0207680_10559924
991 Ga0207645_10000149
992 Ga0207645_10207568
993 Ga0207643_10001005
994 Ga0207643_10015274
995 Ga0207643_10035151
996 Ga0207684_10000158
997 Ga0207684_10000410
998 Ga0207684_10000567
999 Ga0207684_10024166
1000 Ga0207684_10025180
1001 Ga0207684_10053448
1002 Ga0207684_10284823
1003 Ga0207684_10292867
1004 Ga0207684_10446720
1005 Ga0207684_10495594
1006 Ga0207684_11159197
1007 Ga0207654_10021735
1008 Ga0207707_10000448
1009 Ga0207671_10692901
1010 Ga0207660_10000157
1011 Ga0207660_10040156
1012 Ga0207662_10189372
1013 Ga0207657_10000332
1014 Ga0207649_10003081
1015 Ga0207652_10000519
1016 Ga0207646_10000188
1017 Ga0207646_10017521
1018 Ga0207646_10043371
1019 Ga0207646_10053321
1020 Ga0207646_10161662
1021 Ga0207646_10163720
1022 Ga0207646_10376597
1023 Ga0207646_10547486
1024 Ga0207646_10781211
1025 Ga0207681_10261053
1026 Ga0207650_10016880
1027 Ga0207650_10047098
1028 Ga0207659_10534492
1029 Ga0207687_10062791
1030 Ga0207644_10053595
1031 Ga0207690_10010271
1032 Ga0207706_10002143
1033 Ga0207706_10064233
1034 Ga0207686_10064362
1035 Ga0207686_10366986
1036 Ga0207709_10018468
1037 Ga0207709_10370711
1038 Ga0207670_10027460
1039 Ga0207670_10204334
1040 Ga0207669_10019779
1041 Ga0207704_10226960
1042 Ga0207691_10013526
1043 Ga0207691_10146870
1044 Ga0207689_10000047
1045 Ga0207689_10023893
1046 Ga0207679_10007792
1047 Ga0207679_10128165
1048 Ga0207679_10170458
1049 Ga0207667_10002507
1050 Ga0207651_10007901
1051 Ga0207651_10044216
1052 Ga0207712_10142233
1053 Ga0207712_10185117
1054 Ga0207712_10625630
1055 Ga0207712_10677654
1056 Ga0207658_10451702
1057 Ga0207677_10036662
1058 Ga0207677_10089725
1059 Ga0207703_10016721
1060 Ga0207703_10025298
1061 Ga0207639_10045941
1062 Ga0207678_10002684
1063 Ga0207708_10026343
1064 Ga0207702_10010175
1065 Ga0207641_10116531
1066 Ga0207648_10009045
1067 Ga0207648_10167014
1068 Ga0207648_10177869
1069 Ga0207676_10234810
1070 Ga0207674_10000431
1071 Ga0207674_10193724
1072 Ga0207675_100000989
1073 Ga0207675_100265291
1074 Ga0207675_100567659
1075 Ga0207683_10015342
1076 Ga0209968_1037209
1077 Ga0209982_1052597
1078 Ga0209588_1010208
1079 Ga0209588_1131761
1080 Ga0209974_10033341
1081 Ga0209974_10037959
1082 Ga0207428_10000138
1083 Ga0207428_10033904
1084 Ga0207428_10042427
1085 Ga0207428_10076704
1086 Ga0207428_10502854
1087 Ga0268265_10005449
1088 Ga0268265_10065532
1089 Ga0268265_10214931
1090 Ga0268264_10087271
1091 Ga0268264_10367392
1092 Ga0307406_10293834
1093 Ga0307407_10226027
1094 Ga0307412_10416679
1095 Ga0307409_100155696
1096 Ga0307409_100793087
1097 Ga0307416_100078218
1098 Ga0307416_101878669
1099 Ga0373948_0002193
1100 Ga0373928_0067813
1101 Ga0373951_0013866
1102 Ga0373932_0085977
1103 Ga0373939_0046792
1104 Ga0373957_0114778
1105 Ga0373960_0007904
1106 Ga0373955_0183662
1107 Ga0373955_0562510
1108 Ga0373962_0019800
1109 Ga0373931_0031664
1110 Ga0373931_0214711
1111 Ga0373937_0128969
1112 Ga0373925_0323053
1113 Ga0395900_0358571
1114 Ga0395905_0540116
1115 Ga0395901_0223828
1116 Ga0242420_009901
1117 Ga0436365_0595503
1118 Ga0436363_1564153
1119 Ga0451853_0817190
1120 Ga0439431_0022258
1121 Ga0439437_004975
1122 Ga0439441_053759
1123 Ga0439448_0004176
1124 Ga0439455_0007771
1125 Ga0439435_0010658
1126 Ga0439459_0001438
1127 Ga0453683_0145896
1128 Ga0453684_0024987
1129 Ga0453684_0044458
1130 Ga0453684_0118800
1131 Ga0451576_0013928
1132 Ga0451576_0096177
1133 Ga0451576_0114735
1134 Ga0451576_0330853
1135 Ga0466967_0115201
1136 Ga0495629_0133906
1137 Ga0495580_0183515
1138 Ga0495582_0108882
1139 Ga0495666_0116869
1140 Ga0495642_0005919
1141 Ga0495667_0197717
1142 Ga0495668_0574097
1143 Ga0495659_0011152
1144 Ga0495659_0285377
1145 Ga0495647_0060832
1146 Ga0495658_0149634
1147 Ga0495658_0177274
1148 Ga0495669_0002962
1149 Ga0495669_0049626
1150 Ga0495670_0141582
1151 Ga0496100_0024113
1152 Ga0496101_0002361
1153 Ga0496102_0025575
1154 Ga0496104_0028294
1155 Ga0496105_0117974
1156 Ga0496106_0118211
1157 Ga0496106_0210645
1158 Ga0496106_0738999
1159 Ga0496107_0166343
1160 Ga0496109_0416837
1161 Ga0496110_0067211
1162 Ga0496112_0194668
1163 Ga0496113_0016688
1164 Ga0496113_0218903
1165 Ga0496113_0449151
1166 Ga0496114_0000662
1167 Ga0496114_0056948
1168 Ga0496115_0151968
1169 Ga0501031_0390137
1170 Ga0501031_0411782
1171 Ga0501032_0091746
1172 Ga0501033_0033926
1173 Ga0501033_0054197
1174 Ga0501036_0106491
1175 Ga0501036_0108237
1176 Ga0501036_0667531
1177 Ga0501036_0730994
1178 Ga0501037_0021038
1179 Ga0501038_0042258
1180 Ga0501038_0312863
1181 Ga0501038_0382429
1182 Ga0501039_0065686
1183 Ga0501040_0054686
1184 Ga0501041_0099497
1185 Ga0501041_0382757
1186 Ga0501042_0045773
1187 Ga0501042_0096712
1188 Ga0501043_0189962
1189 Ga0501043_0207197
1190 Ga0501046_0118155
1191 Ga0501046_0138053
1192 Ga0501048_0042614
1193 Ga0501068_0257813
1194 Ga0501071_0085535
1195 Ga0501071_0093329
1196 Ga0501071_0215862
1197 Ga0501072_0046365
1198 Ga0501072_0110841
1199 Ga0501072_0116787
1200 Ga0501072_0150372
1201 Ga0501072_0263102
1202 Ga0501072_0335758
1203 Ga0501074_0070646
1204 Ga0501074_0154083
1205 Ga0501074_0360616
1206 Ga0501074_0875138
1207 Ga0501075_0014805
1208 Ga0501075_0064467
1209 Ga0501075_0099371
1210 Ga0501075_0353548
1211 Ga0501075_0702156
1212 Ga0501076_0003002
1213 Ga0501076_0153702
1214 Ga0501077_0022750
1215 Ga0501077_0023590
1216 Ga0501077_0057624
1217 Ga0501077_0060830
1218 Ga0501077_0114015
1219 Ga0501077_0257768
1220 Ga0501077_0279619
1221 Ga0501079_0014421
1222 Ga0501079_0113917
1223 Ga0501079_0128959
1224 Ga0501079_0144985
1225 Ga0501079_0199031
1226 Ga0501079_0618332
1227 Ga0501080_0022453
1228 Ga0501080_0266965
1229 Ga0501080_0396881
1230 Ga0501080_0486361
1231 Ga0501080_0521991
1232 Ga0501080_0649153
1233 Ga0501081_0000139
1234 Ga0501081_0011338
1235 Ga0501081_0035591
1236 Ga0501081_0038536
1237 Ga0501081_0043067
1238 Ga0501081_0454228
1239 Ga0501081_0897341
1240 Ga0501083_0156638
1241 Ga0501083_0269405
1242 Ga0501035_0212154
1243 Ga0501045_0013809
1244 Ga0501045_0017328
1245 Ga0501045_0546240
1246 Ga0501045_0917479
1247 nmdc:mga03683_21100_c1
1248 nmdc:mga00v17_275228_c1
1249 nmdc:mga00v17_8292_c1
1250 nmdc:mga0yw44_23313_c1
1251 nmdc:mga0yw44_500328_c1
1252 nmdc:mga0k408_80655_c1
1253 nmdc:mga06z11_118978_c1
1254 nmdc:mga07m45_224205_c1
1255 nmdc:mga05p37_114251_c1
1256 nmdc:mga05p37_17459_c1
1257 nmdc:mga05p37_211518_c1
1258 nmdc:mga05p37_21604_c1
1259 nmdc:mga05p37_218844_c1
1260 nmdc:mga05p37_231383_c1
1261 nmdc:mga05p37_232218_c1
1262 nmdc:mga05p37_23979_c1
1263 nmdc:mga05p37_28236_c1
1264 nmdc:mga05p37_383875_c1
1265 nmdc:mga05p37_38_c1
1266 nmdc:mga05p37_40935_c2
1267 nmdc:mga05p37_478692_c1
1268 nmdc:mga05p37_66645_c1
1269 nmdc:mga05p37_69892_c1
1270 nmdc:mga05p37_73824_c1
1271 nmdc:mga09592_152332_c1
1272 nmdc:mga09592_220384_c1
1273 nmdc:mga09592_22434_c1
1274 nmdc:mga09592_227552_c1
1275 nmdc:mga09592_93440_c1
1276 nmdc:mga09592_962546_c1
1277 nmdc:mga09592_98103_c1
1278 nmdc:mga0qj67_107845_c1
1279 nmdc:mga0qj67_11698_c1
1280 nmdc:mga0qj67_224352_c1
1281 nmdc:mga0qj67_30194_c1
1282 nmdc:mga0qj67_521580_c1
1283 nmdc:mga0qj67_926091_c1
1284 nmdc:mga06r32_10522_c1
1285 nmdc:mga06r32_107178_c1
1286 nmdc:mga06r32_10829_c1
1287 nmdc:mga06r32_120361_c1
1288 nmdc:mga06r32_1333900_c1
1289 nmdc:mga06r32_16781_c1
1290 nmdc:mga06r32_220436_c1
1291 nmdc:mga06r32_257370_c1
1292 nmdc:mga06r32_3028_c1
1293 nmdc:mga06r32_312726_c1
1294 nmdc:mga06r32_439732_c1
1295 nmdc:mga06r32_540530_c1
1296 nmdc:mga06r32_88164_c1
1297 nmdc:mga06r32_901397_c1
1298 nmdc:mga06r32_99449_c1
1299 nmdc:mga08y16_1069626_c1
1300 nmdc:mga08y16_1129022_c1
1301 nmdc:mga08y16_1441_c1
1302 nmdc:mga08y16_23572_c1
1303 nmdc:mga08y16_374691_c1
1304 nmdc:mga08y16_40740_c1
1305 nmdc:mga08y16_931292_c1
1306 nmdc:mga0n895_187113_c1
1307 nmdc:mga0n895_21664_c1
1308 nmdc:mga0n895_218975_c1
1309 nmdc:mga0n895_3872_c1
1310 nmdc:mga0n895_484644_c1
1311 nmdc:mga0n895_542391_c1
1312 nmdc:mga0n895_58090_c1
1313 nmdc:mga0n895_659003_c1
1314 nmdc:mga0n895_746862_c1
1315 nmdc:mga0rr50_102466_c1
1316 nmdc:mga0rr50_13052_c1
1317 nmdc:mga0rr50_166858_c1
1318 nmdc:mga0rr50_27643_c1
1319 nmdc:mga0rr50_682448_c1
1320 nmdc:mga08x19_127221_c1
1321 nmdc:mga08x19_142726_c1
1322 nmdc:mga08x19_16091_c1
1323 nmdc:mga08x19_451963_c1
1324 nmdc:mga08x19_89270_c1
1325 nmdc:mga0a205_112513_c1
1326 nmdc:mga0a205_124760_c1
1327 nmdc:mga0a205_13653_c1
1328 nmdc:mga0a205_27192_c1
1329 nmdc:mga0a205_272359_c1
1330 nmdc:mga0a205_36479_c1
1331 nmdc:mga0a205_401499_c1
1332 nmdc:mga0a205_59482_c1
1333 nmdc:mga0a205_77221_c1
1334 Ga0495601_0364635
1335 Ga0500628_030759
1336 Ga0501084_0011317
1337 Ga0501084_0011615
1338 Ga0501084_0015966
1339 Ga0501084_0042879
1340 Ga0590071_000535
1341 Ga0590074_004009
1342 Ga0590075_020418
1343 Ga0590075_041181
1344 Ga0590077_000151
1345 Ga0501082_0000526
1346 Ga0501082_0050072
1347 Ga0501082_0281222
1348 Ga0530510_0000479
1349 Ga0530510_0024895
1350 Ga0530510_0081376
1351 Ga0530510_0172504
1352 Ga0530510_0324779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01227

GTP_cyclohydroI

GTP cyclohydrolase I

8

180

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7alc-assembly1.cif.gz_D-2 human gch-gfrp stimulatory complex 0.9849 2 179
7ala-assembly1.cif.gz_E-2 human gch-gfrp inhibitory complex 0.9825 2 179
7alc-assembly1.cif.gz_E-2 human gch-gfrp stimulatory complex 0.9791 2 179
6z89-assembly1.cif.gz_C-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9782 50 179
7alb-assembly2.cif.gz_N human gch-gfrp stimulatory complex 7-deaza-gtp bound 0.9773 2 179
ID Description Score Start End Superfamily
4uqfG01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.973 2 42 1.10.286.10
1is8H01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9719 2 45 1.10.286.10
1is8C01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9717 2 45 1.10.286.10
1wplG01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9687 2 45 1.10.286.10
1is8A01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9681 2 45 1.10.286.10
ID Description Score Start End GO Terms
AF-A0A1Q7H790-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9937 2 145 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A7C7VRZ5-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9919 2 147 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A2V6IM09-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9887 2 146 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A6L5C482-F1-model_v4 deleted 0.9875 2 141
AF-Q968X9-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) 0.9875 2 145 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0008270
GO:0046654

Map