F474482
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 676 | 299 | 1352 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300003203|JGI25406J46586_10019728|JGI25406J46586_100197282 |
| Length | 178 |
| Sequence | MLDMDSRSSPQGGDMAFFSVAIGKDHLRFTAAHFIAFRGFREPLHGHTYQVRVTVSGPVGADGYVVDFLALKKIAEEEVARLHFRTLLPQQSDCLVIEESAAQVAVHCEDGAYFVFPRDDVYFLPIVHSSSEEIAQHLVARIRERLRDVRGASIQTIEVLIEDIPGQEAVCREDFFVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 161 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 163 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 164 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 165 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 166 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 178 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 179 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 180 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 183 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 184 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 185 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 186 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 187 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 188 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 189 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 190 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 220 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 221 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 222 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 223 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 224 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 227 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 228 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 229 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 230 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 231 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 232 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 233 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 256 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 257 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 258 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 259 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 260 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 261 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 262 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 263 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 264 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 265 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 266 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 267 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 268 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 269 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 271 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 276 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 277 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 278 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 279 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 280 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 281 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 295 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 296 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 297 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 298 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 9.47 |
| Rhizosphere | 89.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 27.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10019728 | 3300003203 | Eukaryota | 2739 |
| 2 | rootH1_10081511 | 3300003316 | Bacteria | 7564 |
| 3 | rootL2_10312855 | 3300003322 | Unclassified | 2057 |
| 4 | Ga0058860_10050693 | 3300004801 | Bacteria | 5059 |
| 5 | Ga0065715_10231613 | 3300005293 | Bacteria | 1232 |
| 6 | Ga0065707_10398287 | 3300005295 | Bacteria | 856 |
| 7 | Ga0065707_10576674 | 3300005295 | Archaea | 704 |
| 8 | Ga0070676_10000316 | 3300005328 | Bacteria | 21893 |
| 9 | Ga0070690_100036711 | 3300005330 | Bacteria | 3082 |
| 10 | Ga0070690_100893466 | 3300005330 | Unclassified | 694 |
| 11 | Ga0070677_10003999 | 3300005333 | Bacteria | 4794 |
| 12 | Ga0070677_10194069 | 3300005333 | Bacteria | 975 |
| 13 | Ga0068869_100006197 | 3300005334 | Bacteria | 7572 |
| 14 | Ga0068869_100772643 | 3300005334 | Unclassified | 824 |
| 15 | Ga0070666_10019402 | 3300005335 | Bacteria | 4389 |
| 16 | Ga0070680_100086953 | 3300005336 | Bacteria | 2585 |
| 17 | Ga0070680_100332820 | 3300005336 | Bacteria | 1290 |
| 18 | Ga0070680_101559978 | 3300005336 | Unclassified | 572 |
| 19 | Ga0070682_100086762 | 3300005337 | Bacteria | 2039 |
| 20 | Ga0070682_100106291 | 3300005337 | Bacteria | 1862 |
| 21 | Ga0070660_100412222 | 3300005339 | Bacteria | 1118 |
| 22 | Ga0070660_100747790 | 3300005339 | Bacteria | 821 |
| 23 | Ga0070689_100063553 | 3300005340 | Bacteria | 2872 |
| 24 | Ga0070689_101712215 | 3300005340 | Bacteria | 572 |
| 25 | Ga0070691_10008511 | 3300005341 | Bacteria | 4697 |
| 26 | Ga0070661_100549352 | 3300005344 | Unclassified | 929 |
| 27 | Ga0070692_10344478 | 3300005345 | Bacteria | 924 |
| 28 | Ga0070692_10524349 | 3300005345 | Bacteria | 772 |
| 29 | Ga0070668_100878559 | 3300005347 | Bacteria | 800 |
| 30 | Ga0070669_100022675 | 3300005353 | Bacteria | 4490 |
| 31 | Ga0070669_100091795 | 3300005353 | Bacteria | 2278 |
| 32 | Ga0070669_100935199 | 3300005353 | Bacteria | 741 |
| 33 | Ga0070675_100011526 | 3300005354 | Bacteria | 6925 |
| 34 | Ga0070675_100373959 | 3300005354 | Bacteria | 1267 |
| 35 | Ga0070671_100011492 | 3300005355 | Bacteria | 7119 |
| 36 | Ga0070671_100259542 | 3300005355 | Bacteria | 1477 |
| 37 | Ga0070671_101026295 | 3300005355 | Bacteria | 723 |
| 38 | Ga0070674_100000162 | 3300005356 | Bacteria | 30827 |
| 39 | Ga0070673_100097922 | 3300005364 | Bacteria | 2409 |
| 40 | Ga0070673_100134917 | 3300005364 | Unclassified | 2076 |
| 41 | Ga0070673_100232987 | 3300005364 | Bacteria | 1598 |
| 42 | Ga0070667_100007846 | 3300005367 | Bacteria | 8852 |
| 43 | Ga0070667_100155082 | 3300005367 | Bacteria | 2014 |
| 44 | Ga0070667_100171412 | 3300005367 | Unclassified | 1916 |
| 45 | Ga0070709_10434468 | 3300005434 | Unclassified | 986 |
| 46 | Ga0070714_100603417 | 3300005435 | Bacteria | 1054 |
| 47 | Ga0070713_100346307 | 3300005436 | Unclassified | 1378 |
| 48 | Ga0070713_102028340 | 3300005436 | Unclassified | 558 |
| 49 | Ga0070710_10215826 | 3300005437 | Bacteria | 1218 |
| 50 | Ga0070701_10182122 | 3300005438 | Bacteria | 1231 |
| 51 | Ga0070711_100385584 | 3300005439 | Unclassified | 1134 |
| 52 | Ga0070711_100499377 | 3300005439 | Bacteria | 1003 |
| 53 | Ga0070705_100000832 | 3300005440 | Bacteria | 17343 |
| 54 | Ga0070705_100005876 | 3300005440 | Bacteria | 6000 |
| 55 | Ga0070705_100618573 | 3300005440 | Unclassified | 840 |
| 56 | Ga0070700_100046301 | 3300005441 | Bacteria | 2686 |
| 57 | Ga0070700_100130553 | 3300005441 | Unclassified | 1695 |
| 58 | Ga0070700_100235012 | 3300005441 | Unclassified | 1307 |
| 59 | Ga0070694_100030607 | 3300005444 | Bacteria | 3522 |
| 60 | Ga0070694_100093146 | 3300005444 | Bacteria | 2117 |
| 61 | Ga0070694_100185201 | 3300005444 | Unclassified | 1542 |
| 62 | Ga0070694_101324417 | 3300005444 | Unclassified | 606 |
| 63 | Ga0070708_100006105 | 3300005445 | Bacteria | 9585 |
| 64 | Ga0070708_100017009 | 3300005445 | Bacteria | 6053 |
| 65 | Ga0070708_100488338 | 3300005445 | Unclassified | 1162 |
| 66 | Ga0070708_100533728 | 3300005445 | Bacteria | 1107 |
| 67 | Ga0070708_100572637 | 3300005445 | Bacteria | 1065 |
| 68 | Ga0070678_100639649 | 3300005456 | Bacteria | 953 |
| 69 | Ga0070662_100000221 | 3300005457 | Bacteria | 33516 |
| 70 | Ga0070662_100179493 | 3300005457 | Bacteria | 1668 |
| 71 | Ga0070662_100320297 | 3300005457 | Unclassified | 1264 |
| 72 | Ga0070681_10029829 | 3300005458 | Bacteria | 5475 |
| 73 | Ga0070681_11074892 | 3300005458 | Unclassified | 725 |
| 74 | Ga0068867_100008237 | 3300005459 | Bacteria | 7362 |
| 75 | Ga0068867_100187358 | 3300005459 | Unclassified | 1649 |
| 76 | Ga0070706_100010912 | 3300005467 | Bacteria | 8435 |
| 77 | Ga0070706_100063982 | 3300005467 | Bacteria | 3399 |
| 78 | Ga0070706_100313624 | 3300005467 | Unclassified | 1463 |
| 79 | Ga0070706_100386557 | 3300005467 | Unclassified | 1303 |
| 80 | Ga0070706_100522408 | 3300005467 | Bacteria | 1104 |
| 81 | Ga0070706_100531804 | 3300005467 | Bacteria | 1094 |
| 82 | Ga0070706_100667116 | 3300005467 | Unclassified | 965 |
| 83 | Ga0070707_100009174 | 3300005468 | Bacteria | 9178 |
| 84 | Ga0070707_100040674 | 3300005468 | Bacteria | 4447 |
| 85 | Ga0070707_100197019 | 3300005468 | Bacteria | 1963 |
| 86 | Ga0070707_101415077 | 3300005468 | Bacteria | 662 |
| 87 | Ga0070698_100172029 | 3300005471 | Bacteria | 2106 |
| 88 | Ga0070698_100680333 | 3300005471 | Unclassified | 971 |
| 89 | Ga0070699_100602450 | 3300005518 | Bacteria | 1002 |
| 90 | Ga0070699_100711685 | 3300005518 | Unclassified | 918 |
| 91 | Ga0070679_100018633 | 3300005530 | Bacteria | 6739 |
| 92 | Ga0070679_100955141 | 3300005530 | Bacteria | 801 |
| 93 | Ga0070697_100219906 | 3300005536 | Unclassified | 1619 |
| 94 | Ga0070697_100238695 | 3300005536 | Bacteria | 1552 |
| 95 | Ga0070697_100613008 | 3300005536 | Unclassified | 957 |
| 96 | Ga0068853_100162554 | 3300005539 | Bacteria | 2016 |
| 97 | Ga0068853_100822448 | 3300005539 | Archaea | 890 |
| 98 | Ga0070672_100065536 | 3300005543 | Bacteria | 2874 |
| 99 | Ga0070672_100494839 | 3300005543 | Bacteria | 1057 |
| 100 | Ga0070672_100799813 | 3300005543 | Bacteria | 830 |
| 101 | Ga0070686_100028710 | 3300005544 | Bacteria | 3376 |
| 102 | Ga0070686_100500615 | 3300005544 | Unclassified | 943 |
| 103 | Ga0070695_100001221 | 3300005545 | Bacteria | 14130 |
| 104 | Ga0070696_100003268 | 3300005546 | Bacteria | 10812 |
| 105 | Ga0070696_100036660 | 3300005546 | Bacteria | 3382 |
| 106 | Ga0070696_100038001 | 3300005546 | Bacteria | 3321 |
| 107 | Ga0070696_100043686 | 3300005546 | Bacteria | 3101 |
| 108 | Ga0070696_100107081 | 3300005546 | Bacteria | 2010 |
| 109 | Ga0070696_100134043 | 3300005546 | Unclassified | 1805 |
| 110 | Ga0070696_100478508 | 3300005546 | Unclassified | 987 |
| 111 | Ga0070696_100756219 | 3300005546 | Unclassified | 797 |
| 112 | Ga0070696_100959956 | 3300005546 | Bacteria | 712 |
| 113 | Ga0070693_100011432 | 3300005547 | Bacteria | 4471 |
| 114 | Ga0070704_100029677 | 3300005549 | Bacteria | 3655 |
| 115 | Ga0070704_100033075 | 3300005549 | Bacteria | 3494 |
| 116 | Ga0070704_100142810 | 3300005549 | Bacteria | 1871 |
| 117 | Ga0070704_101031444 | 3300005549 | Unclassified | 745 |
| 118 | Ga0068855_100032967 | 3300005563 | Bacteria | 6184 |
| 119 | Ga0070664_100272293 | 3300005564 | Bacteria | 1525 |
| 120 | Ga0070664_100505681 | 3300005564 | Bacteria | 1114 |
| 121 | Ga0068857_100004046 | 3300005577 | Bacteria | 12344 |
| 122 | Ga0068857_100069735 | 3300005577 | Bacteria | 3130 |
| 123 | Ga0068854_100009465 | 3300005578 | Bacteria | 6291 |
| 124 | Ga0070702_100509420 | 3300005615 | Archaea | 885 |
| 125 | Ga0068859_101240213 | 3300005617 | Archaea | 821 |
| 126 | Ga0068864_100027217 | 3300005618 | Unclassified | 4826 |
| 127 | Ga0068864_100273735 | 3300005618 | Bacteria | 1574 |
| 128 | Ga0068864_100300848 | 3300005618 | Unclassified | 1502 |
| 129 | Ga0068864_100580852 | 3300005618 | Bacteria | 1086 |
| 130 | Ga0068866_10002512 | 3300005718 | Bacteria | 7558 |
| 131 | Ga0068866_10551202 | 3300005718 | Unclassified | 771 |
| 132 | Ga0068861_101243991 | 3300005719 | Unclassified | 722 |
| 133 | Ga0068861_101479799 | 3300005719 | Unclassified | 666 |
| 134 | Ga0068870_10007826 | 3300005840 | Bacteria | 4779 |
| 135 | Ga0068870_10221064 | 3300005840 | Bacteria | 1159 |
| 136 | Ga0068863_100118740 | 3300005841 | Bacteria | 2521 |
| 137 | Ga0068863_101404578 | 3300005841 | Bacteria | 706 |
| 138 | Ga0068858_100209802 | 3300005842 | Unclassified | 1843 |
| 139 | Ga0068858_100234843 | 3300005842 | Bacteria | 1739 |
| 140 | Ga0068858_100241862 | 3300005842 | Unclassified | 1713 |
| 141 | Ga0068860_100034901 | 3300005843 | Bacteria | 4825 |
| 142 | Ga0081455_10057340 | 3300005937 | Unclassified | 3301 |
| 143 | Ga0081539_10002359 | 3300005985 | Bacteria | 27116 |
| 144 | Ga0081539_10427625 | 3300005985 | Unclassified | 549 |
| 145 | Ga0070715_10303270 | 3300006163 | Unclassified | 855 |
| 146 | Ga0070716_100305061 | 3300006173 | Unclassified | 1109 |
| 147 | Ga0097621_100037627 | 3300006237 | Bacteria | 3879 |
| 148 | Ga0097621_100460252 | 3300006237 | Unclassified | 1147 |
| 149 | Ga0068871_100077175 | 3300006358 | Bacteria | 2753 |
| 150 | Ga0075428_100065007 | 3300006844 | Bacteria | 3995 |
| 151 | Ga0075428_100195606 | 3300006844 | Bacteria | 2187 |
| 152 | Ga0075428_100301117 | 3300006844 | Bacteria | 1724 |
| 153 | Ga0075428_100491466 | 3300006844 | Bacteria | 1313 |
| 154 | Ga0075428_101985639 | 3300006844 | Unclassified | 603 |
| 155 | Ga0075430_100190896 | 3300006846 | Bacteria | 1703 |
| 156 | Ga0075431_100052239 | 3300006847 | Bacteria | 4214 |
| 157 | Ga0075431_100279856 | 3300006847 | Bacteria | 1689 |
| 158 | Ga0075431_100350607 | 3300006847 | Unclassified | 1484 |
| 159 | Ga0075431_100760044 | 3300006847 | Bacteria | 944 |
| 160 | Ga0075433_10023328 | 3300006852 | Bacteria | 5206 |
| 161 | Ga0075433_10052531 | 3300006852 | Bacteria | 3551 |
| 162 | Ga0075433_10099300 | 3300006852 | Unclassified | 2577 |
| 163 | Ga0075434_100050189 | 3300006871 | Bacteria | 4144 |
| 164 | Ga0075434_100153575 | 3300006871 | Bacteria | 2322 |
| 165 | Ga0075434_100219218 | 3300006871 | Bacteria | 1922 |
| 166 | Ga0075434_100248244 | 3300006871 | Bacteria | 1799 |
| 167 | Ga0075434_100250059 | 3300006871 | Unclassified | 1792 |
| 168 | Ga0075434_100289461 | 3300006871 | Unclassified | 1658 |
| 169 | Ga0075429_100008628 | 3300006880 | Bacteria | 8866 |
| 170 | Ga0075429_100615235 | 3300006880 | Bacteria | 952 |
| 171 | Ga0068865_100039301 | 3300006881 | Bacteria | 3209 |
| 172 | Ga0068865_100985080 | 3300006881 | Unclassified | 737 |
| 173 | Ga0075436_100051335 | 3300006914 | Bacteria | 2846 |
| 174 | Ga0075436_100644060 | 3300006914 | Unclassified | 782 |
| 175 | Ga0075436_100780903 | 3300006914 | Bacteria | 710 |
| 176 | Ga0097620_101240545 | 3300006931 | Archaea | 821 |
| 177 | Ga0075435_100238129 | 3300007076 | Bacteria | 1547 |
| 178 | Ga0075435_100518430 | 3300007076 | Bacteria | 1031 |
| 179 | Ga0105240_10052398 | 3300009093 | Bacteria | 5131 |
| 180 | Ga0111539_10030838 | 3300009094 | Bacteria | 6518 |
| 181 | Ga0111539_10702311 | 3300009094 | Bacteria | 1177 |
| 182 | Ga0111539_11209130 | 3300009094 | Unclassified | 878 |
| 183 | Ga0105245_10020564 | 3300009098 | Bacteria | 5788 |
| 184 | Ga0105245_11938566 | 3300009098 | Bacteria | 642 |
| 185 | Ga0105247_10067992 | 3300009101 | Bacteria | 2221 |
| 186 | Ga0114129_10001846 | 3300009147 | Bacteria | 28863 |
| 187 | Ga0114129_10169257 | 3300009147 | Bacteria | 2980 |
| 188 | Ga0114129_10207332 | 3300009147 | Bacteria | 2652 |
| 189 | Ga0114129_10880394 | 3300009147 | Unclassified | 1136 |
| 190 | Ga0114129_11345085 | 3300009147 | Bacteria | 883 |
| 191 | Ga0105241_10029502 | 3300009174 | Bacteria | 4094 |
| 192 | Ga0105242_10001092 | 3300009176 | Bacteria | 21335 |
| 193 | Ga0105242_10871820 | 3300009176 | Unclassified | 898 |
| 194 | Ga0105248_10000907 | 3300009177 | Bacteria | 33063 |
| 195 | Ga0105248_10049079 | 3300009177 | Bacteria | 4735 |
| 196 | Ga0105248_10094739 | 3300009177 | Bacteria | 3361 |
| 197 | Ga0105248_10350357 | 3300009177 | Unclassified | 1662 |
| 198 | Ga0105237_11102133 | 3300009545 | Unclassified | 801 |
| 199 | Ga0105238_10592786 | 3300009551 | Bacteria | 1116 |
| 200 | Ga0105249_10027117 | 3300009553 | Bacteria | 5168 |
| 201 | Ga0105249_10050069 | 3300009553 | Bacteria | 3809 |
| 202 | Ga0105249_10112311 | 3300009553 | Bacteria | 2577 |
| 203 | Ga0105249_10169472 | 3300009553 | Unclassified | 2116 |
| 204 | Ga0105249_11826672 | 3300009553 | Unclassified | 680 |
| 205 | Ga0105239_10036630 | 3300010375 | Bacteria | 5385 |
| 206 | Ga0105239_10040582 | 3300010375 | Bacteria | 5099 |
| 207 | Ga0105239_10606918 | 3300010375 | Bacteria | 1248 |
| 208 | Ga0105239_11504858 | 3300010375 | Bacteria | 778 |
| 209 | Ga0105246_10032663 | 3300011119 | Bacteria | 3453 |
| 210 | Ga0105246_11027497 | 3300011119 | Bacteria | 748 |
| 211 | Ga0105246_11058697 | 3300011119 | Bacteria | 738 |
| 212 | Ga0157371_10264487 | 3300013102 | Bacteria | 1240 |
| 213 | Ga0157378_10005156 | 3300013297 | Bacteria | 11469 |
| 214 | Ga0157378_10490012 | 3300013297 | Unclassified | 1226 |
| 215 | Ga0163162_10008376 | 3300013306 | Bacteria | 10081 |
| 216 | Ga0163162_10026144 | 3300013306 | Bacteria | 5768 |
| 217 | Ga0163162_10041422 | 3300013306 | Bacteria | 4608 |
| 218 | Ga0163162_10063915 | 3300013306 | Bacteria | 3724 |
| 219 | Ga0157372_10849489 | 3300013307 | Bacteria | 1060 |
| 220 | Ga0157372_11012111 | 3300013307 | Bacteria | 962 |
| 221 | Ga0157375_10034591 | 3300013308 | Bacteria | 4815 |
| 222 | Ga0157375_10072177 | 3300013308 | Bacteria | 3468 |
| 223 | Ga0157375_10308242 | 3300013308 | Bacteria | 1747 |
| 224 | Ga0163163_10167567 | 3300014325 | Bacteria | 2243 |
| 225 | Ga0163163_12330262 | 3300014325 | Unclassified | 594 |
| 226 | Ga0157380_10003718 | 3300014326 | Bacteria | 10488 |
| 227 | Ga0157380_10133367 | 3300014326 | Bacteria | 2122 |
| 228 | Ga0157380_10398267 | 3300014326 | Bacteria | 1305 |
| 229 | Ga0157379_10058242 | 3300014968 | Unclassified | 3453 |
| 230 | Ga0157379_10725781 | 3300014968 | Unclassified | 934 |
| 231 | Ga0157376_10054407 | 3300014969 | Bacteria | 3336 |
| 232 | Ga0157376_10077441 | 3300014969 | Unclassified | 2844 |
| 233 | Ga0163161_10115943 | 3300017792 | Bacteria | 2008 |
| 234 | Ga0207697_10075104 | 3300025315 | Bacteria | 1420 |
| 235 | Ga0207697_10143231 | 3300025315 | Bacteria | 1037 |
| 236 | Ga0207682_10063348 | 3300025893 | Unclassified | 1552 |
| 237 | Ga0207682_10178316 | 3300025893 | Bacteria | 969 |
| 238 | Ga0207642_10006023 | 3300025899 | Bacteria | 4005 |
| 239 | Ga0207642_10180540 | 3300025899 | Unclassified | 1150 |
| 240 | Ga0207680_10090250 | 3300025903 | Bacteria | 1947 |
| 241 | Ga0207647_10229077 | 3300025904 | Bacteria | 1069 |
| 242 | Ga0207685_10283944 | 3300025905 | Bacteria | 813 |
| 243 | Ga0207645_10000367 | 3300025907 | Bacteria | 37425 |
| 244 | Ga0207645_10057496 | 3300025907 | Bacteria | 2483 |
| 245 | Ga0207643_10002434 | 3300025908 | Bacteria | 10067 |
| 246 | Ga0207684_10017041 | 3300025910 | Bacteria | 6240 |
| 247 | Ga0207684_10211515 | 3300025910 | Bacteria | 1673 |
| 248 | Ga0207684_10289844 | 3300025910 | Bacteria | 1411 |
| 249 | Ga0207684_10741289 | 3300025910 | Unclassified | 833 |
| 250 | Ga0207684_10797268 | 3300025910 | Unclassified | 799 |
| 251 | Ga0207654_10003813 | 3300025911 | Bacteria | 7601 |
| 252 | Ga0207707_10139798 | 3300025912 | Bacteria | 2117 |
| 253 | Ga0207707_10494216 | 3300025912 | Bacteria | 1044 |
| 254 | Ga0207695_10056126 | 3300025913 | Bacteria | 4100 |
| 255 | Ga0207663_10509843 | 3300025916 | Unclassified | 935 |
| 256 | Ga0207660_10126538 | 3300025917 | Unclassified | 1941 |
| 257 | Ga0207660_10318007 | 3300025917 | Bacteria | 1242 |
| 258 | Ga0207660_10351289 | 3300025917 | Bacteria | 1182 |
| 259 | Ga0207657_10117458 | 3300025919 | Bacteria | 2191 |
| 260 | Ga0207657_11139056 | 3300025919 | Bacteria | 595 |
| 261 | Ga0207649_10428932 | 3300025920 | Unclassified | 994 |
| 262 | Ga0207652_10265518 | 3300025921 | Bacteria | 1548 |
| 263 | Ga0207652_10318626 | 3300025921 | Bacteria | 1404 |
| 264 | Ga0207646_10015406 | 3300025922 | Bacteria | 7222 |
| 265 | Ga0207646_10043473 | 3300025922 | Bacteria | 4035 |
| 266 | Ga0207646_10104036 | 3300025922 | Unclassified | 2546 |
| 267 | Ga0207646_10219126 | 3300025922 | Unclassified | 1719 |
| 268 | Ga0207646_10686795 | 3300025922 | Bacteria | 916 |
| 269 | Ga0207646_10884146 | 3300025922 | Unclassified | 793 |
| 270 | Ga0207681_10003521 | 3300025923 | Bacteria | 9749 |
| 271 | Ga0207681_10141518 | 3300025923 | Bacteria | 1792 |
| 272 | Ga0207681_11042075 | 3300025923 | Bacteria | 687 |
| 273 | Ga0207694_10449321 | 3300025924 | Bacteria | 1076 |
| 274 | Ga0207659_10121468 | 3300025926 | Unclassified | 2002 |
| 275 | Ga0207659_10325564 | 3300025926 | Bacteria | 1269 |
| 276 | Ga0207659_10588302 | 3300025926 | Bacteria | 948 |
| 277 | Ga0207659_10805312 | 3300025926 | Bacteria | 807 |
| 278 | Ga0207687_10040114 | 3300025927 | Bacteria | 3208 |
| 279 | Ga0207644_10753000 | 3300025931 | Bacteria | 814 |
| 280 | Ga0207690_10941271 | 3300025932 | Unclassified | 717 |
| 281 | Ga0207706_10000121 | 3300025933 | Bacteria | 83940 |
| 282 | Ga0207706_10352390 | 3300025933 | Unclassified | 1280 |
| 283 | Ga0207686_10000081 | 3300025934 | Bacteria | 80195 |
| 284 | Ga0207686_10541591 | 3300025934 | Unclassified | 909 |
| 285 | Ga0207709_10010880 | 3300025935 | Bacteria | 5012 |
| 286 | Ga0207670_10244277 | 3300025936 | Unclassified | 1384 |
| 287 | Ga0207669_10007755 | 3300025937 | Bacteria | 4993 |
| 288 | Ga0207704_10017762 | 3300025938 | Bacteria | 3697 |
| 289 | Ga0207704_10293761 | 3300025938 | Bacteria | 1241 |
| 290 | Ga0207704_11058683 | 3300025938 | Unclassified | 688 |
| 291 | Ga0207691_10029903 | 3300025940 | Bacteria | 5095 |
| 292 | Ga0207691_10142871 | 3300025940 | Unclassified | 2108 |
| 293 | Ga0207691_11112808 | 3300025940 | Unclassified | 657 |
| 294 | Ga0207711_10002289 | 3300025941 | Bacteria | 17181 |
| 295 | Ga0207711_10094686 | 3300025941 | Bacteria | 2632 |
| 296 | Ga0207711_10434553 | 3300025941 | Bacteria | 1222 |
| 297 | Ga0207689_10001917 | 3300025942 | Bacteria | 19669 |
| 298 | Ga0207661_11668317 | 3300025944 | Unclassified | 582 |
| 299 | Ga0207679_10025032 | 3300025945 | Bacteria | 4100 |
| 300 | Ga0207679_10323091 | 3300025945 | Bacteria | 1337 |
| 301 | Ga0207679_10589669 | 3300025945 | Bacteria | 1000 |
| 302 | Ga0207651_10086345 | 3300025960 | Bacteria | 2280 |
| 303 | Ga0207651_10211499 | 3300025960 | Bacteria | 1561 |
| 304 | Ga0207651_10349084 | 3300025960 | Bacteria | 1245 |
| 305 | Ga0207712_10039573 | 3300025961 | Unclassified | 3231 |
| 306 | Ga0207712_10496793 | 3300025961 | Bacteria | 1042 |
| 307 | Ga0207712_10801865 | 3300025961 | Bacteria | 828 |
| 308 | Ga0207668_10010535 | 3300025972 | Bacteria | 5589 |
| 309 | Ga0207640_10000470 | 3300025981 | Bacteria | 24653 |
| 310 | Ga0207640_10556455 | 3300025981 | Unclassified | 964 |
| 311 | Ga0207658_10007465 | 3300025986 | Bacteria | 7450 |
| 312 | Ga0207658_10134709 | 3300025986 | Unclassified | 1990 |
| 313 | Ga0207658_10353119 | 3300025986 | Bacteria | 1281 |
| 314 | Ga0207703_10040226 | 3300026035 | Bacteria | 3741 |
| 315 | Ga0207703_10664009 | 3300026035 | Unclassified | 990 |
| 316 | Ga0207703_10762035 | 3300026035 | Bacteria | 923 |
| 317 | Ga0207639_10116461 | 3300026041 | Bacteria | 2188 |
| 318 | Ga0207639_10641584 | 3300026041 | Bacteria | 982 |
| 319 | Ga0207678_10218465 | 3300026067 | Bacteria | 1631 |
| 320 | Ga0207678_10287235 | 3300026067 | Unclassified | 1412 |
| 321 | Ga0207708_10053478 | 3300026075 | Unclassified | 3077 |
| 322 | Ga0207708_10063238 | 3300026075 | Bacteria | 2827 |
| 323 | Ga0207641_11153017 | 3300026088 | Bacteria | 774 |
| 324 | Ga0207648_10000107 | 3300026089 | Bacteria | 80740 |
| 325 | Ga0207648_10142432 | 3300026089 | Bacteria | 2113 |
| 326 | Ga0207676_10001028 | 3300026095 | Bacteria | 21341 |
| 327 | Ga0207676_10017014 | 3300026095 | Bacteria | 5267 |
| 328 | Ga0207676_10350005 | 3300026095 | Bacteria | 1366 |
| 329 | Ga0207674_10015420 | 3300026116 | Bacteria | 8396 |
| 330 | Ga0207674_10094427 | 3300026116 | Bacteria | 2977 |
| 331 | Ga0207674_11605742 | 3300026116 | Unclassified | 619 |
| 332 | Ga0207675_100033916 | 3300026118 | Bacteria | 4757 |
| 333 | Ga0207675_100101062 | 3300026118 | Unclassified | 2717 |
| 334 | Ga0207675_101354370 | 3300026118 | Unclassified | 732 |
| 335 | Ga0207683_10667058 | 3300026121 | Bacteria | 964 |
| 336 | Ga0207683_11581519 | 3300026121 | Unclassified | 605 |
| 337 | Ga0209970_1052019 | 3300027614 | Bacteria | 742 |
| 338 | Ga0207428_10194625 | 3300027907 | Bacteria | 1527 |
| 339 | Ga0207428_10205460 | 3300027907 | Bacteria | 1481 |
| 340 | Ga0207428_10221541 | 3300027907 | Unclassified | 1418 |
| 341 | Ga0268266_10437894 | 3300028379 | Bacteria | 1241 |
| 342 | Ga0268265_10152825 | 3300028380 | Bacteria | 1949 |
| 343 | Ga0268265_10279484 | 3300028380 | Bacteria | 1493 |
| 344 | Ga0268265_10301552 | 3300028380 | Bacteria | 1443 |
| 345 | Ga0268265_10461959 | 3300028380 | Unclassified | 1188 |
| 346 | Ga0268264_10002811 | 3300028381 | Bacteria | 15205 |
| 347 | Ga0268264_10505269 | 3300028381 | Unclassified | 1180 |
| 348 | Ga0307408_100043200 | 3300031548 | Unclassified | 3206 |
| 349 | Ga0307408_100047447 | 3300031548 | Bacteria | 3076 |
| 350 | Ga0307408_100067471 | 3300031548 | Bacteria | 2631 |
| 351 | Ga0307408_100142493 | 3300031548 | Bacteria | 1883 |
| 352 | Ga0307408_100482761 | 3300031548 | Bacteria | 1081 |
| 353 | Ga0307408_100835608 | 3300031548 | Bacteria | 838 |
| 354 | Ga0307408_100903672 | 3300031548 | Unclassified | 808 |
| 355 | Ga0307408_100915514 | 3300031548 | Bacteria | 803 |
| 356 | Ga0307405_10016555 | 3300031731 | Bacteria | 4023 |
| 357 | Ga0307405_10062701 | 3300031731 | Bacteria | 2355 |
| 358 | Ga0307405_10380689 | 3300031731 | Bacteria | 1098 |
| 359 | Ga0307405_10656454 | 3300031731 | Bacteria | 863 |
| 360 | Ga0307413_10006839 | 3300031824 | Bacteria | 5245 |
| 361 | Ga0307413_10011396 | 3300031824 | Bacteria | 4369 |
| 362 | Ga0307413_10264332 | 3300031824 | Bacteria | 1284 |
| 363 | Ga0307413_10282661 | 3300031824 | Bacteria | 1249 |
| 364 | Ga0307413_10292241 | 3300031824 | Bacteria | 1232 |
| 365 | Ga0307413_10366337 | 3300031824 | Bacteria | 1117 |
| 366 | Ga0307410_10000581 | 3300031852 | Bacteria | 15012 |
| 367 | Ga0307410_10018802 | 3300031852 | Unclassified | 4185 |
| 368 | Ga0307410_10048296 | 3300031852 | Bacteria | 2849 |
| 369 | Ga0307410_10063076 | 3300031852 | Bacteria | 2541 |
| 370 | Ga0307410_10082294 | 3300031852 | Bacteria | 2264 |
| 371 | Ga0307410_10092886 | 3300031852 | Unclassified | 2146 |
| 372 | Ga0307410_10094783 | 3300031852 | Bacteria | 2127 |
| 373 | Ga0307410_10307495 | 3300031852 | Bacteria | 1253 |
| 374 | Ga0307410_10371125 | 3300031852 | Unclassified | 1149 |
| 375 | Ga0307410_10376077 | 3300031852 | Unclassified | 1142 |
| 376 | Ga0307406_10011559 | 3300031901 | Bacteria | 5016 |
| 377 | Ga0307406_10031276 | 3300031901 | Bacteria | 3239 |
| 378 | Ga0307406_10103177 | 3300031901 | Bacteria | 1947 |
| 379 | Ga0307406_10197932 | 3300031901 | Bacteria | 1476 |
| 380 | Ga0307406_10566871 | 3300031901 | Bacteria | 931 |
| 381 | Ga0307406_10801828 | 3300031901 | Unclassified | 795 |
| 382 | Ga0307407_10002900 | 3300031903 | Bacteria | 6858 |
| 383 | Ga0307407_10365708 | 3300031903 | Bacteria | 1025 |
| 384 | Ga0307407_10709436 | 3300031903 | Unclassified | 758 |
| 385 | Ga0307407_10721901 | 3300031903 | Unclassified | 752 |
| 386 | Ga0307412_10028295 | 3300031911 | Bacteria | 3505 |
| 387 | Ga0307412_10157522 | 3300031911 | Bacteria | 1683 |
| 388 | Ga0307409_100004424 | 3300031995 | Bacteria | 7891 |
| 389 | Ga0307409_100029664 | 3300031995 | Bacteria | 3918 |
| 390 | Ga0307409_100029738 | 3300031995 | Bacteria | 3914 |
| 391 | Ga0307409_100240215 | 3300031995 | Bacteria | 1648 |
| 392 | Ga0307409_100275711 | 3300031995 | Bacteria | 1551 |
| 393 | Ga0307409_100319489 | 3300031995 | Bacteria | 1452 |
| 394 | Ga0307409_100407046 | 3300031995 | Bacteria | 1301 |
| 395 | Ga0307409_100538654 | 3300031995 | Unclassified | 1144 |
| 396 | Ga0307409_100827928 | 3300031995 | Unclassified | 935 |
| 397 | Ga0307409_101070251 | 3300031995 | Bacteria | 827 |
| 398 | Ga0307409_101186320 | 3300031995 | Unclassified | 786 |
| 399 | Ga0307416_100000301 | 3300032002 | Bacteria | 25445 |
| 400 | Ga0307416_100024175 | 3300032002 | Unclassified | 4428 |
| 401 | Ga0307416_100049489 | 3300032002 | Unclassified | 3342 |
| 402 | Ga0307416_100113509 | 3300032002 | Bacteria | 2394 |
| 403 | Ga0307416_100152034 | 3300032002 | Bacteria | 2124 |
| 404 | Ga0307416_100162402 | 3300032002 | Bacteria | 2067 |
| 405 | Ga0307416_100342118 | 3300032002 | Bacteria | 1509 |
| 406 | Ga0307416_100342465 | 3300032002 | Bacteria | 1509 |
| 407 | Ga0307416_100702225 | 3300032002 | Bacteria | 1101 |
| 408 | Ga0307416_100742605 | 3300032002 | Bacteria | 1073 |
| 409 | Ga0307416_101063999 | 3300032002 | Bacteria | 913 |
| 410 | Ga0307414_10002345 | 3300032004 | Bacteria | 9895 |
| 411 | Ga0307414_10007749 | 3300032004 | Bacteria | 6051 |
| 412 | Ga0307414_10018217 | 3300032004 | Unclassified | 4316 |
| 413 | Ga0307414_10027858 | 3300032004 | Unclassified | 3657 |
| 414 | Ga0307414_10192008 | 3300032004 | Bacteria | 1653 |
| 415 | Ga0307414_10262090 | 3300032004 | Bacteria | 1443 |
| 416 | Ga0307414_10383305 | 3300032004 | Bacteria | 1216 |
| 417 | Ga0307414_10427856 | 3300032004 | Bacteria | 1156 |
| 418 | Ga0307414_10938201 | 3300032004 | Unclassified | 795 |
| 419 | Ga0307411_10000425 | 3300032005 | Bacteria | 14357 |
| 420 | Ga0307411_10004190 | 3300032005 | Bacteria | 6858 |
| 421 | Ga0307411_10007295 | 3300032005 | Bacteria | 5614 |
| 422 | Ga0307411_10007974 | 3300032005 | Bacteria | 5448 |
| 423 | Ga0307411_10040645 | 3300032005 | Bacteria | 2952 |
| 424 | Ga0307411_10341281 | 3300032005 | Bacteria | 1217 |
| 425 | Ga0307411_10836082 | 3300032005 | Unclassified | 813 |
| 426 | Ga0307415_100002039 | 3300032126 | Bacteria | 9968 |
| 427 | Ga0307415_100003756 | 3300032126 | Bacteria | 7780 |
| 428 | Ga0307415_100031276 | 3300032126 | Unclassified | 3427 |
| 429 | Ga0307415_100083656 | 3300032126 | Bacteria | 2287 |
| 430 | Ga0307415_100099119 | 3300032126 | Bacteria | 2132 |
| 431 | Ga0307415_100124804 | 3300032126 | Bacteria | 1938 |
| 432 | Ga0307415_100971915 | 3300032126 | Bacteria | 787 |
| 433 | Ga0373959_0117638 | 3300034820 | Unclassified | 647 |
| 434 | Ga0373949_0068499 | 3300035090 | Unclassified | 926 |
| 435 | Ga0373960_0206731 | 3300035121 | Bacteria | 696 |
| 436 | Ga0373961_0028301 | 3300035241 | Unclassified | 1544 |
| 437 | Ga0373931_0009861 | 3300035691 | Bacteria | 4577 |
| 438 | Ga0395905_0210481 | 3300037471 | Bacteria | 1822 |
| 439 | Ga0395905_0563685 | 3300037471 | Unclassified | 1040 |
| 440 | Ga0395901_0310577 | 3300038443 | Unclassified | 1633 |
| 441 | Ga0242420_128971 | 3300038996 | Unclassified | 556 |
| 442 | Ga0451793_0280683 | 3300041452 | Unclassified | 1287 |
| 443 | Ga0451807_0455648 | 3300041486 | Unclassified | 1431 |
| 444 | Ga0451833_0507750 | 3300041491 | Unclassified | 618 |
| 445 | Ga0451853_1846957 | 3300041512 | Unclassified | 908 |
| 446 | Ga0439446_0011436 | 3300042156 | Bacteria | 2410 |
| 447 | Ga0439434_0143551 | 3300042435 | Bacteria | 788 |
| 448 | Ga0439459_0062179 | 3300042438 | Unclassified | 846 |
| 449 | Ga0451577_0023487 | 3300042876 | Bacteria | 5623 |
| 450 | Ga0451577_0310175 | 3300042876 | Bacteria | 1430 |
| 451 | Ga0451577_0343375 | 3300042876 | Bacteria | 1354 |
| 452 | Ga0453683_0212726 | 3300044673 | Bacteria | 1228 |
| 453 | Ga0453684_0164880 | 3300044712 | Bacteria | 2617 |
| 454 | Ga0453684_0346494 | 3300044712 | Bacteria | 1676 |
| 455 | Ga0451576_0254141 | 3300045051 | Bacteria | 1837 |
| 456 | Ga0451576_1649660 | 3300045051 | Unclassified | 664 |
| 457 | Ga0466967_0808593 | 3300045976 | Bacteria | 931 |
| 458 | Ga0495603_0065268 | 3300046455 | Bacteria | 2145 |
| 459 | Ga0495603_0361228 | 3300046455 | Unclassified | 833 |
| 460 | Ga0495641_0014520 | 3300046461 | Bacteria | 4256 |
| 461 | Ga0495651_0489689 | 3300046462 | Bacteria | 789 |
| 462 | Ga0495580_0158431 | 3300046472 | Unclassified | 1567 |
| 463 | Ga0495639_0423440 | 3300046475 | Bacteria | 674 |
| 464 | Ga0495639_0436449 | 3300046475 | Unclassified | 664 |
| 465 | Ga0495664_0049026 | 3300046477 | Bacteria | 2507 |
| 466 | Ga0495594_0025662 | 3300046499 | Bacteria | 3168 |
| 467 | Ga0495594_0029471 | 3300046499 | Bacteria | 2966 |
| 468 | Ga0495618_0024144 | 3300046514 | Bacteria | 3762 |
| 469 | Ga0495630_0044914 | 3300046517 | Bacteria | 3301 |
| 470 | Ga0495640_0033767 | 3300046533 | Bacteria | 3633 |
| 471 | Ga0495586_0005553 | 3300046535 | Bacteria | 6746 |
| 472 | Ga0495621_0283777 | 3300046539 | Unclassified | 683 |
| 473 | Ga0495622_0289492 | 3300046557 | Unclassified | 715 |
| 474 | Ga0495633_0257896 | 3300046558 | Unclassified | 795 |
| 475 | Ga0495667_0153238 | 3300046559 | Bacteria | 1484 |
| 476 | Ga0495656_0477429 | 3300046615 | Bacteria | 659 |
| 477 | Ga0495634_0013988 | 3300046642 | Bacteria | 5795 |
| 478 | Ga0495647_0012629 | 3300046681 | Bacteria | 2912 |
| 479 | Ga0495658_0371334 | 3300046683 | Unclassified | 910 |
| 480 | Ga0495613_0373316 | 3300046689 | Bacteria | 976 |
| 481 | Ga0495674_0022355 | 3300047319 | Bacteria | 5833 |
| 482 | Ga0495676_0213883 | 3300047321 | Bacteria | 1332 |
| 483 | Ga0495680_0013290 | 3300047322 | Bacteria | 7190 |
| 484 | Ga0495684_0105240 | 3300047471 | Bacteria | 2132 |
| 485 | Ga0496100_0078169 | 3300048903 | Bacteria | 2227 |
| 486 | Ga0496100_0161426 | 3300048903 | Bacteria | 1607 |
| 487 | Ga0496101_0046131 | 3300048904 | Bacteria | 3124 |
| 488 | Ga0496101_0103059 | 3300048904 | Bacteria | 2138 |
| 489 | Ga0496101_0143456 | 3300048904 | Bacteria | 1822 |
| 490 | Ga0496102_0005252 | 3300048905 | Bacteria | 10996 |
| 491 | Ga0496102_0015476 | 3300048905 | Bacteria | 6645 |
| 492 | Ga0496102_0026151 | 3300048905 | Bacteria | 5202 |
| 493 | Ga0496102_0039337 | 3300048905 | Bacteria | 4273 |
| 494 | Ga0496103_0016984 | 3300048906 | Bacteria | 4349 |
| 495 | Ga0496103_0125156 | 3300048906 | Bacteria | 1639 |
| 496 | Ga0496103_0481903 | 3300048906 | Bacteria | 794 |
| 497 | Ga0496103_0713457 | 3300048906 | Bacteria | 635 |
| 498 | Ga0496104_0001703 | 3300048907 | Bacteria | 18985 |
| 499 | Ga0496104_0070831 | 3300048907 | Unclassified | 3315 |
| 500 | Ga0496104_0108043 | 3300048907 | Bacteria | 2666 |
| 501 | Ga0496104_0126307 | 3300048907 | Bacteria | 2456 |
| 502 | Ga0496104_0327759 | 3300048907 | Unclassified | 1444 |
| 503 | Ga0496104_0387360 | 3300048907 | Bacteria | 1310 |
| 504 | Ga0496105_0060895 | 3300048908 | Unclassified | 3115 |
| 505 | Ga0496105_0261298 | 3300048908 | Unclassified | 1400 |
| 506 | Ga0496105_0370517 | 3300048908 | Bacteria | 1141 |
| 507 | Ga0496106_0004623 | 3300048909 | Bacteria | 10209 |
| 508 | Ga0496106_0009898 | 3300048909 | Bacteria | 7039 |
| 509 | Ga0496106_0107963 | 3300048909 | Unclassified | 2165 |
| 510 | Ga0496106_0233816 | 3300048909 | Bacteria | 1468 |
| 511 | Ga0496106_0555636 | 3300048909 | Unclassified | 921 |
| 512 | Ga0496107_0007683 | 3300048910 | Bacteria | 7446 |
| 513 | Ga0496107_0168629 | 3300048910 | Bacteria | 1624 |
| 514 | Ga0496107_0915363 | 3300048910 | Unclassified | 639 |
| 515 | Ga0496108_0000426 | 3300048911 | Bacteria | 34037 |
| 516 | Ga0496108_0000573 | 3300048911 | Bacteria | 28745 |
| 517 | Ga0496108_0004627 | 3300048911 | Bacteria | 11091 |
| 518 | Ga0496108_0016790 | 3300048911 | Bacteria | 5980 |
| 519 | Ga0496108_0093975 | 3300048911 | Bacteria | 2552 |
| 520 | Ga0496109_0000596 | 3300048912 | Bacteria | 30229 |
| 521 | Ga0496109_0003769 | 3300048912 | Bacteria | 12663 |
| 522 | Ga0496109_0008246 | 3300048912 | Bacteria | 8846 |
| 523 | Ga0496109_0014082 | 3300048912 | Bacteria | 6952 |
| 524 | Ga0496109_0077845 | 3300048912 | Bacteria | 3052 |
| 525 | Ga0496110_0002244 | 3300048913 | Bacteria | 14455 |
| 526 | Ga0496110_0005269 | 3300048913 | Bacteria | 10120 |
| 527 | Ga0496110_0007351 | 3300048913 | Bacteria | 8794 |
| 528 | Ga0496110_0062740 | 3300048913 | Bacteria | 3283 |
| 529 | Ga0496110_0285756 | 3300048913 | Bacteria | 1502 |
| 530 | Ga0496111_0004937 | 3300048914 | Bacteria | 8473 |
| 531 | Ga0496111_0024767 | 3300048914 | Bacteria | 4232 |
| 532 | Ga0496111_0025388 | 3300048914 | Bacteria | 4182 |
| 533 | Ga0496112_0004531 | 3300048915 | Bacteria | 11805 |
| 534 | Ga0496112_0007174 | 3300048915 | Bacteria | 9869 |
| 535 | Ga0496112_0010496 | 3300048915 | Bacteria | 8404 |
| 536 | Ga0496112_0014112 | 3300048915 | Bacteria | 7397 |
| 537 | Ga0496113_0000965 | 3300048916 | Bacteria | 15293 |
| 538 | Ga0496113_0004825 | 3300048916 | Bacteria | 8340 |
| 539 | Ga0496113_0005440 | 3300048916 | Bacteria | 7941 |
| 540 | Ga0496113_0021171 | 3300048916 | Bacteria | 4584 |
| 541 | Ga0496113_0813878 | 3300048916 | Unclassified | 742 |
| 542 | Ga0496114_0003263 | 3300048917 | Bacteria | 12456 |
| 543 | Ga0496114_0355442 | 3300048917 | Unclassified | 1296 |
| 544 | Ga0496114_0407220 | 3300048917 | Bacteria | 1204 |
| 545 | Ga0496115_0122769 | 3300048918 | Bacteria | 2138 |
| 546 | Ga0496115_0152979 | 3300048918 | Unclassified | 1905 |
| 547 | Ga0501298_060074 | 3300049521 | Bacteria | 804 |
| 548 | Ga0501031_0037628 | 3300049568 | Bacteria | 3158 |
| 549 | Ga0501032_0446313 | 3300049569 | Bacteria | 829 |
| 550 | Ga0501033_0093441 | 3300049570 | Bacteria | 2200 |
| 551 | Ga0501033_0150264 | 3300049570 | Bacteria | 1681 |
| 552 | Ga0501034_0211055 | 3300049571 | Unclassified | 1897 |
| 553 | Ga0501036_0036627 | 3300049572 | Bacteria | 4152 |
| 554 | Ga0501038_0187889 | 3300049574 | Unclassified | 1664 |
| 555 | Ga0501038_0229384 | 3300049574 | Bacteria | 1478 |
| 556 | Ga0501039_0054202 | 3300049575 | Bacteria | 3104 |
| 557 | Ga0501040_0009895 | 3300049576 | Bacteria | 6225 |
| 558 | Ga0501040_0266602 | 3300049576 | Bacteria | 1222 |
| 559 | Ga0501041_0116854 | 3300049577 | Unclassified | 1656 |
| 560 | Ga0501041_0325710 | 3300049577 | Bacteria | 969 |
| 561 | Ga0501042_0010630 | 3300049578 | Bacteria | 6182 |
| 562 | Ga0501042_0071850 | 3300049578 | Bacteria | 2476 |
| 563 | Ga0501046_0247152 | 3300049580 | Bacteria | 1314 |
| 564 | Ga0501048_0073168 | 3300049582 | Bacteria | 2419 |
| 565 | Ga0501048_0129649 | 3300049582 | Unclassified | 1783 |
| 566 | Ga0501067_0073711 | 3300049583 | Unclassified | 1891 |
| 567 | Ga0501067_0201989 | 3300049583 | Bacteria | 1107 |
| 568 | Ga0501067_0236568 | 3300049583 | Bacteria | 1016 |
| 569 | Ga0501069_0060756 | 3300049585 | Unclassified | 2110 |
| 570 | Ga0501069_0073917 | 3300049585 | Unclassified | 1912 |
| 571 | Ga0501069_0358502 | 3300049585 | Bacteria | 860 |
| 572 | Ga0501070_0529526 | 3300049586 | Bacteria | 945 |
| 573 | Ga0501071_0027731 | 3300049587 | Bacteria | 3986 |
| 574 | Ga0501072_0016740 | 3300049588 | Bacteria | 5633 |
| 575 | Ga0501072_0070322 | 3300049588 | Bacteria | 2764 |
| 576 | Ga0501073_0042716 | 3300049589 | Bacteria | 3199 |
| 577 | Ga0501073_0298422 | 3300049589 | Bacteria | 1112 |
| 578 | Ga0501074_0007240 | 3300049590 | Bacteria | 8015 |
| 579 | Ga0501075_0014329 | 3300049591 | Bacteria | 5681 |
| 580 | Ga0501075_0042159 | 3300049591 | Bacteria | 3421 |
| 581 | Ga0501076_0015841 | 3300049592 | Bacteria | 5703 |
| 582 | Ga0501076_0110867 | 3300049592 | Bacteria | 2218 |
| 583 | Ga0501076_0340440 | 3300049592 | Unclassified | 1231 |
| 584 | Ga0501077_0000553 | 3300049593 | Bacteria | 22727 |
| 585 | Ga0501077_0001357 | 3300049593 | Bacteria | 14723 |
| 586 | Ga0501077_0221548 | 3300049593 | Unclassified | 1202 |
| 587 | Ga0501077_0432784 | 3300049593 | Bacteria | 842 |
| 588 | Ga0501209_007958 | 3300049656 | Bacteria | 2064 |
| 589 | Ga0501209_015935 | 3300049656 | Bacteria | 1687 |
| 590 | Ga0501209_031323 | 3300049656 | Bacteria | 1351 |
| 591 | Ga0501214_007009 | 3300049659 | Unclassified | 1141 |
| 592 | Ga0501216_000868 | 3300049660 | Bacteria | 3821 |
| 593 | Ga0501217_005539 | 3300049661 | Bacteria | 2646 |
| 594 | Ga0501217_070280 | 3300049661 | Bacteria | 952 |
| 595 | Ga0501233_006433 | 3300049668 | Bacteria | 2206 |
| 596 | Ga0501233_051709 | 3300049668 | Bacteria | 997 |
| 597 | Ga0501236_026165 | 3300049670 | Unclassified | 896 |
| 598 | Ga0501242_015879 | 3300049674 | Unclassified | 940 |
| 599 | Ga0501243_003788 | 3300049675 | Unclassified | 2257 |
| 600 | Ga0501247_004436 | 3300049677 | Unclassified | 1533 |
| 601 | Ga0501249_009951 | 3300049679 | Bacteria | 1982 |
| 602 | Ga0501249_054049 | 3300049679 | Unclassified | 924 |
| 603 | Ga0501250_064956 | 3300049680 | Unclassified | 591 |
| 604 | Ga0501255_050854 | 3300049684 | Bacteria | 634 |
| 605 | Ga0501257_004942 | 3300049686 | Bacteria | 2921 |
| 606 | Ga0501257_056540 | 3300049686 | Bacteria | 986 |
| 607 | Ga0501259_078088 | 3300049688 | Unclassified | 722 |
| 608 | Ga0501234_038479 | 3300049707 | Bacteria | 780 |
| 609 | Ga0501234_051038 | 3300049707 | Unclassified | 689 |
| 610 | Ga0501245_070513 | 3300049708 | Unclassified | 657 |
| 611 | Ga0501079_0001648 | 3300049741 | Bacteria | 15901 |
| 612 | Ga0501079_0014834 | 3300049741 | Bacteria | 5940 |
| 613 | Ga0501079_0023403 | 3300049741 | Bacteria | 4740 |
| 614 | Ga0501080_0032490 | 3300049742 | Bacteria | 4868 |
| 615 | Ga0501081_0027233 | 3300049743 | Bacteria | 3856 |
| 616 | Ga0501081_0058686 | 3300049743 | Bacteria | 2663 |
| 617 | Ga0501083_0070532 | 3300049744 | Bacteria | 2324 |
| 618 | Ga0501083_0411877 | 3300049744 | Bacteria | 879 |
| 619 | Ga0501241_032908 | 3300049758 | Unclassified | 984 |
| 620 | Ga0501263_000186 | 3300049760 | Unclassified | 3782 |
| 621 | Ga0501268_002479 | 3300049765 | Bacteria | 2437 |
| 622 | Ga0501272_015738 | 3300049769 | Unclassified | 882 |
| 623 | Ga0501275_031444 | 3300049772 | Unclassified | 704 |
| 624 | Ga0501283_050455 | 3300049779 | Unclassified | 736 |
| 625 | Ga0501035_0820818 | 3300049822 | Unclassified | 742 |
| 626 | Ga0501045_0003788 | 3300049824 | Bacteria | 10401 |
| 627 | Ga0501045_0116561 | 3300049824 | Bacteria | 1982 |
| 628 | Ga0501045_0902418 | 3300049824 | Unclassified | 649 |
| 629 | Ga0501204_020801 | 3300049850 | Unclassified | 855 |
| 630 | nmdc:mga05p37_1561132_c1 | 3300050507 | Unclassified | 653 |
| 631 | nmdc:mga05p37_1741_c1 | 3300050507 | Bacteria | 25395 |
| 632 | nmdc:mga05p37_201630_c1 | 3300050507 | Bacteria | 2409 |
| 633 | nmdc:mga05p37_569064_c1 | 3300050507 | Unclassified | 1286 |
| 634 | nmdc:mga09592_67806_c1 | 3300050508 | Unclassified | 3026 |
| 635 | nmdc:mga0qj67_1411250_c1 | 3300050509 | Unclassified | 537 |
| 636 | nmdc:mga0qj67_21997_c1 | 3300050509 | Bacteria | 4894 |
| 637 | nmdc:mga0qj67_411816_c1 | 3300050509 | Bacteria | 1090 |
| 638 | nmdc:mga0qj67_454583_c1 | 3300050509 | Bacteria | 1031 |
| 639 | nmdc:mga06r32_406131_c1 | 3300050510 | Unclassified | 1344 |
| 640 | nmdc:mga06r32_680719_c1 | 3300050510 | Bacteria | 995 |
| 641 | nmdc:mga06r32_6937_c1 | 3300050510 | Bacteria | 10188 |
| 642 | nmdc:mga08y16_433252_c1 | 3300050511 | Bacteria | 1343 |
| 643 | nmdc:mga08y16_73307_c1 | 3300050511 | Bacteria | 3567 |
| 644 | nmdc:mga0n895_15839_c1 | 3300050512 | Bacteria | 6894 |
| 645 | nmdc:mga0n895_227255_c1 | 3300050512 | Unclassified | 1894 |
| 646 | nmdc:mga0n895_296571_c1 | 3300050512 | Bacteria | 1639 |
| 647 | nmdc:mga0n895_47957_c1 | 3300050512 | Bacteria | 4179 |
| 648 | nmdc:mga0n895_664731_c1 | 3300050512 | Unclassified | 1040 |
| 649 | nmdc:mga0n895_845989_c1 | 3300050512 | Bacteria | 903 |
| 650 | nmdc:mga0n895_949719_c1 | 3300050512 | Unclassified | 843 |
| 651 | nmdc:mga0rr50_19458_c1 | 3300050513 | Bacteria | 4583 |
| 652 | nmdc:mga0rr50_275951_c1 | 3300050513 | Unclassified | 1402 |
| 653 | nmdc:mga0rr50_468458_c1 | 3300050513 | Bacteria | 1069 |
| 654 | nmdc:mga08x19_107277_c1 | 3300050514 | Bacteria | 1859 |
| 655 | nmdc:mga08x19_633693_c1 | 3300050514 | Unclassified | 758 |
| 656 | nmdc:mga0a205_11688_c1 | 3300050515 | Bacteria | 8094 |
| 657 | nmdc:mga0a205_16588_c1 | 3300050515 | Bacteria | 6899 |
| 658 | nmdc:mga0a205_241976_c1 | 3300050515 | Unclassified | 1685 |
| 659 | nmdc:mga0a205_38399_c1 | 3300050515 | Bacteria | 4606 |
| 660 | Ga0501084_0020350 | 3300054114 | Bacteria | 5533 |
| 661 | Ga0501084_0044412 | 3300054114 | Bacteria | 3720 |
| 662 | Ga0501084_0101561 | 3300054114 | Bacteria | 2415 |
| 663 | Ga0501084_0122941 | 3300054114 | Bacteria | 2183 |
| 664 | Ga0501084_0149104 | 3300054114 | Bacteria | 1971 |
| 665 | Ga0501084_1350039 | 3300054114 | Unclassified | 597 |
| 666 | Ga0590071_000840 | 3300059421 | Bacteria | 8559 |
| 667 | Ga0590071_001378 | 3300059421 | Bacteria | 6446 |
| 668 | Ga0590071_012945 | 3300059421 | Bacteria | 1955 |
| 669 | Ga0590074_027981 | 3300059423 | Bacteria | 988 |
| 670 | Ga0590075_011464 | 3300059424 | Unclassified | 2144 |
| 671 | Ga0590077_003333 | 3300059426 | Unclassified | 3339 |
| 672 | Ga0590077_047320 | 3300059426 | Bacteria | 963 |
| 673 | Ga0501082_0064827 | 3300060353 | Bacteria | 3146 |
| 674 | Ga0501082_0115609 | 3300060353 | Bacteria | 2323 |
| 675 | Ga0530510_0045789 | 3300061734 | Bacteria | 3160 |
| 676 | Ga0530510_0261692 | 3300061734 | Unclassified | 1290 |
| 677 | JGI25406J46586_10019728 | |||
| 678 | rootH1_10081511 | |||
| 679 | rootL2_10312855 | |||
| 680 | Ga0058860_10050693 | |||
| 681 | Ga0065715_10231613 | |||
| 682 | Ga0065707_10398287 | |||
| 683 | Ga0065707_10576674 | |||
| 684 | Ga0070676_10000316 | |||
| 685 | Ga0070690_100036711 | |||
| 686 | Ga0070690_100893466 | |||
| 687 | Ga0070677_10003999 | |||
| 688 | Ga0070677_10194069 | |||
| 689 | Ga0068869_100006197 | |||
| 690 | Ga0068869_100772643 | |||
| 691 | Ga0070666_10019402 | |||
| 692 | Ga0070680_100086953 | |||
| 693 | Ga0070680_100332820 | |||
| 694 | Ga0070680_101559978 | |||
| 695 | Ga0070682_100086762 | |||
| 696 | Ga0070682_100106291 | |||
| 697 | Ga0070660_100412222 | |||
| 698 | Ga0070660_100747790 | |||
| 699 | Ga0070689_100063553 | |||
| 700 | Ga0070689_101712215 | |||
| 701 | Ga0070691_10008511 | |||
| 702 | Ga0070661_100549352 | |||
| 703 | Ga0070692_10344478 | |||
| 704 | Ga0070692_10524349 | |||
| 705 | Ga0070668_100878559 | |||
| 706 | Ga0070669_100022675 | |||
| 707 | Ga0070669_100091795 | |||
| 708 | Ga0070669_100935199 | |||
| 709 | Ga0070675_100011526 | |||
| 710 | Ga0070675_100373959 | |||
| 711 | Ga0070671_100011492 | |||
| 712 | Ga0070671_100259542 | |||
| 713 | Ga0070671_101026295 | |||
| 714 | Ga0070674_100000162 | |||
| 715 | Ga0070673_100097922 | |||
| 716 | Ga0070673_100134917 | |||
| 717 | Ga0070673_100232987 | |||
| 718 | Ga0070667_100007846 | |||
| 719 | Ga0070667_100155082 | |||
| 720 | Ga0070667_100171412 | |||
| 721 | Ga0070709_10434468 | |||
| 722 | Ga0070714_100603417 | |||
| 723 | Ga0070713_100346307 | |||
| 724 | Ga0070713_102028340 | |||
| 725 | Ga0070710_10215826 | |||
| 726 | Ga0070701_10182122 | |||
| 727 | Ga0070711_100385584 | |||
| 728 | Ga0070711_100499377 | |||
| 729 | Ga0070705_100000832 | |||
| 730 | Ga0070705_100005876 | |||
| 731 | Ga0070705_100618573 | |||
| 732 | Ga0070700_100046301 | |||
| 733 | Ga0070700_100130553 | |||
| 734 | Ga0070700_100235012 | |||
| 735 | Ga0070694_100030607 | |||
| 736 | Ga0070694_100093146 | |||
| 737 | Ga0070694_100185201 | |||
| 738 | Ga0070694_101324417 | |||
| 739 | Ga0070708_100006105 | |||
| 740 | Ga0070708_100017009 | |||
| 741 | Ga0070708_100488338 | |||
| 742 | Ga0070708_100533728 | |||
| 743 | Ga0070708_100572637 | |||
| 744 | Ga0070678_100639649 | |||
| 745 | Ga0070662_100000221 | |||
| 746 | Ga0070662_100179493 | |||
| 747 | Ga0070662_100320297 | |||
| 748 | Ga0070681_10029829 | |||
| 749 | Ga0070681_11074892 | |||
| 750 | Ga0068867_100008237 | |||
| 751 | Ga0068867_100187358 | |||
| 752 | Ga0070706_100010912 | |||
| 753 | Ga0070706_100063982 | |||
| 754 | Ga0070706_100313624 | |||
| 755 | Ga0070706_100386557 | |||
| 756 | Ga0070706_100522408 | |||
| 757 | Ga0070706_100531804 | |||
| 758 | Ga0070706_100667116 | |||
| 759 | Ga0070707_100009174 | |||
| 760 | Ga0070707_100040674 | |||
| 761 | Ga0070707_100197019 | |||
| 762 | Ga0070707_101415077 | |||
| 763 | Ga0070698_100172029 | |||
| 764 | Ga0070698_100680333 | |||
| 765 | Ga0070699_100602450 | |||
| 766 | Ga0070699_100711685 | |||
| 767 | Ga0070679_100018633 | |||
| 768 | Ga0070679_100955141 | |||
| 769 | Ga0070697_100219906 | |||
| 770 | Ga0070697_100238695 | |||
| 771 | Ga0070697_100613008 | |||
| 772 | Ga0068853_100162554 | |||
| 773 | Ga0068853_100822448 | |||
| 774 | Ga0070672_100065536 | |||
| 775 | Ga0070672_100494839 | |||
| 776 | Ga0070672_100799813 | |||
| 777 | Ga0070686_100028710 | |||
| 778 | Ga0070686_100500615 | |||
| 779 | Ga0070695_100001221 | |||
| 780 | Ga0070696_100003268 | |||
| 781 | Ga0070696_100036660 | |||
| 782 | Ga0070696_100038001 | |||
| 783 | Ga0070696_100043686 | |||
| 784 | Ga0070696_100107081 | |||
| 785 | Ga0070696_100134043 | |||
| 786 | Ga0070696_100478508 | |||
| 787 | Ga0070696_100756219 | |||
| 788 | Ga0070696_100959956 | |||
| 789 | Ga0070693_100011432 | |||
| 790 | Ga0070704_100029677 | |||
| 791 | Ga0070704_100033075 | |||
| 792 | Ga0070704_100142810 | |||
| 793 | Ga0070704_101031444 | |||
| 794 | Ga0068855_100032967 | |||
| 795 | Ga0070664_100272293 | |||
| 796 | Ga0070664_100505681 | |||
| 797 | Ga0068857_100004046 | |||
| 798 | Ga0068857_100069735 | |||
| 799 | Ga0068854_100009465 | |||
| 800 | Ga0070702_100509420 | |||
| 801 | Ga0068859_101240213 | |||
| 802 | Ga0068864_100027217 | |||
| 803 | Ga0068864_100273735 | |||
| 804 | Ga0068864_100300848 | |||
| 805 | Ga0068864_100580852 | |||
| 806 | Ga0068866_10002512 | |||
| 807 | Ga0068866_10551202 | |||
| 808 | Ga0068861_101243991 | |||
| 809 | Ga0068861_101479799 | |||
| 810 | Ga0068870_10007826 | |||
| 811 | Ga0068870_10221064 | |||
| 812 | Ga0068863_100118740 | |||
| 813 | Ga0068863_101404578 | |||
| 814 | Ga0068858_100209802 | |||
| 815 | Ga0068858_100234843 | |||
| 816 | Ga0068858_100241862 | |||
| 817 | Ga0068860_100034901 | |||
| 818 | Ga0081455_10057340 | |||
| 819 | Ga0081539_10002359 | |||
| 820 | Ga0081539_10427625 | |||
| 821 | Ga0070715_10303270 | |||
| 822 | Ga0070716_100305061 | |||
| 823 | Ga0097621_100037627 | |||
| 824 | Ga0097621_100460252 | |||
| 825 | Ga0068871_100077175 | |||
| 826 | Ga0075428_100065007 | |||
| 827 | Ga0075428_100195606 | |||
| 828 | Ga0075428_100301117 | |||
| 829 | Ga0075428_100491466 | |||
| 830 | Ga0075428_101985639 | |||
| 831 | Ga0075430_100190896 | |||
| 832 | Ga0075431_100052239 | |||
| 833 | Ga0075431_100279856 | |||
| 834 | Ga0075431_100350607 | |||
| 835 | Ga0075431_100760044 | |||
| 836 | Ga0075433_10023328 | |||
| 837 | Ga0075433_10052531 | |||
| 838 | Ga0075433_10099300 | |||
| 839 | Ga0075434_100050189 | |||
| 840 | Ga0075434_100153575 | |||
| 841 | Ga0075434_100219218 | |||
| 842 | Ga0075434_100248244 | |||
| 843 | Ga0075434_100250059 | |||
| 844 | Ga0075434_100289461 | |||
| 845 | Ga0075429_100008628 | |||
| 846 | Ga0075429_100615235 | |||
| 847 | Ga0068865_100039301 | |||
| 848 | Ga0068865_100985080 | |||
| 849 | Ga0075436_100051335 | |||
| 850 | Ga0075436_100644060 | |||
| 851 | Ga0075436_100780903 | |||
| 852 | Ga0097620_101240545 | |||
| 853 | Ga0075435_100238129 | |||
| 854 | Ga0075435_100518430 | |||
| 855 | Ga0105240_10052398 | |||
| 856 | Ga0111539_10030838 | |||
| 857 | Ga0111539_10702311 | |||
| 858 | Ga0111539_11209130 | |||
| 859 | Ga0105245_10020564 | |||
| 860 | Ga0105245_11938566 | |||
| 861 | Ga0105247_10067992 | |||
| 862 | Ga0114129_10001846 | |||
| 863 | Ga0114129_10169257 | |||
| 864 | Ga0114129_10207332 | |||
| 865 | Ga0114129_10880394 | |||
| 866 | Ga0114129_11345085 | |||
| 867 | Ga0105241_10029502 | |||
| 868 | Ga0105242_10001092 | |||
| 869 | Ga0105242_10871820 | |||
| 870 | Ga0105248_10000907 | |||
| 871 | Ga0105248_10049079 | |||
| 872 | Ga0105248_10094739 | |||
| 873 | Ga0105248_10350357 | |||
| 874 | Ga0105237_11102133 | |||
| 875 | Ga0105238_10592786 | |||
| 876 | Ga0105249_10027117 | |||
| 877 | Ga0105249_10050069 | |||
| 878 | Ga0105249_10112311 | |||
| 879 | Ga0105249_10169472 | |||
| 880 | Ga0105249_11826672 | |||
| 881 | Ga0105239_10036630 | |||
| 882 | Ga0105239_10040582 | |||
| 883 | Ga0105239_10606918 | |||
| 884 | Ga0105239_11504858 | |||
| 885 | Ga0105246_10032663 | |||
| 886 | Ga0105246_11027497 | |||
| 887 | Ga0105246_11058697 | |||
| 888 | Ga0157371_10264487 | |||
| 889 | Ga0157378_10005156 | |||
| 890 | Ga0157378_10490012 | |||
| 891 | Ga0163162_10008376 | |||
| 892 | Ga0163162_10026144 | |||
| 893 | Ga0163162_10041422 | |||
| 894 | Ga0163162_10063915 | |||
| 895 | Ga0157372_10849489 | |||
| 896 | Ga0157372_11012111 | |||
| 897 | Ga0157375_10034591 | |||
| 898 | Ga0157375_10072177 | |||
| 899 | Ga0157375_10308242 | |||
| 900 | Ga0163163_10167567 | |||
| 901 | Ga0163163_12330262 | |||
| 902 | Ga0157380_10003718 | |||
| 903 | Ga0157380_10133367 | |||
| 904 | Ga0157380_10398267 | |||
| 905 | Ga0157379_10058242 | |||
| 906 | Ga0157379_10725781 | |||
| 907 | Ga0157376_10054407 | |||
| 908 | Ga0157376_10077441 | |||
| 909 | Ga0163161_10115943 | |||
| 910 | Ga0207697_10075104 | |||
| 911 | Ga0207697_10143231 | |||
| 912 | Ga0207682_10063348 | |||
| 913 | Ga0207682_10178316 | |||
| 914 | Ga0207642_10006023 | |||
| 915 | Ga0207642_10180540 | |||
| 916 | Ga0207680_10090250 | |||
| 917 | Ga0207647_10229077 | |||
| 918 | Ga0207685_10283944 | |||
| 919 | Ga0207645_10000367 | |||
| 920 | Ga0207645_10057496 | |||
| 921 | Ga0207643_10002434 | |||
| 922 | Ga0207684_10017041 | |||
| 923 | Ga0207684_10211515 | |||
| 924 | Ga0207684_10289844 | |||
| 925 | Ga0207684_10741289 | |||
| 926 | Ga0207684_10797268 | |||
| 927 | Ga0207654_10003813 | |||
| 928 | Ga0207707_10139798 | |||
| 929 | Ga0207707_10494216 | |||
| 930 | Ga0207695_10056126 | |||
| 931 | Ga0207663_10509843 | |||
| 932 | Ga0207660_10126538 | |||
| 933 | Ga0207660_10318007 | |||
| 934 | Ga0207660_10351289 | |||
| 935 | Ga0207657_10117458 | |||
| 936 | Ga0207657_11139056 | |||
| 937 | Ga0207649_10428932 | |||
| 938 | Ga0207652_10265518 | |||
| 939 | Ga0207652_10318626 | |||
| 940 | Ga0207646_10015406 | |||
| 941 | Ga0207646_10043473 | |||
| 942 | Ga0207646_10104036 | |||
| 943 | Ga0207646_10219126 | |||
| 944 | Ga0207646_10686795 | |||
| 945 | Ga0207646_10884146 | |||
| 946 | Ga0207681_10003521 | |||
| 947 | Ga0207681_10141518 | |||
| 948 | Ga0207681_11042075 | |||
| 949 | Ga0207694_10449321 | |||
| 950 | Ga0207659_10121468 | |||
| 951 | Ga0207659_10325564 | |||
| 952 | Ga0207659_10588302 | |||
| 953 | Ga0207659_10805312 | |||
| 954 | Ga0207687_10040114 | |||
| 955 | Ga0207644_10753000 | |||
| 956 | Ga0207690_10941271 | |||
| 957 | Ga0207706_10000121 | |||
| 958 | Ga0207706_10352390 | |||
| 959 | Ga0207686_10000081 | |||
| 960 | Ga0207686_10541591 | |||
| 961 | Ga0207709_10010880 | |||
| 962 | Ga0207670_10244277 | |||
| 963 | Ga0207669_10007755 | |||
| 964 | Ga0207704_10017762 | |||
| 965 | Ga0207704_10293761 | |||
| 966 | Ga0207704_11058683 | |||
| 967 | Ga0207691_10029903 | |||
| 968 | Ga0207691_10142871 | |||
| 969 | Ga0207691_11112808 | |||
| 970 | Ga0207711_10002289 | |||
| 971 | Ga0207711_10094686 | |||
| 972 | Ga0207711_10434553 | |||
| 973 | Ga0207689_10001917 | |||
| 974 | Ga0207661_11668317 | |||
| 975 | Ga0207679_10025032 | |||
| 976 | Ga0207679_10323091 | |||
| 977 | Ga0207679_10589669 | |||
| 978 | Ga0207651_10086345 | |||
| 979 | Ga0207651_10211499 | |||
| 980 | Ga0207651_10349084 | |||
| 981 | Ga0207712_10039573 | |||
| 982 | Ga0207712_10496793 | |||
| 983 | Ga0207712_10801865 | |||
| 984 | Ga0207668_10010535 | |||
| 985 | Ga0207640_10000470 | |||
| 986 | Ga0207640_10556455 | |||
| 987 | Ga0207658_10007465 | |||
| 988 | Ga0207658_10134709 | |||
| 989 | Ga0207658_10353119 | |||
| 990 | Ga0207703_10040226 | |||
| 991 | Ga0207703_10664009 | |||
| 992 | Ga0207703_10762035 | |||
| 993 | Ga0207639_10116461 | |||
| 994 | Ga0207639_10641584 | |||
| 995 | Ga0207678_10218465 | |||
| 996 | Ga0207678_10287235 | |||
| 997 | Ga0207708_10053478 | |||
| 998 | Ga0207708_10063238 | |||
| 999 | Ga0207641_11153017 | |||
| 1000 | Ga0207648_10000107 | |||
| 1001 | Ga0207648_10142432 | |||
| 1002 | Ga0207676_10001028 | |||
| 1003 | Ga0207676_10017014 | |||
| 1004 | Ga0207676_10350005 | |||
| 1005 | Ga0207674_10015420 | |||
| 1006 | Ga0207674_10094427 | |||
| 1007 | Ga0207674_11605742 | |||
| 1008 | Ga0207675_100033916 | |||
| 1009 | Ga0207675_100101062 | |||
| 1010 | Ga0207675_101354370 | |||
| 1011 | Ga0207683_10667058 | |||
| 1012 | Ga0207683_11581519 | |||
| 1013 | Ga0209970_1052019 | |||
| 1014 | Ga0207428_10194625 | |||
| 1015 | Ga0207428_10205460 | |||
| 1016 | Ga0207428_10221541 | |||
| 1017 | Ga0268266_10437894 | |||
| 1018 | Ga0268265_10152825 | |||
| 1019 | Ga0268265_10279484 | |||
| 1020 | Ga0268265_10301552 | |||
| 1021 | Ga0268265_10461959 | |||
| 1022 | Ga0268264_10002811 | |||
| 1023 | Ga0268264_10505269 | |||
| 1024 | Ga0307408_100043200 | |||
| 1025 | Ga0307408_100047447 | |||
| 1026 | Ga0307408_100067471 | |||
| 1027 | Ga0307408_100142493 | |||
| 1028 | Ga0307408_100482761 | |||
| 1029 | Ga0307408_100835608 | |||
| 1030 | Ga0307408_100903672 | |||
| 1031 | Ga0307408_100915514 | |||
| 1032 | Ga0307405_10016555 | |||
| 1033 | Ga0307405_10062701 | |||
| 1034 | Ga0307405_10380689 | |||
| 1035 | Ga0307405_10656454 | |||
| 1036 | Ga0307413_10006839 | |||
| 1037 | Ga0307413_10011396 | |||
| 1038 | Ga0307413_10264332 | |||
| 1039 | Ga0307413_10282661 | |||
| 1040 | Ga0307413_10292241 | |||
| 1041 | Ga0307413_10366337 | |||
| 1042 | Ga0307410_10000581 | |||
| 1043 | Ga0307410_10018802 | |||
| 1044 | Ga0307410_10048296 | |||
| 1045 | Ga0307410_10063076 | |||
| 1046 | Ga0307410_10082294 | |||
| 1047 | Ga0307410_10092886 | |||
| 1048 | Ga0307410_10094783 | |||
| 1049 | Ga0307410_10307495 | |||
| 1050 | Ga0307410_10371125 | |||
| 1051 | Ga0307410_10376077 | |||
| 1052 | Ga0307406_10011559 | |||
| 1053 | Ga0307406_10031276 | |||
| 1054 | Ga0307406_10103177 | |||
| 1055 | Ga0307406_10197932 | |||
| 1056 | Ga0307406_10566871 | |||
| 1057 | Ga0307406_10801828 | |||
| 1058 | Ga0307407_10002900 | |||
| 1059 | Ga0307407_10365708 | |||
| 1060 | Ga0307407_10709436 | |||
| 1061 | Ga0307407_10721901 | |||
| 1062 | Ga0307412_10028295 | |||
| 1063 | Ga0307412_10157522 | |||
| 1064 | Ga0307409_100004424 | |||
| 1065 | Ga0307409_100029664 | |||
| 1066 | Ga0307409_100029738 | |||
| 1067 | Ga0307409_100240215 | |||
| 1068 | Ga0307409_100275711 | |||
| 1069 | Ga0307409_100319489 | |||
| 1070 | Ga0307409_100407046 | |||
| 1071 | Ga0307409_100538654 | |||
| 1072 | Ga0307409_100827928 | |||
| 1073 | Ga0307409_101070251 | |||
| 1074 | Ga0307409_101186320 | |||
| 1075 | Ga0307416_100000301 | |||
| 1076 | Ga0307416_100024175 | |||
| 1077 | Ga0307416_100049489 | |||
| 1078 | Ga0307416_100113509 | |||
| 1079 | Ga0307416_100152034 | |||
| 1080 | Ga0307416_100162402 | |||
| 1081 | Ga0307416_100342118 | |||
| 1082 | Ga0307416_100342465 | |||
| 1083 | Ga0307416_100702225 | |||
| 1084 | Ga0307416_100742605 | |||
| 1085 | Ga0307416_101063999 | |||
| 1086 | Ga0307414_10002345 | |||
| 1087 | Ga0307414_10007749 | |||
| 1088 | Ga0307414_10018217 | |||
| 1089 | Ga0307414_10027858 | |||
| 1090 | Ga0307414_10192008 | |||
| 1091 | Ga0307414_10262090 | |||
| 1092 | Ga0307414_10383305 | |||
| 1093 | Ga0307414_10427856 | |||
| 1094 | Ga0307414_10938201 | |||
| 1095 | Ga0307411_10000425 | |||
| 1096 | Ga0307411_10004190 | |||
| 1097 | Ga0307411_10007295 | |||
| 1098 | Ga0307411_10007974 | |||
| 1099 | Ga0307411_10040645 | |||
| 1100 | Ga0307411_10341281 | |||
| 1101 | Ga0307411_10836082 | |||
| 1102 | Ga0307415_100002039 | |||
| 1103 | Ga0307415_100003756 | |||
| 1104 | Ga0307415_100031276 | |||
| 1105 | Ga0307415_100083656 | |||
| 1106 | Ga0307415_100099119 | |||
| 1107 | Ga0307415_100124804 | |||
| 1108 | Ga0307415_100971915 | |||
| 1109 | Ga0373959_0117638 | |||
| 1110 | Ga0373949_0068499 | |||
| 1111 | Ga0373960_0206731 | |||
| 1112 | Ga0373961_0028301 | |||
| 1113 | Ga0373931_0009861 | |||
| 1114 | Ga0395905_0210481 | |||
| 1115 | Ga0395905_0563685 | |||
| 1116 | Ga0395901_0310577 | |||
| 1117 | Ga0242420_128971 | |||
| 1118 | Ga0451793_0280683 | |||
| 1119 | Ga0451807_0455648 | |||
| 1120 | Ga0451833_0507750 | |||
| 1121 | Ga0451853_1846957 | |||
| 1122 | Ga0439446_0011436 | |||
| 1123 | Ga0439434_0143551 | |||
| 1124 | Ga0439459_0062179 | |||
| 1125 | Ga0451577_0023487 | |||
| 1126 | Ga0451577_0310175 | |||
| 1127 | Ga0451577_0343375 | |||
| 1128 | Ga0453683_0212726 | |||
| 1129 | Ga0453684_0164880 | |||
| 1130 | Ga0453684_0346494 | |||
| 1131 | Ga0451576_0254141 | |||
| 1132 | Ga0451576_1649660 | |||
| 1133 | Ga0466967_0808593 | |||
| 1134 | Ga0495603_0065268 | |||
| 1135 | Ga0495603_0361228 | |||
| 1136 | Ga0495641_0014520 | |||
| 1137 | Ga0495651_0489689 | |||
| 1138 | Ga0495580_0158431 | |||
| 1139 | Ga0495639_0423440 | |||
| 1140 | Ga0495639_0436449 | |||
| 1141 | Ga0495664_0049026 | |||
| 1142 | Ga0495594_0025662 | |||
| 1143 | Ga0495594_0029471 | |||
| 1144 | Ga0495618_0024144 | |||
| 1145 | Ga0495630_0044914 | |||
| 1146 | Ga0495640_0033767 | |||
| 1147 | Ga0495586_0005553 | |||
| 1148 | Ga0495621_0283777 | |||
| 1149 | Ga0495622_0289492 | |||
| 1150 | Ga0495633_0257896 | |||
| 1151 | Ga0495667_0153238 | |||
| 1152 | Ga0495656_0477429 | |||
| 1153 | Ga0495634_0013988 | |||
| 1154 | Ga0495647_0012629 | |||
| 1155 | Ga0495658_0371334 | |||
| 1156 | Ga0495613_0373316 | |||
| 1157 | Ga0495674_0022355 | |||
| 1158 | Ga0495676_0213883 | |||
| 1159 | Ga0495680_0013290 | |||
| 1160 | Ga0495684_0105240 | |||
| 1161 | Ga0496100_0078169 | |||
| 1162 | Ga0496100_0161426 | |||
| 1163 | Ga0496101_0046131 | |||
| 1164 | Ga0496101_0103059 | |||
| 1165 | Ga0496101_0143456 | |||
| 1166 | Ga0496102_0005252 | |||
| 1167 | Ga0496102_0015476 | |||
| 1168 | Ga0496102_0026151 | |||
| 1169 | Ga0496102_0039337 | |||
| 1170 | Ga0496103_0016984 | |||
| 1171 | Ga0496103_0125156 | |||
| 1172 | Ga0496103_0481903 | |||
| 1173 | Ga0496103_0713457 | |||
| 1174 | Ga0496104_0001703 | |||
| 1175 | Ga0496104_0070831 | |||
| 1176 | Ga0496104_0108043 | |||
| 1177 | Ga0496104_0126307 | |||
| 1178 | Ga0496104_0327759 | |||
| 1179 | Ga0496104_0387360 | |||
| 1180 | Ga0496105_0060895 | |||
| 1181 | Ga0496105_0261298 | |||
| 1182 | Ga0496105_0370517 | |||
| 1183 | Ga0496106_0004623 | |||
| 1184 | Ga0496106_0009898 | |||
| 1185 | Ga0496106_0107963 | |||
| 1186 | Ga0496106_0233816 | |||
| 1187 | Ga0496106_0555636 | |||
| 1188 | Ga0496107_0007683 | |||
| 1189 | Ga0496107_0168629 | |||
| 1190 | Ga0496107_0915363 | |||
| 1191 | Ga0496108_0000426 | |||
| 1192 | Ga0496108_0000573 | |||
| 1193 | Ga0496108_0004627 | |||
| 1194 | Ga0496108_0016790 | |||
| 1195 | Ga0496108_0093975 | |||
| 1196 | Ga0496109_0000596 | |||
| 1197 | Ga0496109_0003769 | |||
| 1198 | Ga0496109_0008246 | |||
| 1199 | Ga0496109_0014082 | |||
| 1200 | Ga0496109_0077845 | |||
| 1201 | Ga0496110_0002244 | |||
| 1202 | Ga0496110_0005269 | |||
| 1203 | Ga0496110_0007351 | |||
| 1204 | Ga0496110_0062740 | |||
| 1205 | Ga0496110_0285756 | |||
| 1206 | Ga0496111_0004937 | |||
| 1207 | Ga0496111_0024767 | |||
| 1208 | Ga0496111_0025388 | |||
| 1209 | Ga0496112_0004531 | |||
| 1210 | Ga0496112_0007174 | |||
| 1211 | Ga0496112_0010496 | |||
| 1212 | Ga0496112_0014112 | |||
| 1213 | Ga0496113_0000965 | |||
| 1214 | Ga0496113_0004825 | |||
| 1215 | Ga0496113_0005440 | |||
| 1216 | Ga0496113_0021171 | |||
| 1217 | Ga0496113_0813878 | |||
| 1218 | Ga0496114_0003263 | |||
| 1219 | Ga0496114_0355442 | |||
| 1220 | Ga0496114_0407220 | |||
| 1221 | Ga0496115_0122769 | |||
| 1222 | Ga0496115_0152979 | |||
| 1223 | Ga0501298_060074 | |||
| 1224 | Ga0501031_0037628 | |||
| 1225 | Ga0501032_0446313 | |||
| 1226 | Ga0501033_0093441 | |||
| 1227 | Ga0501033_0150264 | |||
| 1228 | Ga0501034_0211055 | |||
| 1229 | Ga0501036_0036627 | |||
| 1230 | Ga0501038_0187889 | |||
| 1231 | Ga0501038_0229384 | |||
| 1232 | Ga0501039_0054202 | |||
| 1233 | Ga0501040_0009895 | |||
| 1234 | Ga0501040_0266602 | |||
| 1235 | Ga0501041_0116854 | |||
| 1236 | Ga0501041_0325710 | |||
| 1237 | Ga0501042_0010630 | |||
| 1238 | Ga0501042_0071850 | |||
| 1239 | Ga0501046_0247152 | |||
| 1240 | Ga0501048_0073168 | |||
| 1241 | Ga0501048_0129649 | |||
| 1242 | Ga0501067_0073711 | |||
| 1243 | Ga0501067_0201989 | |||
| 1244 | Ga0501067_0236568 | |||
| 1245 | Ga0501069_0060756 | |||
| 1246 | Ga0501069_0073917 | |||
| 1247 | Ga0501069_0358502 | |||
| 1248 | Ga0501070_0529526 | |||
| 1249 | Ga0501071_0027731 | |||
| 1250 | Ga0501072_0016740 | |||
| 1251 | Ga0501072_0070322 | |||
| 1252 | Ga0501073_0042716 | |||
| 1253 | Ga0501073_0298422 | |||
| 1254 | Ga0501074_0007240 | |||
| 1255 | Ga0501075_0014329 | |||
| 1256 | Ga0501075_0042159 | |||
| 1257 | Ga0501076_0015841 | |||
| 1258 | Ga0501076_0110867 | |||
| 1259 | Ga0501076_0340440 | |||
| 1260 | Ga0501077_0000553 | |||
| 1261 | Ga0501077_0001357 | |||
| 1262 | Ga0501077_0221548 | |||
| 1263 | Ga0501077_0432784 | |||
| 1264 | Ga0501209_007958 | |||
| 1265 | Ga0501209_015935 | |||
| 1266 | Ga0501209_031323 | |||
| 1267 | Ga0501214_007009 | |||
| 1268 | Ga0501216_000868 | |||
| 1269 | Ga0501217_005539 | |||
| 1270 | Ga0501217_070280 | |||
| 1271 | Ga0501233_006433 | |||
| 1272 | Ga0501233_051709 | |||
| 1273 | Ga0501236_026165 | |||
| 1274 | Ga0501242_015879 | |||
| 1275 | Ga0501243_003788 | |||
| 1276 | Ga0501247_004436 | |||
| 1277 | Ga0501249_009951 | |||
| 1278 | Ga0501249_054049 | |||
| 1279 | Ga0501250_064956 | |||
| 1280 | Ga0501255_050854 | |||
| 1281 | Ga0501257_004942 | |||
| 1282 | Ga0501257_056540 | |||
| 1283 | Ga0501259_078088 | |||
| 1284 | Ga0501234_038479 | |||
| 1285 | Ga0501234_051038 | |||
| 1286 | Ga0501245_070513 | |||
| 1287 | Ga0501079_0001648 | |||
| 1288 | Ga0501079_0014834 | |||
| 1289 | Ga0501079_0023403 | |||
| 1290 | Ga0501080_0032490 | |||
| 1291 | Ga0501081_0027233 | |||
| 1292 | Ga0501081_0058686 | |||
| 1293 | Ga0501083_0070532 | |||
| 1294 | Ga0501083_0411877 | |||
| 1295 | Ga0501241_032908 | |||
| 1296 | Ga0501263_000186 | |||
| 1297 | Ga0501268_002479 | |||
| 1298 | Ga0501272_015738 | |||
| 1299 | Ga0501275_031444 | |||
| 1300 | Ga0501283_050455 | |||
| 1301 | Ga0501035_0820818 | |||
| 1302 | Ga0501045_0003788 | |||
| 1303 | Ga0501045_0116561 | |||
| 1304 | Ga0501045_0902418 | |||
| 1305 | Ga0501204_020801 | |||
| 1306 | nmdc:mga05p37_1561132_c1 | |||
| 1307 | nmdc:mga05p37_1741_c1 | |||
| 1308 | nmdc:mga05p37_201630_c1 | |||
| 1309 | nmdc:mga05p37_569064_c1 | |||
| 1310 | nmdc:mga09592_67806_c1 | |||
| 1311 | nmdc:mga0qj67_1411250_c1 | |||
| 1312 | nmdc:mga0qj67_21997_c1 | |||
| 1313 | nmdc:mga0qj67_411816_c1 | |||
| 1314 | nmdc:mga0qj67_454583_c1 | |||
| 1315 | nmdc:mga06r32_406131_c1 | |||
| 1316 | nmdc:mga06r32_680719_c1 | |||
| 1317 | nmdc:mga06r32_6937_c1 | |||
| 1318 | nmdc:mga08y16_433252_c1 | |||
| 1319 | nmdc:mga08y16_73307_c1 | |||
| 1320 | nmdc:mga0n895_15839_c1 | |||
| 1321 | nmdc:mga0n895_227255_c1 | |||
| 1322 | nmdc:mga0n895_296571_c1 | |||
| 1323 | nmdc:mga0n895_47957_c1 | |||
| 1324 | nmdc:mga0n895_664731_c1 | |||
| 1325 | nmdc:mga0n895_845989_c1 | |||
| 1326 | nmdc:mga0n895_949719_c1 | |||
| 1327 | nmdc:mga0rr50_19458_c1 | |||
| 1328 | nmdc:mga0rr50_275951_c1 | |||
| 1329 | nmdc:mga0rr50_468458_c1 | |||
| 1330 | nmdc:mga08x19_107277_c1 | |||
| 1331 | nmdc:mga08x19_633693_c1 | |||
| 1332 | nmdc:mga0a205_11688_c1 | |||
| 1333 | nmdc:mga0a205_16588_c1 | |||
| 1334 | nmdc:mga0a205_241976_c1 | |||
| 1335 | nmdc:mga0a205_38399_c1 | |||
| 1336 | Ga0501084_0020350 | |||
| 1337 | Ga0501084_0044412 | |||
| 1338 | Ga0501084_0101561 | |||
| 1339 | Ga0501084_0122941 | |||
| 1340 | Ga0501084_0149104 | |||
| 1341 | Ga0501084_1350039 | |||
| 1342 | Ga0590071_000840 | |||
| 1343 | Ga0590071_001378 | |||
| 1344 | Ga0590071_012945 | |||
| 1345 | Ga0590074_027981 | |||
| 1346 | Ga0590075_011464 | |||
| 1347 | Ga0590077_003333 | |||
| 1348 | Ga0590077_047320 | |||
| 1349 | Ga0501082_0064827 | |||
| 1350 | Ga0501082_0115609 | |||
| 1351 | Ga0530510_0045789 | |||
| 1352 | Ga0530510_0261692 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lze-assembly1.cif.gz_A | plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37c catalytic residue mutant | 0.9308 | 16 | 175 |
| 2a0s-assembly1.cif.gz_A | crystal structure of 6-pyruvoyl tetrahydropterin synthase (ptps) from plasmodium vivax at 2.2 a resolution | 0.9296 | 16 | 175 |
| 3m0n-assembly1.cif.gz_A | plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37a catalytic residue mutant | 0.9295 | 16 | 175 |
| 1y13-assembly1.cif.gz_A | structural analysis of plasmodium falciparum 6-pyruvoyl tetrahydropterin synthase (ptps) | 0.9234 | 17 | 175 |
| 3lze-assembly1.cif.gz_A | plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37c catalytic residue mutant | 0.9092 | 16 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1y13C00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9187 | 17 | 175 | 3.30.479.10 |
| af_Q58668_4_160_3.30.479.10 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9125 | 28 | 175 | 3.30.479.10 |
| 1y13C00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.8973 | 17 | 175 | 3.30.479.10 |
| af_Q5I0E5_1_204_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.8682 | 95 | 117 | 1.20.140.150 |
| af_Q58668_4_160_3.30.479.10 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.8576 | 28 | 175 | 3.30.479.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3L7XJS4-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9709 | 67 | 176 |
GO:0070497
|
| AF-A0A535SCS7-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9633 | 49 | 176 |
GO:0070497
|
| AF-A0A3L7XJS4-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9622 | 67 | 176 |
GO:0070497
|
| AF-A0A7Y4RQC4-F1-model_v4 | Uncharacterized protein | 0.9608 | 87 | 147 |
|
| AF-A0A800EGC0-F1-model_v4 | deleted | 0.9559 | 74 | 176 |
|