F474482

General Info

Members Datasets Scaffolds Average Seq Length
676 299 1352 161

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10019728|JGI25406J46586_100197282
Length 178
Sequence MLDMDSRSSPQGGDMAFFSVAIGKDHLRFTAAHFIAFRGFREPLHGHTYQVRVTVSGPVGADGYVVDFLALKKIAEEEVARLHFRTLLPQQSDCLVIEESAAQVAVHCEDGAYFVFPRDDVYFLPIVHSSSEEIAQHLVARIRERLRDVRGASIQTIEVLIEDIPGQEAVCREDFFVR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
173 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
185 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
186 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
256 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
257 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
258 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
259 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
260 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
261 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
262 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
263 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
264 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
265 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
266 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
267 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
268 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
269 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
270 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
271 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
274 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
275 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
276 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
277 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
278 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
279 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
280 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
295 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
296 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
297 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.47
Rhizosphere 89.79
Stem 0
Stem Tuber 0
Unclassified 27.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10019728 3300003203 Eukaryota 2739
2 rootH1_10081511 3300003316 Bacteria 7564
3 rootL2_10312855 3300003322 Unclassified 2057
4 Ga0058860_10050693 3300004801 Bacteria 5059
5 Ga0065715_10231613 3300005293 Bacteria 1232
6 Ga0065707_10398287 3300005295 Bacteria 856
7 Ga0065707_10576674 3300005295 Archaea 704
8 Ga0070676_10000316 3300005328 Bacteria 21893
9 Ga0070690_100036711 3300005330 Bacteria 3082
10 Ga0070690_100893466 3300005330 Unclassified 694
11 Ga0070677_10003999 3300005333 Bacteria 4794
12 Ga0070677_10194069 3300005333 Bacteria 975
13 Ga0068869_100006197 3300005334 Bacteria 7572
14 Ga0068869_100772643 3300005334 Unclassified 824
15 Ga0070666_10019402 3300005335 Bacteria 4389
16 Ga0070680_100086953 3300005336 Bacteria 2585
17 Ga0070680_100332820 3300005336 Bacteria 1290
18 Ga0070680_101559978 3300005336 Unclassified 572
19 Ga0070682_100086762 3300005337 Bacteria 2039
20 Ga0070682_100106291 3300005337 Bacteria 1862
21 Ga0070660_100412222 3300005339 Bacteria 1118
22 Ga0070660_100747790 3300005339 Bacteria 821
23 Ga0070689_100063553 3300005340 Bacteria 2872
24 Ga0070689_101712215 3300005340 Bacteria 572
25 Ga0070691_10008511 3300005341 Bacteria 4697
26 Ga0070661_100549352 3300005344 Unclassified 929
27 Ga0070692_10344478 3300005345 Bacteria 924
28 Ga0070692_10524349 3300005345 Bacteria 772
29 Ga0070668_100878559 3300005347 Bacteria 800
30 Ga0070669_100022675 3300005353 Bacteria 4490
31 Ga0070669_100091795 3300005353 Bacteria 2278
32 Ga0070669_100935199 3300005353 Bacteria 741
33 Ga0070675_100011526 3300005354 Bacteria 6925
34 Ga0070675_100373959 3300005354 Bacteria 1267
35 Ga0070671_100011492 3300005355 Bacteria 7119
36 Ga0070671_100259542 3300005355 Bacteria 1477
37 Ga0070671_101026295 3300005355 Bacteria 723
38 Ga0070674_100000162 3300005356 Bacteria 30827
39 Ga0070673_100097922 3300005364 Bacteria 2409
40 Ga0070673_100134917 3300005364 Unclassified 2076
41 Ga0070673_100232987 3300005364 Bacteria 1598
42 Ga0070667_100007846 3300005367 Bacteria 8852
43 Ga0070667_100155082 3300005367 Bacteria 2014
44 Ga0070667_100171412 3300005367 Unclassified 1916
45 Ga0070709_10434468 3300005434 Unclassified 986
46 Ga0070714_100603417 3300005435 Bacteria 1054
47 Ga0070713_100346307 3300005436 Unclassified 1378
48 Ga0070713_102028340 3300005436 Unclassified 558
49 Ga0070710_10215826 3300005437 Bacteria 1218
50 Ga0070701_10182122 3300005438 Bacteria 1231
51 Ga0070711_100385584 3300005439 Unclassified 1134
52 Ga0070711_100499377 3300005439 Bacteria 1003
53 Ga0070705_100000832 3300005440 Bacteria 17343
54 Ga0070705_100005876 3300005440 Bacteria 6000
55 Ga0070705_100618573 3300005440 Unclassified 840
56 Ga0070700_100046301 3300005441 Bacteria 2686
57 Ga0070700_100130553 3300005441 Unclassified 1695
58 Ga0070700_100235012 3300005441 Unclassified 1307
59 Ga0070694_100030607 3300005444 Bacteria 3522
60 Ga0070694_100093146 3300005444 Bacteria 2117
61 Ga0070694_100185201 3300005444 Unclassified 1542
62 Ga0070694_101324417 3300005444 Unclassified 606
63 Ga0070708_100006105 3300005445 Bacteria 9585
64 Ga0070708_100017009 3300005445 Bacteria 6053
65 Ga0070708_100488338 3300005445 Unclassified 1162
66 Ga0070708_100533728 3300005445 Bacteria 1107
67 Ga0070708_100572637 3300005445 Bacteria 1065
68 Ga0070678_100639649 3300005456 Bacteria 953
69 Ga0070662_100000221 3300005457 Bacteria 33516
70 Ga0070662_100179493 3300005457 Bacteria 1668
71 Ga0070662_100320297 3300005457 Unclassified 1264
72 Ga0070681_10029829 3300005458 Bacteria 5475
73 Ga0070681_11074892 3300005458 Unclassified 725
74 Ga0068867_100008237 3300005459 Bacteria 7362
75 Ga0068867_100187358 3300005459 Unclassified 1649
76 Ga0070706_100010912 3300005467 Bacteria 8435
77 Ga0070706_100063982 3300005467 Bacteria 3399
78 Ga0070706_100313624 3300005467 Unclassified 1463
79 Ga0070706_100386557 3300005467 Unclassified 1303
80 Ga0070706_100522408 3300005467 Bacteria 1104
81 Ga0070706_100531804 3300005467 Bacteria 1094
82 Ga0070706_100667116 3300005467 Unclassified 965
83 Ga0070707_100009174 3300005468 Bacteria 9178
84 Ga0070707_100040674 3300005468 Bacteria 4447
85 Ga0070707_100197019 3300005468 Bacteria 1963
86 Ga0070707_101415077 3300005468 Bacteria 662
87 Ga0070698_100172029 3300005471 Bacteria 2106
88 Ga0070698_100680333 3300005471 Unclassified 971
89 Ga0070699_100602450 3300005518 Bacteria 1002
90 Ga0070699_100711685 3300005518 Unclassified 918
91 Ga0070679_100018633 3300005530 Bacteria 6739
92 Ga0070679_100955141 3300005530 Bacteria 801
93 Ga0070697_100219906 3300005536 Unclassified 1619
94 Ga0070697_100238695 3300005536 Bacteria 1552
95 Ga0070697_100613008 3300005536 Unclassified 957
96 Ga0068853_100162554 3300005539 Bacteria 2016
97 Ga0068853_100822448 3300005539 Archaea 890
98 Ga0070672_100065536 3300005543 Bacteria 2874
99 Ga0070672_100494839 3300005543 Bacteria 1057
100 Ga0070672_100799813 3300005543 Bacteria 830
101 Ga0070686_100028710 3300005544 Bacteria 3376
102 Ga0070686_100500615 3300005544 Unclassified 943
103 Ga0070695_100001221 3300005545 Bacteria 14130
104 Ga0070696_100003268 3300005546 Bacteria 10812
105 Ga0070696_100036660 3300005546 Bacteria 3382
106 Ga0070696_100038001 3300005546 Bacteria 3321
107 Ga0070696_100043686 3300005546 Bacteria 3101
108 Ga0070696_100107081 3300005546 Bacteria 2010
109 Ga0070696_100134043 3300005546 Unclassified 1805
110 Ga0070696_100478508 3300005546 Unclassified 987
111 Ga0070696_100756219 3300005546 Unclassified 797
112 Ga0070696_100959956 3300005546 Bacteria 712
113 Ga0070693_100011432 3300005547 Bacteria 4471
114 Ga0070704_100029677 3300005549 Bacteria 3655
115 Ga0070704_100033075 3300005549 Bacteria 3494
116 Ga0070704_100142810 3300005549 Bacteria 1871
117 Ga0070704_101031444 3300005549 Unclassified 745
118 Ga0068855_100032967 3300005563 Bacteria 6184
119 Ga0070664_100272293 3300005564 Bacteria 1525
120 Ga0070664_100505681 3300005564 Bacteria 1114
121 Ga0068857_100004046 3300005577 Bacteria 12344
122 Ga0068857_100069735 3300005577 Bacteria 3130
123 Ga0068854_100009465 3300005578 Bacteria 6291
124 Ga0070702_100509420 3300005615 Archaea 885
125 Ga0068859_101240213 3300005617 Archaea 821
126 Ga0068864_100027217 3300005618 Unclassified 4826
127 Ga0068864_100273735 3300005618 Bacteria 1574
128 Ga0068864_100300848 3300005618 Unclassified 1502
129 Ga0068864_100580852 3300005618 Bacteria 1086
130 Ga0068866_10002512 3300005718 Bacteria 7558
131 Ga0068866_10551202 3300005718 Unclassified 771
132 Ga0068861_101243991 3300005719 Unclassified 722
133 Ga0068861_101479799 3300005719 Unclassified 666
134 Ga0068870_10007826 3300005840 Bacteria 4779
135 Ga0068870_10221064 3300005840 Bacteria 1159
136 Ga0068863_100118740 3300005841 Bacteria 2521
137 Ga0068863_101404578 3300005841 Bacteria 706
138 Ga0068858_100209802 3300005842 Unclassified 1843
139 Ga0068858_100234843 3300005842 Bacteria 1739
140 Ga0068858_100241862 3300005842 Unclassified 1713
141 Ga0068860_100034901 3300005843 Bacteria 4825
142 Ga0081455_10057340 3300005937 Unclassified 3301
143 Ga0081539_10002359 3300005985 Bacteria 27116
144 Ga0081539_10427625 3300005985 Unclassified 549
145 Ga0070715_10303270 3300006163 Unclassified 855
146 Ga0070716_100305061 3300006173 Unclassified 1109
147 Ga0097621_100037627 3300006237 Bacteria 3879
148 Ga0097621_100460252 3300006237 Unclassified 1147
149 Ga0068871_100077175 3300006358 Bacteria 2753
150 Ga0075428_100065007 3300006844 Bacteria 3995
151 Ga0075428_100195606 3300006844 Bacteria 2187
152 Ga0075428_100301117 3300006844 Bacteria 1724
153 Ga0075428_100491466 3300006844 Bacteria 1313
154 Ga0075428_101985639 3300006844 Unclassified 603
155 Ga0075430_100190896 3300006846 Bacteria 1703
156 Ga0075431_100052239 3300006847 Bacteria 4214
157 Ga0075431_100279856 3300006847 Bacteria 1689
158 Ga0075431_100350607 3300006847 Unclassified 1484
159 Ga0075431_100760044 3300006847 Bacteria 944
160 Ga0075433_10023328 3300006852 Bacteria 5206
161 Ga0075433_10052531 3300006852 Bacteria 3551
162 Ga0075433_10099300 3300006852 Unclassified 2577
163 Ga0075434_100050189 3300006871 Bacteria 4144
164 Ga0075434_100153575 3300006871 Bacteria 2322
165 Ga0075434_100219218 3300006871 Bacteria 1922
166 Ga0075434_100248244 3300006871 Bacteria 1799
167 Ga0075434_100250059 3300006871 Unclassified 1792
168 Ga0075434_100289461 3300006871 Unclassified 1658
169 Ga0075429_100008628 3300006880 Bacteria 8866
170 Ga0075429_100615235 3300006880 Bacteria 952
171 Ga0068865_100039301 3300006881 Bacteria 3209
172 Ga0068865_100985080 3300006881 Unclassified 737
173 Ga0075436_100051335 3300006914 Bacteria 2846
174 Ga0075436_100644060 3300006914 Unclassified 782
175 Ga0075436_100780903 3300006914 Bacteria 710
176 Ga0097620_101240545 3300006931 Archaea 821
177 Ga0075435_100238129 3300007076 Bacteria 1547
178 Ga0075435_100518430 3300007076 Bacteria 1031
179 Ga0105240_10052398 3300009093 Bacteria 5131
180 Ga0111539_10030838 3300009094 Bacteria 6518
181 Ga0111539_10702311 3300009094 Bacteria 1177
182 Ga0111539_11209130 3300009094 Unclassified 878
183 Ga0105245_10020564 3300009098 Bacteria 5788
184 Ga0105245_11938566 3300009098 Bacteria 642
185 Ga0105247_10067992 3300009101 Bacteria 2221
186 Ga0114129_10001846 3300009147 Bacteria 28863
187 Ga0114129_10169257 3300009147 Bacteria 2980
188 Ga0114129_10207332 3300009147 Bacteria 2652
189 Ga0114129_10880394 3300009147 Unclassified 1136
190 Ga0114129_11345085 3300009147 Bacteria 883
191 Ga0105241_10029502 3300009174 Bacteria 4094
192 Ga0105242_10001092 3300009176 Bacteria 21335
193 Ga0105242_10871820 3300009176 Unclassified 898
194 Ga0105248_10000907 3300009177 Bacteria 33063
195 Ga0105248_10049079 3300009177 Bacteria 4735
196 Ga0105248_10094739 3300009177 Bacteria 3361
197 Ga0105248_10350357 3300009177 Unclassified 1662
198 Ga0105237_11102133 3300009545 Unclassified 801
199 Ga0105238_10592786 3300009551 Bacteria 1116
200 Ga0105249_10027117 3300009553 Bacteria 5168
201 Ga0105249_10050069 3300009553 Bacteria 3809
202 Ga0105249_10112311 3300009553 Bacteria 2577
203 Ga0105249_10169472 3300009553 Unclassified 2116
204 Ga0105249_11826672 3300009553 Unclassified 680
205 Ga0105239_10036630 3300010375 Bacteria 5385
206 Ga0105239_10040582 3300010375 Bacteria 5099
207 Ga0105239_10606918 3300010375 Bacteria 1248
208 Ga0105239_11504858 3300010375 Bacteria 778
209 Ga0105246_10032663 3300011119 Bacteria 3453
210 Ga0105246_11027497 3300011119 Bacteria 748
211 Ga0105246_11058697 3300011119 Bacteria 738
212 Ga0157371_10264487 3300013102 Bacteria 1240
213 Ga0157378_10005156 3300013297 Bacteria 11469
214 Ga0157378_10490012 3300013297 Unclassified 1226
215 Ga0163162_10008376 3300013306 Bacteria 10081
216 Ga0163162_10026144 3300013306 Bacteria 5768
217 Ga0163162_10041422 3300013306 Bacteria 4608
218 Ga0163162_10063915 3300013306 Bacteria 3724
219 Ga0157372_10849489 3300013307 Bacteria 1060
220 Ga0157372_11012111 3300013307 Bacteria 962
221 Ga0157375_10034591 3300013308 Bacteria 4815
222 Ga0157375_10072177 3300013308 Bacteria 3468
223 Ga0157375_10308242 3300013308 Bacteria 1747
224 Ga0163163_10167567 3300014325 Bacteria 2243
225 Ga0163163_12330262 3300014325 Unclassified 594
226 Ga0157380_10003718 3300014326 Bacteria 10488
227 Ga0157380_10133367 3300014326 Bacteria 2122
228 Ga0157380_10398267 3300014326 Bacteria 1305
229 Ga0157379_10058242 3300014968 Unclassified 3453
230 Ga0157379_10725781 3300014968 Unclassified 934
231 Ga0157376_10054407 3300014969 Bacteria 3336
232 Ga0157376_10077441 3300014969 Unclassified 2844
233 Ga0163161_10115943 3300017792 Bacteria 2008
234 Ga0207697_10075104 3300025315 Bacteria 1420
235 Ga0207697_10143231 3300025315 Bacteria 1037
236 Ga0207682_10063348 3300025893 Unclassified 1552
237 Ga0207682_10178316 3300025893 Bacteria 969
238 Ga0207642_10006023 3300025899 Bacteria 4005
239 Ga0207642_10180540 3300025899 Unclassified 1150
240 Ga0207680_10090250 3300025903 Bacteria 1947
241 Ga0207647_10229077 3300025904 Bacteria 1069
242 Ga0207685_10283944 3300025905 Bacteria 813
243 Ga0207645_10000367 3300025907 Bacteria 37425
244 Ga0207645_10057496 3300025907 Bacteria 2483
245 Ga0207643_10002434 3300025908 Bacteria 10067
246 Ga0207684_10017041 3300025910 Bacteria 6240
247 Ga0207684_10211515 3300025910 Bacteria 1673
248 Ga0207684_10289844 3300025910 Bacteria 1411
249 Ga0207684_10741289 3300025910 Unclassified 833
250 Ga0207684_10797268 3300025910 Unclassified 799
251 Ga0207654_10003813 3300025911 Bacteria 7601
252 Ga0207707_10139798 3300025912 Bacteria 2117
253 Ga0207707_10494216 3300025912 Bacteria 1044
254 Ga0207695_10056126 3300025913 Bacteria 4100
255 Ga0207663_10509843 3300025916 Unclassified 935
256 Ga0207660_10126538 3300025917 Unclassified 1941
257 Ga0207660_10318007 3300025917 Bacteria 1242
258 Ga0207660_10351289 3300025917 Bacteria 1182
259 Ga0207657_10117458 3300025919 Bacteria 2191
260 Ga0207657_11139056 3300025919 Bacteria 595
261 Ga0207649_10428932 3300025920 Unclassified 994
262 Ga0207652_10265518 3300025921 Bacteria 1548
263 Ga0207652_10318626 3300025921 Bacteria 1404
264 Ga0207646_10015406 3300025922 Bacteria 7222
265 Ga0207646_10043473 3300025922 Bacteria 4035
266 Ga0207646_10104036 3300025922 Unclassified 2546
267 Ga0207646_10219126 3300025922 Unclassified 1719
268 Ga0207646_10686795 3300025922 Bacteria 916
269 Ga0207646_10884146 3300025922 Unclassified 793
270 Ga0207681_10003521 3300025923 Bacteria 9749
271 Ga0207681_10141518 3300025923 Bacteria 1792
272 Ga0207681_11042075 3300025923 Bacteria 687
273 Ga0207694_10449321 3300025924 Bacteria 1076
274 Ga0207659_10121468 3300025926 Unclassified 2002
275 Ga0207659_10325564 3300025926 Bacteria 1269
276 Ga0207659_10588302 3300025926 Bacteria 948
277 Ga0207659_10805312 3300025926 Bacteria 807
278 Ga0207687_10040114 3300025927 Bacteria 3208
279 Ga0207644_10753000 3300025931 Bacteria 814
280 Ga0207690_10941271 3300025932 Unclassified 717
281 Ga0207706_10000121 3300025933 Bacteria 83940
282 Ga0207706_10352390 3300025933 Unclassified 1280
283 Ga0207686_10000081 3300025934 Bacteria 80195
284 Ga0207686_10541591 3300025934 Unclassified 909
285 Ga0207709_10010880 3300025935 Bacteria 5012
286 Ga0207670_10244277 3300025936 Unclassified 1384
287 Ga0207669_10007755 3300025937 Bacteria 4993
288 Ga0207704_10017762 3300025938 Bacteria 3697
289 Ga0207704_10293761 3300025938 Bacteria 1241
290 Ga0207704_11058683 3300025938 Unclassified 688
291 Ga0207691_10029903 3300025940 Bacteria 5095
292 Ga0207691_10142871 3300025940 Unclassified 2108
293 Ga0207691_11112808 3300025940 Unclassified 657
294 Ga0207711_10002289 3300025941 Bacteria 17181
295 Ga0207711_10094686 3300025941 Bacteria 2632
296 Ga0207711_10434553 3300025941 Bacteria 1222
297 Ga0207689_10001917 3300025942 Bacteria 19669
298 Ga0207661_11668317 3300025944 Unclassified 582
299 Ga0207679_10025032 3300025945 Bacteria 4100
300 Ga0207679_10323091 3300025945 Bacteria 1337
301 Ga0207679_10589669 3300025945 Bacteria 1000
302 Ga0207651_10086345 3300025960 Bacteria 2280
303 Ga0207651_10211499 3300025960 Bacteria 1561
304 Ga0207651_10349084 3300025960 Bacteria 1245
305 Ga0207712_10039573 3300025961 Unclassified 3231
306 Ga0207712_10496793 3300025961 Bacteria 1042
307 Ga0207712_10801865 3300025961 Bacteria 828
308 Ga0207668_10010535 3300025972 Bacteria 5589
309 Ga0207640_10000470 3300025981 Bacteria 24653
310 Ga0207640_10556455 3300025981 Unclassified 964
311 Ga0207658_10007465 3300025986 Bacteria 7450
312 Ga0207658_10134709 3300025986 Unclassified 1990
313 Ga0207658_10353119 3300025986 Bacteria 1281
314 Ga0207703_10040226 3300026035 Bacteria 3741
315 Ga0207703_10664009 3300026035 Unclassified 990
316 Ga0207703_10762035 3300026035 Bacteria 923
317 Ga0207639_10116461 3300026041 Bacteria 2188
318 Ga0207639_10641584 3300026041 Bacteria 982
319 Ga0207678_10218465 3300026067 Bacteria 1631
320 Ga0207678_10287235 3300026067 Unclassified 1412
321 Ga0207708_10053478 3300026075 Unclassified 3077
322 Ga0207708_10063238 3300026075 Bacteria 2827
323 Ga0207641_11153017 3300026088 Bacteria 774
324 Ga0207648_10000107 3300026089 Bacteria 80740
325 Ga0207648_10142432 3300026089 Bacteria 2113
326 Ga0207676_10001028 3300026095 Bacteria 21341
327 Ga0207676_10017014 3300026095 Bacteria 5267
328 Ga0207676_10350005 3300026095 Bacteria 1366
329 Ga0207674_10015420 3300026116 Bacteria 8396
330 Ga0207674_10094427 3300026116 Bacteria 2977
331 Ga0207674_11605742 3300026116 Unclassified 619
332 Ga0207675_100033916 3300026118 Bacteria 4757
333 Ga0207675_100101062 3300026118 Unclassified 2717
334 Ga0207675_101354370 3300026118 Unclassified 732
335 Ga0207683_10667058 3300026121 Bacteria 964
336 Ga0207683_11581519 3300026121 Unclassified 605
337 Ga0209970_1052019 3300027614 Bacteria 742
338 Ga0207428_10194625 3300027907 Bacteria 1527
339 Ga0207428_10205460 3300027907 Bacteria 1481
340 Ga0207428_10221541 3300027907 Unclassified 1418
341 Ga0268266_10437894 3300028379 Bacteria 1241
342 Ga0268265_10152825 3300028380 Bacteria 1949
343 Ga0268265_10279484 3300028380 Bacteria 1493
344 Ga0268265_10301552 3300028380 Bacteria 1443
345 Ga0268265_10461959 3300028380 Unclassified 1188
346 Ga0268264_10002811 3300028381 Bacteria 15205
347 Ga0268264_10505269 3300028381 Unclassified 1180
348 Ga0307408_100043200 3300031548 Unclassified 3206
349 Ga0307408_100047447 3300031548 Bacteria 3076
350 Ga0307408_100067471 3300031548 Bacteria 2631
351 Ga0307408_100142493 3300031548 Bacteria 1883
352 Ga0307408_100482761 3300031548 Bacteria 1081
353 Ga0307408_100835608 3300031548 Bacteria 838
354 Ga0307408_100903672 3300031548 Unclassified 808
355 Ga0307408_100915514 3300031548 Bacteria 803
356 Ga0307405_10016555 3300031731 Bacteria 4023
357 Ga0307405_10062701 3300031731 Bacteria 2355
358 Ga0307405_10380689 3300031731 Bacteria 1098
359 Ga0307405_10656454 3300031731 Bacteria 863
360 Ga0307413_10006839 3300031824 Bacteria 5245
361 Ga0307413_10011396 3300031824 Bacteria 4369
362 Ga0307413_10264332 3300031824 Bacteria 1284
363 Ga0307413_10282661 3300031824 Bacteria 1249
364 Ga0307413_10292241 3300031824 Bacteria 1232
365 Ga0307413_10366337 3300031824 Bacteria 1117
366 Ga0307410_10000581 3300031852 Bacteria 15012
367 Ga0307410_10018802 3300031852 Unclassified 4185
368 Ga0307410_10048296 3300031852 Bacteria 2849
369 Ga0307410_10063076 3300031852 Bacteria 2541
370 Ga0307410_10082294 3300031852 Bacteria 2264
371 Ga0307410_10092886 3300031852 Unclassified 2146
372 Ga0307410_10094783 3300031852 Bacteria 2127
373 Ga0307410_10307495 3300031852 Bacteria 1253
374 Ga0307410_10371125 3300031852 Unclassified 1149
375 Ga0307410_10376077 3300031852 Unclassified 1142
376 Ga0307406_10011559 3300031901 Bacteria 5016
377 Ga0307406_10031276 3300031901 Bacteria 3239
378 Ga0307406_10103177 3300031901 Bacteria 1947
379 Ga0307406_10197932 3300031901 Bacteria 1476
380 Ga0307406_10566871 3300031901 Bacteria 931
381 Ga0307406_10801828 3300031901 Unclassified 795
382 Ga0307407_10002900 3300031903 Bacteria 6858
383 Ga0307407_10365708 3300031903 Bacteria 1025
384 Ga0307407_10709436 3300031903 Unclassified 758
385 Ga0307407_10721901 3300031903 Unclassified 752
386 Ga0307412_10028295 3300031911 Bacteria 3505
387 Ga0307412_10157522 3300031911 Bacteria 1683
388 Ga0307409_100004424 3300031995 Bacteria 7891
389 Ga0307409_100029664 3300031995 Bacteria 3918
390 Ga0307409_100029738 3300031995 Bacteria 3914
391 Ga0307409_100240215 3300031995 Bacteria 1648
392 Ga0307409_100275711 3300031995 Bacteria 1551
393 Ga0307409_100319489 3300031995 Bacteria 1452
394 Ga0307409_100407046 3300031995 Bacteria 1301
395 Ga0307409_100538654 3300031995 Unclassified 1144
396 Ga0307409_100827928 3300031995 Unclassified 935
397 Ga0307409_101070251 3300031995 Bacteria 827
398 Ga0307409_101186320 3300031995 Unclassified 786
399 Ga0307416_100000301 3300032002 Bacteria 25445
400 Ga0307416_100024175 3300032002 Unclassified 4428
401 Ga0307416_100049489 3300032002 Unclassified 3342
402 Ga0307416_100113509 3300032002 Bacteria 2394
403 Ga0307416_100152034 3300032002 Bacteria 2124
404 Ga0307416_100162402 3300032002 Bacteria 2067
405 Ga0307416_100342118 3300032002 Bacteria 1509
406 Ga0307416_100342465 3300032002 Bacteria 1509
407 Ga0307416_100702225 3300032002 Bacteria 1101
408 Ga0307416_100742605 3300032002 Bacteria 1073
409 Ga0307416_101063999 3300032002 Bacteria 913
410 Ga0307414_10002345 3300032004 Bacteria 9895
411 Ga0307414_10007749 3300032004 Bacteria 6051
412 Ga0307414_10018217 3300032004 Unclassified 4316
413 Ga0307414_10027858 3300032004 Unclassified 3657
414 Ga0307414_10192008 3300032004 Bacteria 1653
415 Ga0307414_10262090 3300032004 Bacteria 1443
416 Ga0307414_10383305 3300032004 Bacteria 1216
417 Ga0307414_10427856 3300032004 Bacteria 1156
418 Ga0307414_10938201 3300032004 Unclassified 795
419 Ga0307411_10000425 3300032005 Bacteria 14357
420 Ga0307411_10004190 3300032005 Bacteria 6858
421 Ga0307411_10007295 3300032005 Bacteria 5614
422 Ga0307411_10007974 3300032005 Bacteria 5448
423 Ga0307411_10040645 3300032005 Bacteria 2952
424 Ga0307411_10341281 3300032005 Bacteria 1217
425 Ga0307411_10836082 3300032005 Unclassified 813
426 Ga0307415_100002039 3300032126 Bacteria 9968
427 Ga0307415_100003756 3300032126 Bacteria 7780
428 Ga0307415_100031276 3300032126 Unclassified 3427
429 Ga0307415_100083656 3300032126 Bacteria 2287
430 Ga0307415_100099119 3300032126 Bacteria 2132
431 Ga0307415_100124804 3300032126 Bacteria 1938
432 Ga0307415_100971915 3300032126 Bacteria 787
433 Ga0373959_0117638 3300034820 Unclassified 647
434 Ga0373949_0068499 3300035090 Unclassified 926
435 Ga0373960_0206731 3300035121 Bacteria 696
436 Ga0373961_0028301 3300035241 Unclassified 1544
437 Ga0373931_0009861 3300035691 Bacteria 4577
438 Ga0395905_0210481 3300037471 Bacteria 1822
439 Ga0395905_0563685 3300037471 Unclassified 1040
440 Ga0395901_0310577 3300038443 Unclassified 1633
441 Ga0242420_128971 3300038996 Unclassified 556
442 Ga0451793_0280683 3300041452 Unclassified 1287
443 Ga0451807_0455648 3300041486 Unclassified 1431
444 Ga0451833_0507750 3300041491 Unclassified 618
445 Ga0451853_1846957 3300041512 Unclassified 908
446 Ga0439446_0011436 3300042156 Bacteria 2410
447 Ga0439434_0143551 3300042435 Bacteria 788
448 Ga0439459_0062179 3300042438 Unclassified 846
449 Ga0451577_0023487 3300042876 Bacteria 5623
450 Ga0451577_0310175 3300042876 Bacteria 1430
451 Ga0451577_0343375 3300042876 Bacteria 1354
452 Ga0453683_0212726 3300044673 Bacteria 1228
453 Ga0453684_0164880 3300044712 Bacteria 2617
454 Ga0453684_0346494 3300044712 Bacteria 1676
455 Ga0451576_0254141 3300045051 Bacteria 1837
456 Ga0451576_1649660 3300045051 Unclassified 664
457 Ga0466967_0808593 3300045976 Bacteria 931
458 Ga0495603_0065268 3300046455 Bacteria 2145
459 Ga0495603_0361228 3300046455 Unclassified 833
460 Ga0495641_0014520 3300046461 Bacteria 4256
461 Ga0495651_0489689 3300046462 Bacteria 789
462 Ga0495580_0158431 3300046472 Unclassified 1567
463 Ga0495639_0423440 3300046475 Bacteria 674
464 Ga0495639_0436449 3300046475 Unclassified 664
465 Ga0495664_0049026 3300046477 Bacteria 2507
466 Ga0495594_0025662 3300046499 Bacteria 3168
467 Ga0495594_0029471 3300046499 Bacteria 2966
468 Ga0495618_0024144 3300046514 Bacteria 3762
469 Ga0495630_0044914 3300046517 Bacteria 3301
470 Ga0495640_0033767 3300046533 Bacteria 3633
471 Ga0495586_0005553 3300046535 Bacteria 6746
472 Ga0495621_0283777 3300046539 Unclassified 683
473 Ga0495622_0289492 3300046557 Unclassified 715
474 Ga0495633_0257896 3300046558 Unclassified 795
475 Ga0495667_0153238 3300046559 Bacteria 1484
476 Ga0495656_0477429 3300046615 Bacteria 659
477 Ga0495634_0013988 3300046642 Bacteria 5795
478 Ga0495647_0012629 3300046681 Bacteria 2912
479 Ga0495658_0371334 3300046683 Unclassified 910
480 Ga0495613_0373316 3300046689 Bacteria 976
481 Ga0495674_0022355 3300047319 Bacteria 5833
482 Ga0495676_0213883 3300047321 Bacteria 1332
483 Ga0495680_0013290 3300047322 Bacteria 7190
484 Ga0495684_0105240 3300047471 Bacteria 2132
485 Ga0496100_0078169 3300048903 Bacteria 2227
486 Ga0496100_0161426 3300048903 Bacteria 1607
487 Ga0496101_0046131 3300048904 Bacteria 3124
488 Ga0496101_0103059 3300048904 Bacteria 2138
489 Ga0496101_0143456 3300048904 Bacteria 1822
490 Ga0496102_0005252 3300048905 Bacteria 10996
491 Ga0496102_0015476 3300048905 Bacteria 6645
492 Ga0496102_0026151 3300048905 Bacteria 5202
493 Ga0496102_0039337 3300048905 Bacteria 4273
494 Ga0496103_0016984 3300048906 Bacteria 4349
495 Ga0496103_0125156 3300048906 Bacteria 1639
496 Ga0496103_0481903 3300048906 Bacteria 794
497 Ga0496103_0713457 3300048906 Bacteria 635
498 Ga0496104_0001703 3300048907 Bacteria 18985
499 Ga0496104_0070831 3300048907 Unclassified 3315
500 Ga0496104_0108043 3300048907 Bacteria 2666
501 Ga0496104_0126307 3300048907 Bacteria 2456
502 Ga0496104_0327759 3300048907 Unclassified 1444
503 Ga0496104_0387360 3300048907 Bacteria 1310
504 Ga0496105_0060895 3300048908 Unclassified 3115
505 Ga0496105_0261298 3300048908 Unclassified 1400
506 Ga0496105_0370517 3300048908 Bacteria 1141
507 Ga0496106_0004623 3300048909 Bacteria 10209
508 Ga0496106_0009898 3300048909 Bacteria 7039
509 Ga0496106_0107963 3300048909 Unclassified 2165
510 Ga0496106_0233816 3300048909 Bacteria 1468
511 Ga0496106_0555636 3300048909 Unclassified 921
512 Ga0496107_0007683 3300048910 Bacteria 7446
513 Ga0496107_0168629 3300048910 Bacteria 1624
514 Ga0496107_0915363 3300048910 Unclassified 639
515 Ga0496108_0000426 3300048911 Bacteria 34037
516 Ga0496108_0000573 3300048911 Bacteria 28745
517 Ga0496108_0004627 3300048911 Bacteria 11091
518 Ga0496108_0016790 3300048911 Bacteria 5980
519 Ga0496108_0093975 3300048911 Bacteria 2552
520 Ga0496109_0000596 3300048912 Bacteria 30229
521 Ga0496109_0003769 3300048912 Bacteria 12663
522 Ga0496109_0008246 3300048912 Bacteria 8846
523 Ga0496109_0014082 3300048912 Bacteria 6952
524 Ga0496109_0077845 3300048912 Bacteria 3052
525 Ga0496110_0002244 3300048913 Bacteria 14455
526 Ga0496110_0005269 3300048913 Bacteria 10120
527 Ga0496110_0007351 3300048913 Bacteria 8794
528 Ga0496110_0062740 3300048913 Bacteria 3283
529 Ga0496110_0285756 3300048913 Bacteria 1502
530 Ga0496111_0004937 3300048914 Bacteria 8473
531 Ga0496111_0024767 3300048914 Bacteria 4232
532 Ga0496111_0025388 3300048914 Bacteria 4182
533 Ga0496112_0004531 3300048915 Bacteria 11805
534 Ga0496112_0007174 3300048915 Bacteria 9869
535 Ga0496112_0010496 3300048915 Bacteria 8404
536 Ga0496112_0014112 3300048915 Bacteria 7397
537 Ga0496113_0000965 3300048916 Bacteria 15293
538 Ga0496113_0004825 3300048916 Bacteria 8340
539 Ga0496113_0005440 3300048916 Bacteria 7941
540 Ga0496113_0021171 3300048916 Bacteria 4584
541 Ga0496113_0813878 3300048916 Unclassified 742
542 Ga0496114_0003263 3300048917 Bacteria 12456
543 Ga0496114_0355442 3300048917 Unclassified 1296
544 Ga0496114_0407220 3300048917 Bacteria 1204
545 Ga0496115_0122769 3300048918 Bacteria 2138
546 Ga0496115_0152979 3300048918 Unclassified 1905
547 Ga0501298_060074 3300049521 Bacteria 804
548 Ga0501031_0037628 3300049568 Bacteria 3158
549 Ga0501032_0446313 3300049569 Bacteria 829
550 Ga0501033_0093441 3300049570 Bacteria 2200
551 Ga0501033_0150264 3300049570 Bacteria 1681
552 Ga0501034_0211055 3300049571 Unclassified 1897
553 Ga0501036_0036627 3300049572 Bacteria 4152
554 Ga0501038_0187889 3300049574 Unclassified 1664
555 Ga0501038_0229384 3300049574 Bacteria 1478
556 Ga0501039_0054202 3300049575 Bacteria 3104
557 Ga0501040_0009895 3300049576 Bacteria 6225
558 Ga0501040_0266602 3300049576 Bacteria 1222
559 Ga0501041_0116854 3300049577 Unclassified 1656
560 Ga0501041_0325710 3300049577 Bacteria 969
561 Ga0501042_0010630 3300049578 Bacteria 6182
562 Ga0501042_0071850 3300049578 Bacteria 2476
563 Ga0501046_0247152 3300049580 Bacteria 1314
564 Ga0501048_0073168 3300049582 Bacteria 2419
565 Ga0501048_0129649 3300049582 Unclassified 1783
566 Ga0501067_0073711 3300049583 Unclassified 1891
567 Ga0501067_0201989 3300049583 Bacteria 1107
568 Ga0501067_0236568 3300049583 Bacteria 1016
569 Ga0501069_0060756 3300049585 Unclassified 2110
570 Ga0501069_0073917 3300049585 Unclassified 1912
571 Ga0501069_0358502 3300049585 Bacteria 860
572 Ga0501070_0529526 3300049586 Bacteria 945
573 Ga0501071_0027731 3300049587 Bacteria 3986
574 Ga0501072_0016740 3300049588 Bacteria 5633
575 Ga0501072_0070322 3300049588 Bacteria 2764
576 Ga0501073_0042716 3300049589 Bacteria 3199
577 Ga0501073_0298422 3300049589 Bacteria 1112
578 Ga0501074_0007240 3300049590 Bacteria 8015
579 Ga0501075_0014329 3300049591 Bacteria 5681
580 Ga0501075_0042159 3300049591 Bacteria 3421
581 Ga0501076_0015841 3300049592 Bacteria 5703
582 Ga0501076_0110867 3300049592 Bacteria 2218
583 Ga0501076_0340440 3300049592 Unclassified 1231
584 Ga0501077_0000553 3300049593 Bacteria 22727
585 Ga0501077_0001357 3300049593 Bacteria 14723
586 Ga0501077_0221548 3300049593 Unclassified 1202
587 Ga0501077_0432784 3300049593 Bacteria 842
588 Ga0501209_007958 3300049656 Bacteria 2064
589 Ga0501209_015935 3300049656 Bacteria 1687
590 Ga0501209_031323 3300049656 Bacteria 1351
591 Ga0501214_007009 3300049659 Unclassified 1141
592 Ga0501216_000868 3300049660 Bacteria 3821
593 Ga0501217_005539 3300049661 Bacteria 2646
594 Ga0501217_070280 3300049661 Bacteria 952
595 Ga0501233_006433 3300049668 Bacteria 2206
596 Ga0501233_051709 3300049668 Bacteria 997
597 Ga0501236_026165 3300049670 Unclassified 896
598 Ga0501242_015879 3300049674 Unclassified 940
599 Ga0501243_003788 3300049675 Unclassified 2257
600 Ga0501247_004436 3300049677 Unclassified 1533
601 Ga0501249_009951 3300049679 Bacteria 1982
602 Ga0501249_054049 3300049679 Unclassified 924
603 Ga0501250_064956 3300049680 Unclassified 591
604 Ga0501255_050854 3300049684 Bacteria 634
605 Ga0501257_004942 3300049686 Bacteria 2921
606 Ga0501257_056540 3300049686 Bacteria 986
607 Ga0501259_078088 3300049688 Unclassified 722
608 Ga0501234_038479 3300049707 Bacteria 780
609 Ga0501234_051038 3300049707 Unclassified 689
610 Ga0501245_070513 3300049708 Unclassified 657
611 Ga0501079_0001648 3300049741 Bacteria 15901
612 Ga0501079_0014834 3300049741 Bacteria 5940
613 Ga0501079_0023403 3300049741 Bacteria 4740
614 Ga0501080_0032490 3300049742 Bacteria 4868
615 Ga0501081_0027233 3300049743 Bacteria 3856
616 Ga0501081_0058686 3300049743 Bacteria 2663
617 Ga0501083_0070532 3300049744 Bacteria 2324
618 Ga0501083_0411877 3300049744 Bacteria 879
619 Ga0501241_032908 3300049758 Unclassified 984
620 Ga0501263_000186 3300049760 Unclassified 3782
621 Ga0501268_002479 3300049765 Bacteria 2437
622 Ga0501272_015738 3300049769 Unclassified 882
623 Ga0501275_031444 3300049772 Unclassified 704
624 Ga0501283_050455 3300049779 Unclassified 736
625 Ga0501035_0820818 3300049822 Unclassified 742
626 Ga0501045_0003788 3300049824 Bacteria 10401
627 Ga0501045_0116561 3300049824 Bacteria 1982
628 Ga0501045_0902418 3300049824 Unclassified 649
629 Ga0501204_020801 3300049850 Unclassified 855
630 nmdc:mga05p37_1561132_c1 3300050507 Unclassified 653
631 nmdc:mga05p37_1741_c1 3300050507 Bacteria 25395
632 nmdc:mga05p37_201630_c1 3300050507 Bacteria 2409
633 nmdc:mga05p37_569064_c1 3300050507 Unclassified 1286
634 nmdc:mga09592_67806_c1 3300050508 Unclassified 3026
635 nmdc:mga0qj67_1411250_c1 3300050509 Unclassified 537
636 nmdc:mga0qj67_21997_c1 3300050509 Bacteria 4894
637 nmdc:mga0qj67_411816_c1 3300050509 Bacteria 1090
638 nmdc:mga0qj67_454583_c1 3300050509 Bacteria 1031
639 nmdc:mga06r32_406131_c1 3300050510 Unclassified 1344
640 nmdc:mga06r32_680719_c1 3300050510 Bacteria 995
641 nmdc:mga06r32_6937_c1 3300050510 Bacteria 10188
642 nmdc:mga08y16_433252_c1 3300050511 Bacteria 1343
643 nmdc:mga08y16_73307_c1 3300050511 Bacteria 3567
644 nmdc:mga0n895_15839_c1 3300050512 Bacteria 6894
645 nmdc:mga0n895_227255_c1 3300050512 Unclassified 1894
646 nmdc:mga0n895_296571_c1 3300050512 Bacteria 1639
647 nmdc:mga0n895_47957_c1 3300050512 Bacteria 4179
648 nmdc:mga0n895_664731_c1 3300050512 Unclassified 1040
649 nmdc:mga0n895_845989_c1 3300050512 Bacteria 903
650 nmdc:mga0n895_949719_c1 3300050512 Unclassified 843
651 nmdc:mga0rr50_19458_c1 3300050513 Bacteria 4583
652 nmdc:mga0rr50_275951_c1 3300050513 Unclassified 1402
653 nmdc:mga0rr50_468458_c1 3300050513 Bacteria 1069
654 nmdc:mga08x19_107277_c1 3300050514 Bacteria 1859
655 nmdc:mga08x19_633693_c1 3300050514 Unclassified 758
656 nmdc:mga0a205_11688_c1 3300050515 Bacteria 8094
657 nmdc:mga0a205_16588_c1 3300050515 Bacteria 6899
658 nmdc:mga0a205_241976_c1 3300050515 Unclassified 1685
659 nmdc:mga0a205_38399_c1 3300050515 Bacteria 4606
660 Ga0501084_0020350 3300054114 Bacteria 5533
661 Ga0501084_0044412 3300054114 Bacteria 3720
662 Ga0501084_0101561 3300054114 Bacteria 2415
663 Ga0501084_0122941 3300054114 Bacteria 2183
664 Ga0501084_0149104 3300054114 Bacteria 1971
665 Ga0501084_1350039 3300054114 Unclassified 597
666 Ga0590071_000840 3300059421 Bacteria 8559
667 Ga0590071_001378 3300059421 Bacteria 6446
668 Ga0590071_012945 3300059421 Bacteria 1955
669 Ga0590074_027981 3300059423 Bacteria 988
670 Ga0590075_011464 3300059424 Unclassified 2144
671 Ga0590077_003333 3300059426 Unclassified 3339
672 Ga0590077_047320 3300059426 Bacteria 963
673 Ga0501082_0064827 3300060353 Bacteria 3146
674 Ga0501082_0115609 3300060353 Bacteria 2323
675 Ga0530510_0045789 3300061734 Bacteria 3160
676 Ga0530510_0261692 3300061734 Unclassified 1290
677 JGI25406J46586_10019728
678 rootH1_10081511
679 rootL2_10312855
680 Ga0058860_10050693
681 Ga0065715_10231613
682 Ga0065707_10398287
683 Ga0065707_10576674
684 Ga0070676_10000316
685 Ga0070690_100036711
686 Ga0070690_100893466
687 Ga0070677_10003999
688 Ga0070677_10194069
689 Ga0068869_100006197
690 Ga0068869_100772643
691 Ga0070666_10019402
692 Ga0070680_100086953
693 Ga0070680_100332820
694 Ga0070680_101559978
695 Ga0070682_100086762
696 Ga0070682_100106291
697 Ga0070660_100412222
698 Ga0070660_100747790
699 Ga0070689_100063553
700 Ga0070689_101712215
701 Ga0070691_10008511
702 Ga0070661_100549352
703 Ga0070692_10344478
704 Ga0070692_10524349
705 Ga0070668_100878559
706 Ga0070669_100022675
707 Ga0070669_100091795
708 Ga0070669_100935199
709 Ga0070675_100011526
710 Ga0070675_100373959
711 Ga0070671_100011492
712 Ga0070671_100259542
713 Ga0070671_101026295
714 Ga0070674_100000162
715 Ga0070673_100097922
716 Ga0070673_100134917
717 Ga0070673_100232987
718 Ga0070667_100007846
719 Ga0070667_100155082
720 Ga0070667_100171412
721 Ga0070709_10434468
722 Ga0070714_100603417
723 Ga0070713_100346307
724 Ga0070713_102028340
725 Ga0070710_10215826
726 Ga0070701_10182122
727 Ga0070711_100385584
728 Ga0070711_100499377
729 Ga0070705_100000832
730 Ga0070705_100005876
731 Ga0070705_100618573
732 Ga0070700_100046301
733 Ga0070700_100130553
734 Ga0070700_100235012
735 Ga0070694_100030607
736 Ga0070694_100093146
737 Ga0070694_100185201
738 Ga0070694_101324417
739 Ga0070708_100006105
740 Ga0070708_100017009
741 Ga0070708_100488338
742 Ga0070708_100533728
743 Ga0070708_100572637
744 Ga0070678_100639649
745 Ga0070662_100000221
746 Ga0070662_100179493
747 Ga0070662_100320297
748 Ga0070681_10029829
749 Ga0070681_11074892
750 Ga0068867_100008237
751 Ga0068867_100187358
752 Ga0070706_100010912
753 Ga0070706_100063982
754 Ga0070706_100313624
755 Ga0070706_100386557
756 Ga0070706_100522408
757 Ga0070706_100531804
758 Ga0070706_100667116
759 Ga0070707_100009174
760 Ga0070707_100040674
761 Ga0070707_100197019
762 Ga0070707_101415077
763 Ga0070698_100172029
764 Ga0070698_100680333
765 Ga0070699_100602450
766 Ga0070699_100711685
767 Ga0070679_100018633
768 Ga0070679_100955141
769 Ga0070697_100219906
770 Ga0070697_100238695
771 Ga0070697_100613008
772 Ga0068853_100162554
773 Ga0068853_100822448
774 Ga0070672_100065536
775 Ga0070672_100494839
776 Ga0070672_100799813
777 Ga0070686_100028710
778 Ga0070686_100500615
779 Ga0070695_100001221
780 Ga0070696_100003268
781 Ga0070696_100036660
782 Ga0070696_100038001
783 Ga0070696_100043686
784 Ga0070696_100107081
785 Ga0070696_100134043
786 Ga0070696_100478508
787 Ga0070696_100756219
788 Ga0070696_100959956
789 Ga0070693_100011432
790 Ga0070704_100029677
791 Ga0070704_100033075
792 Ga0070704_100142810
793 Ga0070704_101031444
794 Ga0068855_100032967
795 Ga0070664_100272293
796 Ga0070664_100505681
797 Ga0068857_100004046
798 Ga0068857_100069735
799 Ga0068854_100009465
800 Ga0070702_100509420
801 Ga0068859_101240213
802 Ga0068864_100027217
803 Ga0068864_100273735
804 Ga0068864_100300848
805 Ga0068864_100580852
806 Ga0068866_10002512
807 Ga0068866_10551202
808 Ga0068861_101243991
809 Ga0068861_101479799
810 Ga0068870_10007826
811 Ga0068870_10221064
812 Ga0068863_100118740
813 Ga0068863_101404578
814 Ga0068858_100209802
815 Ga0068858_100234843
816 Ga0068858_100241862
817 Ga0068860_100034901
818 Ga0081455_10057340
819 Ga0081539_10002359
820 Ga0081539_10427625
821 Ga0070715_10303270
822 Ga0070716_100305061
823 Ga0097621_100037627
824 Ga0097621_100460252
825 Ga0068871_100077175
826 Ga0075428_100065007
827 Ga0075428_100195606
828 Ga0075428_100301117
829 Ga0075428_100491466
830 Ga0075428_101985639
831 Ga0075430_100190896
832 Ga0075431_100052239
833 Ga0075431_100279856
834 Ga0075431_100350607
835 Ga0075431_100760044
836 Ga0075433_10023328
837 Ga0075433_10052531
838 Ga0075433_10099300
839 Ga0075434_100050189
840 Ga0075434_100153575
841 Ga0075434_100219218
842 Ga0075434_100248244
843 Ga0075434_100250059
844 Ga0075434_100289461
845 Ga0075429_100008628
846 Ga0075429_100615235
847 Ga0068865_100039301
848 Ga0068865_100985080
849 Ga0075436_100051335
850 Ga0075436_100644060
851 Ga0075436_100780903
852 Ga0097620_101240545
853 Ga0075435_100238129
854 Ga0075435_100518430
855 Ga0105240_10052398
856 Ga0111539_10030838
857 Ga0111539_10702311
858 Ga0111539_11209130
859 Ga0105245_10020564
860 Ga0105245_11938566
861 Ga0105247_10067992
862 Ga0114129_10001846
863 Ga0114129_10169257
864 Ga0114129_10207332
865 Ga0114129_10880394
866 Ga0114129_11345085
867 Ga0105241_10029502
868 Ga0105242_10001092
869 Ga0105242_10871820
870 Ga0105248_10000907
871 Ga0105248_10049079
872 Ga0105248_10094739
873 Ga0105248_10350357
874 Ga0105237_11102133
875 Ga0105238_10592786
876 Ga0105249_10027117
877 Ga0105249_10050069
878 Ga0105249_10112311
879 Ga0105249_10169472
880 Ga0105249_11826672
881 Ga0105239_10036630
882 Ga0105239_10040582
883 Ga0105239_10606918
884 Ga0105239_11504858
885 Ga0105246_10032663
886 Ga0105246_11027497
887 Ga0105246_11058697
888 Ga0157371_10264487
889 Ga0157378_10005156
890 Ga0157378_10490012
891 Ga0163162_10008376
892 Ga0163162_10026144
893 Ga0163162_10041422
894 Ga0163162_10063915
895 Ga0157372_10849489
896 Ga0157372_11012111
897 Ga0157375_10034591
898 Ga0157375_10072177
899 Ga0157375_10308242
900 Ga0163163_10167567
901 Ga0163163_12330262
902 Ga0157380_10003718
903 Ga0157380_10133367
904 Ga0157380_10398267
905 Ga0157379_10058242
906 Ga0157379_10725781
907 Ga0157376_10054407
908 Ga0157376_10077441
909 Ga0163161_10115943
910 Ga0207697_10075104
911 Ga0207697_10143231
912 Ga0207682_10063348
913 Ga0207682_10178316
914 Ga0207642_10006023
915 Ga0207642_10180540
916 Ga0207680_10090250
917 Ga0207647_10229077
918 Ga0207685_10283944
919 Ga0207645_10000367
920 Ga0207645_10057496
921 Ga0207643_10002434
922 Ga0207684_10017041
923 Ga0207684_10211515
924 Ga0207684_10289844
925 Ga0207684_10741289
926 Ga0207684_10797268
927 Ga0207654_10003813
928 Ga0207707_10139798
929 Ga0207707_10494216
930 Ga0207695_10056126
931 Ga0207663_10509843
932 Ga0207660_10126538
933 Ga0207660_10318007
934 Ga0207660_10351289
935 Ga0207657_10117458
936 Ga0207657_11139056
937 Ga0207649_10428932
938 Ga0207652_10265518
939 Ga0207652_10318626
940 Ga0207646_10015406
941 Ga0207646_10043473
942 Ga0207646_10104036
943 Ga0207646_10219126
944 Ga0207646_10686795
945 Ga0207646_10884146
946 Ga0207681_10003521
947 Ga0207681_10141518
948 Ga0207681_11042075
949 Ga0207694_10449321
950 Ga0207659_10121468
951 Ga0207659_10325564
952 Ga0207659_10588302
953 Ga0207659_10805312
954 Ga0207687_10040114
955 Ga0207644_10753000
956 Ga0207690_10941271
957 Ga0207706_10000121
958 Ga0207706_10352390
959 Ga0207686_10000081
960 Ga0207686_10541591
961 Ga0207709_10010880
962 Ga0207670_10244277
963 Ga0207669_10007755
964 Ga0207704_10017762
965 Ga0207704_10293761
966 Ga0207704_11058683
967 Ga0207691_10029903
968 Ga0207691_10142871
969 Ga0207691_11112808
970 Ga0207711_10002289
971 Ga0207711_10094686
972 Ga0207711_10434553
973 Ga0207689_10001917
974 Ga0207661_11668317
975 Ga0207679_10025032
976 Ga0207679_10323091
977 Ga0207679_10589669
978 Ga0207651_10086345
979 Ga0207651_10211499
980 Ga0207651_10349084
981 Ga0207712_10039573
982 Ga0207712_10496793
983 Ga0207712_10801865
984 Ga0207668_10010535
985 Ga0207640_10000470
986 Ga0207640_10556455
987 Ga0207658_10007465
988 Ga0207658_10134709
989 Ga0207658_10353119
990 Ga0207703_10040226
991 Ga0207703_10664009
992 Ga0207703_10762035
993 Ga0207639_10116461
994 Ga0207639_10641584
995 Ga0207678_10218465
996 Ga0207678_10287235
997 Ga0207708_10053478
998 Ga0207708_10063238
999 Ga0207641_11153017
1000 Ga0207648_10000107
1001 Ga0207648_10142432
1002 Ga0207676_10001028
1003 Ga0207676_10017014
1004 Ga0207676_10350005
1005 Ga0207674_10015420
1006 Ga0207674_10094427
1007 Ga0207674_11605742
1008 Ga0207675_100033916
1009 Ga0207675_100101062
1010 Ga0207675_101354370
1011 Ga0207683_10667058
1012 Ga0207683_11581519
1013 Ga0209970_1052019
1014 Ga0207428_10194625
1015 Ga0207428_10205460
1016 Ga0207428_10221541
1017 Ga0268266_10437894
1018 Ga0268265_10152825
1019 Ga0268265_10279484
1020 Ga0268265_10301552
1021 Ga0268265_10461959
1022 Ga0268264_10002811
1023 Ga0268264_10505269
1024 Ga0307408_100043200
1025 Ga0307408_100047447
1026 Ga0307408_100067471
1027 Ga0307408_100142493
1028 Ga0307408_100482761
1029 Ga0307408_100835608
1030 Ga0307408_100903672
1031 Ga0307408_100915514
1032 Ga0307405_10016555
1033 Ga0307405_10062701
1034 Ga0307405_10380689
1035 Ga0307405_10656454
1036 Ga0307413_10006839
1037 Ga0307413_10011396
1038 Ga0307413_10264332
1039 Ga0307413_10282661
1040 Ga0307413_10292241
1041 Ga0307413_10366337
1042 Ga0307410_10000581
1043 Ga0307410_10018802
1044 Ga0307410_10048296
1045 Ga0307410_10063076
1046 Ga0307410_10082294
1047 Ga0307410_10092886
1048 Ga0307410_10094783
1049 Ga0307410_10307495
1050 Ga0307410_10371125
1051 Ga0307410_10376077
1052 Ga0307406_10011559
1053 Ga0307406_10031276
1054 Ga0307406_10103177
1055 Ga0307406_10197932
1056 Ga0307406_10566871
1057 Ga0307406_10801828
1058 Ga0307407_10002900
1059 Ga0307407_10365708
1060 Ga0307407_10709436
1061 Ga0307407_10721901
1062 Ga0307412_10028295
1063 Ga0307412_10157522
1064 Ga0307409_100004424
1065 Ga0307409_100029664
1066 Ga0307409_100029738
1067 Ga0307409_100240215
1068 Ga0307409_100275711
1069 Ga0307409_100319489
1070 Ga0307409_100407046
1071 Ga0307409_100538654
1072 Ga0307409_100827928
1073 Ga0307409_101070251
1074 Ga0307409_101186320
1075 Ga0307416_100000301
1076 Ga0307416_100024175
1077 Ga0307416_100049489
1078 Ga0307416_100113509
1079 Ga0307416_100152034
1080 Ga0307416_100162402
1081 Ga0307416_100342118
1082 Ga0307416_100342465
1083 Ga0307416_100702225
1084 Ga0307416_100742605
1085 Ga0307416_101063999
1086 Ga0307414_10002345
1087 Ga0307414_10007749
1088 Ga0307414_10018217
1089 Ga0307414_10027858
1090 Ga0307414_10192008
1091 Ga0307414_10262090
1092 Ga0307414_10383305
1093 Ga0307414_10427856
1094 Ga0307414_10938201
1095 Ga0307411_10000425
1096 Ga0307411_10004190
1097 Ga0307411_10007295
1098 Ga0307411_10007974
1099 Ga0307411_10040645
1100 Ga0307411_10341281
1101 Ga0307411_10836082
1102 Ga0307415_100002039
1103 Ga0307415_100003756
1104 Ga0307415_100031276
1105 Ga0307415_100083656
1106 Ga0307415_100099119
1107 Ga0307415_100124804
1108 Ga0307415_100971915
1109 Ga0373959_0117638
1110 Ga0373949_0068499
1111 Ga0373960_0206731
1112 Ga0373961_0028301
1113 Ga0373931_0009861
1114 Ga0395905_0210481
1115 Ga0395905_0563685
1116 Ga0395901_0310577
1117 Ga0242420_128971
1118 Ga0451793_0280683
1119 Ga0451807_0455648
1120 Ga0451833_0507750
1121 Ga0451853_1846957
1122 Ga0439446_0011436
1123 Ga0439434_0143551
1124 Ga0439459_0062179
1125 Ga0451577_0023487
1126 Ga0451577_0310175
1127 Ga0451577_0343375
1128 Ga0453683_0212726
1129 Ga0453684_0164880
1130 Ga0453684_0346494
1131 Ga0451576_0254141
1132 Ga0451576_1649660
1133 Ga0466967_0808593
1134 Ga0495603_0065268
1135 Ga0495603_0361228
1136 Ga0495641_0014520
1137 Ga0495651_0489689
1138 Ga0495580_0158431
1139 Ga0495639_0423440
1140 Ga0495639_0436449
1141 Ga0495664_0049026
1142 Ga0495594_0025662
1143 Ga0495594_0029471
1144 Ga0495618_0024144
1145 Ga0495630_0044914
1146 Ga0495640_0033767
1147 Ga0495586_0005553
1148 Ga0495621_0283777
1149 Ga0495622_0289492
1150 Ga0495633_0257896
1151 Ga0495667_0153238
1152 Ga0495656_0477429
1153 Ga0495634_0013988
1154 Ga0495647_0012629
1155 Ga0495658_0371334
1156 Ga0495613_0373316
1157 Ga0495674_0022355
1158 Ga0495676_0213883
1159 Ga0495680_0013290
1160 Ga0495684_0105240
1161 Ga0496100_0078169
1162 Ga0496100_0161426
1163 Ga0496101_0046131
1164 Ga0496101_0103059
1165 Ga0496101_0143456
1166 Ga0496102_0005252
1167 Ga0496102_0015476
1168 Ga0496102_0026151
1169 Ga0496102_0039337
1170 Ga0496103_0016984
1171 Ga0496103_0125156
1172 Ga0496103_0481903
1173 Ga0496103_0713457
1174 Ga0496104_0001703
1175 Ga0496104_0070831
1176 Ga0496104_0108043
1177 Ga0496104_0126307
1178 Ga0496104_0327759
1179 Ga0496104_0387360
1180 Ga0496105_0060895
1181 Ga0496105_0261298
1182 Ga0496105_0370517
1183 Ga0496106_0004623
1184 Ga0496106_0009898
1185 Ga0496106_0107963
1186 Ga0496106_0233816
1187 Ga0496106_0555636
1188 Ga0496107_0007683
1189 Ga0496107_0168629
1190 Ga0496107_0915363
1191 Ga0496108_0000426
1192 Ga0496108_0000573
1193 Ga0496108_0004627
1194 Ga0496108_0016790
1195 Ga0496108_0093975
1196 Ga0496109_0000596
1197 Ga0496109_0003769
1198 Ga0496109_0008246
1199 Ga0496109_0014082
1200 Ga0496109_0077845
1201 Ga0496110_0002244
1202 Ga0496110_0005269
1203 Ga0496110_0007351
1204 Ga0496110_0062740
1205 Ga0496110_0285756
1206 Ga0496111_0004937
1207 Ga0496111_0024767
1208 Ga0496111_0025388
1209 Ga0496112_0004531
1210 Ga0496112_0007174
1211 Ga0496112_0010496
1212 Ga0496112_0014112
1213 Ga0496113_0000965
1214 Ga0496113_0004825
1215 Ga0496113_0005440
1216 Ga0496113_0021171
1217 Ga0496113_0813878
1218 Ga0496114_0003263
1219 Ga0496114_0355442
1220 Ga0496114_0407220
1221 Ga0496115_0122769
1222 Ga0496115_0152979
1223 Ga0501298_060074
1224 Ga0501031_0037628
1225 Ga0501032_0446313
1226 Ga0501033_0093441
1227 Ga0501033_0150264
1228 Ga0501034_0211055
1229 Ga0501036_0036627
1230 Ga0501038_0187889
1231 Ga0501038_0229384
1232 Ga0501039_0054202
1233 Ga0501040_0009895
1234 Ga0501040_0266602
1235 Ga0501041_0116854
1236 Ga0501041_0325710
1237 Ga0501042_0010630
1238 Ga0501042_0071850
1239 Ga0501046_0247152
1240 Ga0501048_0073168
1241 Ga0501048_0129649
1242 Ga0501067_0073711
1243 Ga0501067_0201989
1244 Ga0501067_0236568
1245 Ga0501069_0060756
1246 Ga0501069_0073917
1247 Ga0501069_0358502
1248 Ga0501070_0529526
1249 Ga0501071_0027731
1250 Ga0501072_0016740
1251 Ga0501072_0070322
1252 Ga0501073_0042716
1253 Ga0501073_0298422
1254 Ga0501074_0007240
1255 Ga0501075_0014329
1256 Ga0501075_0042159
1257 Ga0501076_0015841
1258 Ga0501076_0110867
1259 Ga0501076_0340440
1260 Ga0501077_0000553
1261 Ga0501077_0001357
1262 Ga0501077_0221548
1263 Ga0501077_0432784
1264 Ga0501209_007958
1265 Ga0501209_015935
1266 Ga0501209_031323
1267 Ga0501214_007009
1268 Ga0501216_000868
1269 Ga0501217_005539
1270 Ga0501217_070280
1271 Ga0501233_006433
1272 Ga0501233_051709
1273 Ga0501236_026165
1274 Ga0501242_015879
1275 Ga0501243_003788
1276 Ga0501247_004436
1277 Ga0501249_009951
1278 Ga0501249_054049
1279 Ga0501250_064956
1280 Ga0501255_050854
1281 Ga0501257_004942
1282 Ga0501257_056540
1283 Ga0501259_078088
1284 Ga0501234_038479
1285 Ga0501234_051038
1286 Ga0501245_070513
1287 Ga0501079_0001648
1288 Ga0501079_0014834
1289 Ga0501079_0023403
1290 Ga0501080_0032490
1291 Ga0501081_0027233
1292 Ga0501081_0058686
1293 Ga0501083_0070532
1294 Ga0501083_0411877
1295 Ga0501241_032908
1296 Ga0501263_000186
1297 Ga0501268_002479
1298 Ga0501272_015738
1299 Ga0501275_031444
1300 Ga0501283_050455
1301 Ga0501035_0820818
1302 Ga0501045_0003788
1303 Ga0501045_0116561
1304 Ga0501045_0902418
1305 Ga0501204_020801
1306 nmdc:mga05p37_1561132_c1
1307 nmdc:mga05p37_1741_c1
1308 nmdc:mga05p37_201630_c1
1309 nmdc:mga05p37_569064_c1
1310 nmdc:mga09592_67806_c1
1311 nmdc:mga0qj67_1411250_c1
1312 nmdc:mga0qj67_21997_c1
1313 nmdc:mga0qj67_411816_c1
1314 nmdc:mga0qj67_454583_c1
1315 nmdc:mga06r32_406131_c1
1316 nmdc:mga06r32_680719_c1
1317 nmdc:mga06r32_6937_c1
1318 nmdc:mga08y16_433252_c1
1319 nmdc:mga08y16_73307_c1
1320 nmdc:mga0n895_15839_c1
1321 nmdc:mga0n895_227255_c1
1322 nmdc:mga0n895_296571_c1
1323 nmdc:mga0n895_47957_c1
1324 nmdc:mga0n895_664731_c1
1325 nmdc:mga0n895_845989_c1
1326 nmdc:mga0n895_949719_c1
1327 nmdc:mga0rr50_19458_c1
1328 nmdc:mga0rr50_275951_c1
1329 nmdc:mga0rr50_468458_c1
1330 nmdc:mga08x19_107277_c1
1331 nmdc:mga08x19_633693_c1
1332 nmdc:mga0a205_11688_c1
1333 nmdc:mga0a205_16588_c1
1334 nmdc:mga0a205_241976_c1
1335 nmdc:mga0a205_38399_c1
1336 Ga0501084_0020350
1337 Ga0501084_0044412
1338 Ga0501084_0101561
1339 Ga0501084_0122941
1340 Ga0501084_0149104
1341 Ga0501084_1350039
1342 Ga0590071_000840
1343 Ga0590071_001378
1344 Ga0590071_012945
1345 Ga0590074_027981
1346 Ga0590075_011464
1347 Ga0590077_003333
1348 Ga0590077_047320
1349 Ga0501082_0064827
1350 Ga0501082_0115609
1351 Ga0530510_0045789
1352 Ga0530510_0261692

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

22

174

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lze-assembly1.cif.gz_A plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37c catalytic residue mutant 0.9308 16 175
2a0s-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydropterin synthase (ptps) from plasmodium vivax at 2.2 a resolution 0.9296 16 175
3m0n-assembly1.cif.gz_A plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37a catalytic residue mutant 0.9295 16 175
1y13-assembly1.cif.gz_A structural analysis of plasmodium falciparum 6-pyruvoyl tetrahydropterin synthase (ptps) 0.9234 17 175
3lze-assembly1.cif.gz_A plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37c catalytic residue mutant 0.9092 16 175
ID Description Score Start End Superfamily
1y13C00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9187 17 175 3.30.479.10
af_Q58668_4_160_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9125 28 175 3.30.479.10
1y13C00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8973 17 175 3.30.479.10
af_Q5I0E5_1_204_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8682 95 117 1.20.140.150
af_Q58668_4_160_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8576 28 175 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A3L7XJS4-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9709 67 176 GO:0070497
AF-A0A535SCS7-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9633 49 176 GO:0070497
AF-A0A3L7XJS4-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9622 67 176 GO:0070497
AF-A0A7Y4RQC4-F1-model_v4 Uncharacterized protein 0.9608 87 147
AF-A0A800EGC0-F1-model_v4 deleted 0.9559 74 176

Map