F474444
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 675 | 382 | 639 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_0228735|Ga0436361_0228735_175_936 |
| Length | 245 |
| Sequence | MPKHALKLAFAALLLIALPAWAQSGGSTSATLPLLVGQGAGGTSYSVPIQTLLFFTALGFLPAVLLMMTGFTRIVIVLSLLRQALGTQSAPPNQVVVGLSLFLTFFVMSPTLDKVYADAWQPYSAGQITFDVALDKAQAPMRGFMLKQTRNSDLTLFARLAKLDPTTTKPETVPFRVLVPAFVTSELKSAFQIAFLIFIPFLVIDMIVSSVLMSLGMSLPFKLMLFVLADGWNLLLGSLAASFVQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 4 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 5 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 6 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 7 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 8 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 9 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 10 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 11 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 12 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 13 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 14 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 15 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 16 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 17 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 18 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 19 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 20 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 21 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 22 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 23 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 24 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 25 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 26 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 27 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 28 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 29 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 30 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 31 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 32 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 33 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 34 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 35 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 36 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 37 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 38 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 39 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 40 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 41 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 42 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 43 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 45 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 49 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 51 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 54 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 55 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 56 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 57 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 63 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 67 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 82 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 90 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 92 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 99 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 100 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 101 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 102 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 103 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 104 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 105 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 106 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 107 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 117 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 118 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 146 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 219 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 228 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 229 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 231 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 233 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 237 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 238 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 239 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 240 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 241 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 243 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 244 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 247 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 248 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 249 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 250 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 251 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 252 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 253 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 255 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 258 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 261 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 264 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 266 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 267 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 268 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 269 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 270 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 277 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 278 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 279 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 280 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 281 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 282 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 283 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 284 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 285 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 286 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 287 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 288 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 289 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 290 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 291 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 292 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 293 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 294 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 295 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 296 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 297 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 298 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 299 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 302 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 303 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 330 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 331 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 332 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 335 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 336 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 337 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 338 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 339 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 340 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 341 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 348 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 349 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 350 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 351 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 352 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 353 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 354 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 355 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 356 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 357 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 358 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 359 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 360 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 364 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 365 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 366 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 367 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 368 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 369 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 370 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 371 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 373 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 374 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 375 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 376 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 377 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 378 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 379 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 380 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 381 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.48 |
| Metatranscriptomes | 1.19 |
| Isolates | 5.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12 |
| Nodule | 1.04 |
| Rhizoplane | 3.7 |
| Rhizosphere | 73.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2574424 | 2162886007 | Bacteria | 1138 |
| 2 | JGI24741J21665_1000016 | 3300001915 | Bacteria | 39450 |
| 3 | JGI24740J21852_10000113 | 3300001979 | Bacteria | 29498 |
| 4 | JGI25152J39213_1003322 | 3300002773 | Bacteria | 5545 |
| 5 | JGI25153J46596_10012754 | 3300003215 | Bacteria | 3601 |
| 6 | Ga0006562J51391_1019837 | 3300003578 | Bacteria | 3864 |
| 7 | Ga0055539_1000127 | 3300003752 | Bacteria | 80618 |
| 8 | Ga0055532_1000054 | 3300003758 | Bacteria | 161617 |
| 9 | Ga0055525_1000278 | 3300003759 | Bacteria | 47097 |
| 10 | Ga0055527_1001718 | 3300003760 | Bacteria | 4272 |
| 11 | Ga0055535_1000037 | 3300003761 | Bacteria | 161617 |
| 12 | Ga0055529_1000070 | 3300003763 | Bacteria | 161617 |
| 13 | Ga0055526_1002532 | 3300003771 | Bacteria | 12277 |
| 14 | Ga0055540_1018737 | 3300003792 | Bacteria | 1888 |
| 15 | Ga0055531_10000043 | 3300003794 | Bacteria | 133906 |
| 16 | Ga0055543_1001524 | 3300004625 | Bacteria | 9081 |
| 17 | Ga0065165_1000390 | 3300005262 | Bacteria | 71262 |
| 18 | Ga0065165_1001585 | 3300005262 | Bacteria | 23411 |
| 19 | Ga0065165_1003619 | 3300005262 | Bacteria | 10607 |
| 20 | Ga0065704_10072289 | 3300005289 | Bacteria | 8798 |
| 21 | Ga0065704_10183301 | 3300005289 | Bacteria | 1226 |
| 22 | Ga0065712_10257904 | 3300005290 | Bacteria | 942 |
| 23 | Ga0065715_10145513 | 3300005293 | Bacteria | 1794 |
| 24 | Ga0065707_10029338 | 3300005295 | Bacteria | 1472 |
| 25 | Ga0070676_10001849 | 3300005328 | Bacteria | 10793 |
| 26 | Ga0070676_10019835 | 3300005328 | Bacteria | 3745 |
| 27 | Ga0070683_100032863 | 3300005329 | Bacteria | 4728 |
| 28 | Ga0070690_100017913 | 3300005330 | Bacteria | 4269 |
| 29 | Ga0070670_100037154 | 3300005331 | Bacteria | 4190 |
| 30 | Ga0070670_100095571 | 3300005331 | Bacteria | 2556 |
| 31 | Ga0068869_100013993 | 3300005334 | Bacteria | 5351 |
| 32 | Ga0068869_100067518 | 3300005334 | Bacteria | 2638 |
| 33 | Ga0070666_10071419 | 3300005335 | Bacteria | 2362 |
| 34 | Ga0070680_100121871 | 3300005336 | Bacteria | 2177 |
| 35 | Ga0070682_100015765 | 3300005337 | Bacteria | 4385 |
| 36 | Ga0068868_100003711 | 3300005338 | Bacteria | 10664 |
| 37 | Ga0068868_100052781 | 3300005338 | Bacteria | 3200 |
| 38 | Ga0068868_100140028 | 3300005338 | Bacteria | 1985 |
| 39 | Ga0070660_100002224 | 3300005339 | Bacteria | 13368 |
| 40 | Ga0070689_100021223 | 3300005340 | Bacteria | 4830 |
| 41 | Ga0070661_100000068 | 3300005344 | Bacteria | 83844 |
| 42 | Ga0070661_100005152 | 3300005344 | Bacteria | 9001 |
| 43 | Ga0070668_100013101 | 3300005347 | Bacteria | 6179 |
| 44 | Ga0070668_100019903 | 3300005347 | Bacteria | 5057 |
| 45 | Ga0070668_100130926 | 3300005347 | Bacteria | 2013 |
| 46 | Ga0070669_100081110 | 3300005353 | Bacteria | 2416 |
| 47 | Ga0070669_100523006 | 3300005353 | Bacteria | 986 |
| 48 | Ga0070675_100003213 | 3300005354 | Bacteria | 12380 |
| 49 | Ga0070675_100011215 | 3300005354 | Bacteria | 7015 |
| 50 | Ga0070675_100012571 | 3300005354 | Bacteria | 6636 |
| 51 | Ga0070675_100025359 | 3300005354 | Bacteria | 4754 |
| 52 | Ga0070671_100006682 | 3300005355 | Bacteria | 9222 |
| 53 | Ga0070671_100104203 | 3300005355 | Bacteria | 2380 |
| 54 | Ga0070671_100126528 | 3300005355 | Bacteria | 2151 |
| 55 | Ga0070671_100152385 | 3300005355 | Bacteria | 1952 |
| 56 | Ga0070674_100021390 | 3300005356 | Bacteria | 4152 |
| 57 | Ga0070674_100029632 | 3300005356 | Bacteria | 3608 |
| 58 | Ga0070674_100038484 | 3300005356 | Bacteria | 3223 |
| 59 | Ga0070673_100027009 | 3300005364 | Bacteria | 4249 |
| 60 | Ga0070673_100073056 | 3300005364 | Bacteria | 2760 |
| 61 | Ga0070673_100274931 | 3300005364 | Bacteria | 1475 |
| 62 | Ga0070673_100324082 | 3300005364 | Bacteria | 1361 |
| 63 | Ga0070659_100008671 | 3300005366 | Bacteria | 7436 |
| 64 | Ga0070659_100362210 | 3300005366 | Bacteria | 1218 |
| 65 | Ga0070667_100067360 | 3300005367 | Bacteria | 3043 |
| 66 | Ga0070667_100080718 | 3300005367 | Bacteria | 2782 |
| 67 | Ga0070663_100000008 | 3300005455 | Bacteria | 188775 |
| 68 | Ga0070663_100193644 | 3300005455 | Bacteria | 1583 |
| 69 | Ga0070678_100093252 | 3300005456 | Bacteria | 2315 |
| 70 | Ga0070678_100099107 | 3300005456 | Bacteria | 2254 |
| 71 | Ga0070662_100052894 | 3300005457 | Bacteria | 2938 |
| 72 | Ga0068867_100000329 | 3300005459 | Bacteria | 31296 |
| 73 | Ga0068867_100001932 | 3300005459 | Bacteria | 14439 |
| 74 | Ga0068867_100020667 | 3300005459 | Bacteria | 4691 |
| 75 | Ga0068867_100023879 | 3300005459 | Bacteria | 4379 |
| 76 | Ga0070685_10168252 | 3300005466 | Bacteria | 1403 |
| 77 | Ga0070706_100096620 | 3300005467 | Bacteria | 2743 |
| 78 | Ga0070679_100043614 | 3300005530 | Bacteria | 4466 |
| 79 | Ga0070679_100212093 | 3300005530 | Bacteria | 1900 |
| 80 | Ga0070672_100015547 | 3300005543 | Bacteria | 5423 |
| 81 | Ga0070672_100021732 | 3300005543 | Bacteria | 4699 |
| 82 | Ga0070672_100027777 | 3300005543 | Bacteria | 4224 |
| 83 | Ga0070672_100030773 | 3300005543 | Bacteria | 4036 |
| 84 | Ga0070696_100360898 | 3300005546 | Bacteria | 1127 |
| 85 | Ga0070693_100026317 | 3300005547 | Bacteria | 3140 |
| 86 | Ga0070665_100294589 | 3300005548 | Bacteria | 1625 |
| 87 | Ga0068855_100015066 | 3300005563 | Bacteria | 9310 |
| 88 | Ga0068855_100019544 | 3300005563 | Bacteria | 8138 |
| 89 | Ga0068855_100225804 | 3300005563 | Bacteria | 2099 |
| 90 | Ga0070664_100000009 | 3300005564 | Bacteria | 166396 |
| 91 | Ga0070664_100001831 | 3300005564 | Bacteria | 17028 |
| 92 | Ga0068857_100001323 | 3300005577 | Bacteria | 19468 |
| 93 | Ga0068857_100015752 | 3300005577 | Bacteria | 6615 |
| 94 | Ga0068854_100000696 | 3300005578 | Bacteria | 19953 |
| 95 | Ga0068854_100173915 | 3300005578 | Bacteria | 1677 |
| 96 | Ga0068854_100183822 | 3300005578 | Bacteria | 1634 |
| 97 | Ga0068854_100285357 | 3300005578 | Bacteria | 1331 |
| 98 | Ga0068856_100000019 | 3300005614 | Bacteria | 150500 |
| 99 | Ga0068856_100586060 | 3300005614 | Bacteria | 1136 |
| 100 | Ga0070702_100217785 | 3300005615 | Bacteria | 1275 |
| 101 | Ga0068852_100003215 | 3300005616 | Bacteria | 11409 |
| 102 | Ga0068852_100005883 | 3300005616 | Bacteria | 8816 |
| 103 | Ga0068852_100123382 | 3300005616 | Bacteria | 2375 |
| 104 | Ga0068852_100197993 | 3300005616 | Bacteria | 1900 |
| 105 | Ga0068859_100111138 | 3300005617 | Bacteria | 2802 |
| 106 | Ga0068859_100205505 | 3300005617 | Bacteria | 2054 |
| 107 | Ga0068859_100367200 | 3300005617 | Bacteria | 1534 |
| 108 | Ga0068864_100003978 | 3300005618 | Bacteria | 12169 |
| 109 | Ga0068864_100008283 | 3300005618 | Bacteria | 8574 |
| 110 | Ga0068864_100026806 | 3300005618 | Bacteria | 4860 |
| 111 | Ga0068866_10002548 | 3300005718 | Bacteria | 7508 |
| 112 | Ga0068866_10092812 | 3300005718 | Bacteria | 1648 |
| 113 | Ga0068861_100007969 | 3300005719 | Bacteria | 7292 |
| 114 | Ga0068861_100010826 | 3300005719 | Bacteria | 6339 |
| 115 | Ga0068851_10049026 | 3300005834 | Bacteria | 2141 |
| 116 | Ga0068851_10110219 | 3300005834 | Bacteria | 1468 |
| 117 | Ga0068870_10013055 | 3300005840 | Bacteria | 3893 |
| 118 | Ga0068863_100160408 | 3300005841 | Bacteria | 2154 |
| 119 | Ga0068858_100001515 | 3300005842 | Bacteria | 23851 |
| 120 | Ga0068858_100001818 | 3300005842 | Bacteria | 21717 |
| 121 | Ga0068858_100363431 | 3300005842 | Bacteria | 1387 |
| 122 | Ga0068860_100001009 | 3300005843 | Bacteria | 31175 |
| 123 | Ga0068860_100001710 | 3300005843 | Bacteria | 23445 |
| 124 | Ga0068860_100057253 | 3300005843 | Bacteria | 3705 |
| 125 | Ga0068860_100249680 | 3300005843 | Bacteria | 1727 |
| 126 | Ga0068862_100016575 | 3300005844 | Bacteria | 6136 |
| 127 | Ga0068862_100036617 | 3300005844 | Bacteria | 4159 |
| 128 | Ga0075364_10011206 | 3300006051 | Bacteria | 5444 |
| 129 | Ga0075366_10005265 | 3300006195 | Bacteria | 7007 |
| 130 | Ga0075366_10025896 | 3300006195 | Bacteria | 3431 |
| 131 | Ga0075366_10083646 | 3300006195 | Bacteria | 1907 |
| 132 | Ga0075366_10089230 | 3300006195 | Bacteria | 1846 |
| 133 | Ga0075366_10259869 | 3300006195 | Bacteria | 1060 |
| 134 | Ga0097621_100056447 | 3300006237 | Bacteria | 3208 |
| 135 | Ga0097621_100104372 | 3300006237 | Bacteria | 2388 |
| 136 | Ga0097621_100454272 | 3300006237 | Bacteria | 1154 |
| 137 | Ga0075370_10010292 | 3300006353 | Bacteria | 4886 |
| 138 | Ga0068871_100191582 | 3300006358 | Bacteria | 1761 |
| 139 | Ga0068871_100236059 | 3300006358 | Bacteria | 1588 |
| 140 | Ga0075433_10616817 | 3300006852 | Bacteria | 952 |
| 141 | Ga0075434_100130115 | 3300006871 | Bacteria | 2535 |
| 142 | Ga0075429_100008966 | 3300006880 | Bacteria | 8689 |
| 143 | Ga0068865_100040116 | 3300006881 | Bacteria | 3179 |
| 144 | Ga0097620_100111147 | 3300006931 | Bacteria | 2802 |
| 145 | Ga0097620_100205485 | 3300006931 | Bacteria | 2054 |
| 146 | Ga0097620_100367195 | 3300006931 | Bacteria | 1534 |
| 147 | Ga0099823_1000163 | 3300006944 | Bacteria | 35759 |
| 148 | Ga0079104_1000040 | 3300006946 | Bacteria | 187962 |
| 149 | Ga0079104_1000530 | 3300006946 | Bacteria | 40514 |
| 150 | Ga0105244_10000750 | 3300009036 | Bacteria | 27787 |
| 151 | Ga0105240_10023967 | 3300009093 | Bacteria | 8062 |
| 152 | Ga0105240_10030303 | 3300009093 | Bacteria | 7031 |
| 153 | Ga0105240_10221428 | 3300009093 | Bacteria | 2204 |
| 154 | Ga0105245_10008631 | 3300009098 | Bacteria | 8888 |
| 155 | Ga0105245_10061364 | 3300009098 | Bacteria | 3388 |
| 156 | Ga0114129_10023973 | 3300009147 | Bacteria | 8647 |
| 157 | Ga0114129_10267738 | 3300009147 | Bacteria | 2287 |
| 158 | Ga0105243_10008438 | 3300009148 | Bacteria | 7910 |
| 159 | Ga0105243_10008894 | 3300009148 | Bacteria | 7680 |
| 160 | Ga0105243_10018872 | 3300009148 | Bacteria | 5229 |
| 161 | Ga0105243_10040342 | 3300009148 | Bacteria | 3645 |
| 162 | Ga0105243_10083870 | 3300009148 | Bacteria | 2608 |
| 163 | Ga0105243_10107737 | 3300009148 | Bacteria | 2325 |
| 164 | Ga0105242_10002491 | 3300009176 | Bacteria | 14439 |
| 165 | Ga0105248_10031936 | 3300009177 | Bacteria | 5884 |
| 166 | Ga0105237_10024647 | 3300009545 | Bacteria | 6153 |
| 167 | Ga0105237_10073055 | 3300009545 | Bacteria | 3423 |
| 168 | Ga0105237_10452160 | 3300009545 | Bacteria | 1290 |
| 169 | Ga0105238_10001575 | 3300009551 | Bacteria | 22864 |
| 170 | Ga0105238_10209691 | 3300009551 | Bacteria | 1924 |
| 171 | Ga0105249_10042407 | 3300009553 | Bacteria | 4138 |
| 172 | Ga0105246_10092463 | 3300011119 | Bacteria | 2183 |
| 173 | Ga0105246_10262745 | 3300011119 | Bacteria | 1376 |
| 174 | Ga0157373_10000617 | 3300013100 | Bacteria | 27844 |
| 175 | Ga0157373_10020413 | 3300013100 | Bacteria | 4815 |
| 176 | Ga0157371_10000047 | 3300013102 | Bacteria | 185590 |
| 177 | Ga0157371_10094994 | 3300013102 | Bacteria | 2113 |
| 178 | Ga0157370_10000004 | 3300013104 | Bacteria | 366426 |
| 179 | Ga0157370_10026238 | 3300013104 | Bacteria | 5756 |
| 180 | Ga0157369_10004067 | 3300013105 | Bacteria | 17322 |
| 181 | Ga0157369_10014312 | 3300013105 | Bacteria | 8961 |
| 182 | Ga0157374_10007375 | 3300013296 | Bacteria | 9379 |
| 183 | Ga0157374_10047442 | 3300013296 | Bacteria | 3983 |
| 184 | Ga0157378_10020973 | 3300013297 | Bacteria | 5749 |
| 185 | Ga0163162_10024300 | 3300013306 | Bacteria | 5980 |
| 186 | Ga0163162_10080866 | 3300013306 | Bacteria | 3319 |
| 187 | Ga0157372_10001037 | 3300013307 | Bacteria | 30385 |
| 188 | Ga0157372_10010263 | 3300013307 | Bacteria | 9948 |
| 189 | Ga0157372_10059208 | 3300013307 | Bacteria | 4283 |
| 190 | Ga0157375_10024076 | 3300013308 | Bacteria | 5629 |
| 191 | Ga0157375_10027569 | 3300013308 | Bacteria | 5311 |
| 192 | Ga0157375_10376569 | 3300013308 | Bacteria | 1586 |
| 193 | Ga0157375_10543308 | 3300013308 | Bacteria | 1324 |
| 194 | Ga0163163_10008768 | 3300014325 | Bacteria | 9000 |
| 195 | Ga0163163_10527368 | 3300014325 | Bacteria | 1243 |
| 196 | Ga0157377_10000170 | 3300014745 | Bacteria | 38897 |
| 197 | Ga0157379_10006124 | 3300014968 | Bacteria | 10355 |
| 198 | Ga0157379_10031084 | 3300014968 | Bacteria | 4757 |
| 199 | Ga0157379_10039682 | 3300014968 | Bacteria | 4201 |
| 200 | Ga0157379_10086468 | 3300014968 | Bacteria | 2811 |
| 201 | Ga0157379_10096959 | 3300014968 | Bacteria | 2646 |
| 202 | Ga0157379_10137716 | 3300014968 | Bacteria | 2200 |
| 203 | Ga0182006_1008279 | 3300015261 | Bacteria | 4714 |
| 204 | Ga0163161_10169258 | 3300017792 | Bacteria | 1670 |
| 205 | Ga0206351_10859076 | 3300020077 | Bacteria | 2700 |
| 206 | Ga0154015_1245876 | 3300020610 | Bacteria | 30783 |
| 207 | Ga0213872_10009666 | 3300021361 | Bacteria | 4617 |
| 208 | Ga0213872_10056148 | 3300021361 | Bacteria | 1784 |
| 209 | Ga0209784_100029 | 3300025224 | Bacteria | 347315 |
| 210 | Ga0209784_100318 | 3300025224 | Bacteria | 24939 |
| 211 | Ga0209784_102235 | 3300025224 | Bacteria | 2047 |
| 212 | Ga0209566_100030 | 3300025225 | Bacteria | 347329 |
| 213 | Ga0209674_100075 | 3300025226 | Bacteria | 216004 |
| 214 | Ga0209674_102415 | 3300025226 | Bacteria | 4031 |
| 215 | Ga0209672_100710 | 3300025228 | Bacteria | 16570 |
| 216 | Ga0209147_100008 | 3300025229 | Bacteria | 777096 |
| 217 | Ga0209563_100117 | 3300025230 | Bacteria | 132048 |
| 218 | Ga0209563_109069 | 3300025230 | Bacteria | 1528 |
| 219 | Ga0209258_100013 | 3300025242 | Bacteria | 777096 |
| 220 | Ga0209258_100567 | 3300025242 | Bacteria | 31694 |
| 221 | Ga0207425_1000881 | 3300025245 | Bacteria | 14608 |
| 222 | Ga0209677_100030 | 3300025253 | Bacteria | 347314 |
| 223 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 224 | Ga0209455_1000130 | 3300025272 | Bacteria | 161669 |
| 225 | Ga0209673_1005247 | 3300025273 | Bacteria | 6592 |
| 226 | Ga0209673_1038095 | 3300025273 | Bacteria | 1404 |
| 227 | Ga0209025_1000073 | 3300025294 | Bacteria | 282133 |
| 228 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 229 | Ga0209564_1000051 | 3300025295 | Bacteria | 357748 |
| 230 | Ga0209758_1000193 | 3300025297 | Bacteria | 134744 |
| 231 | Ga0209758_1000208 | 3300025297 | Bacteria | 128596 |
| 232 | Ga0209050_1001233 | 3300025298 | Bacteria | 29602 |
| 233 | Ga0209050_1001300 | 3300025298 | Bacteria | 28170 |
| 234 | Ga0209050_1008874 | 3300025298 | Bacteria | 5265 |
| 235 | Ga0209256_1036914 | 3300025299 | Bacteria | 1278 |
| 236 | Ga0209051_1000981 | 3300025303 | Bacteria | 27697 |
| 237 | Ga0209051_1054597 | 3300025303 | Bacteria | 1302 |
| 238 | Ga0209257_1000182 | 3300025304 | Bacteria | 156672 |
| 239 | Ga0209257_1002753 | 3300025304 | Bacteria | 16625 |
| 240 | Ga0209257_1028057 | 3300025304 | Bacteria | 1860 |
| 241 | Ga0207697_10046050 | 3300025315 | Bacteria | 1796 |
| 242 | Ga0207697_10105617 | 3300025315 | Bacteria | 1203 |
| 243 | Ga0207656_10071784 | 3300025321 | Bacteria | 1540 |
| 244 | Ga0207656_10078424 | 3300025321 | Bacteria | 1480 |
| 245 | Ga0207682_10002310 | 3300025893 | Bacteria | 8592 |
| 246 | Ga0207682_10008487 | 3300025893 | Bacteria | 4061 |
| 247 | Ga0207642_10002846 | 3300025899 | Bacteria | 5403 |
| 248 | Ga0207642_10006194 | 3300025899 | Bacteria | 3963 |
| 249 | Ga0207642_10008862 | 3300025899 | Bacteria | 3476 |
| 250 | Ga0207642_10058739 | 3300025899 | Bacteria | 1776 |
| 251 | Ga0207688_10009912 | 3300025901 | Bacteria | 5186 |
| 252 | Ga0207680_10002216 | 3300025903 | Bacteria | 9082 |
| 253 | Ga0207645_10143291 | 3300025907 | Bacteria | 1557 |
| 254 | Ga0207645_10392566 | 3300025907 | Bacteria | 932 |
| 255 | Ga0207645_10397960 | 3300025907 | Bacteria | 926 |
| 256 | Ga0207705_10033984 | 3300025909 | Bacteria | 3645 |
| 257 | Ga0207684_10071919 | 3300025910 | Bacteria | 2938 |
| 258 | Ga0207654_10146490 | 3300025911 | Bacteria | 1511 |
| 259 | Ga0207707_10034849 | 3300025912 | Bacteria | 4403 |
| 260 | Ga0207695_10002229 | 3300025913 | Bacteria | 29087 |
| 261 | Ga0207695_10088943 | 3300025913 | Bacteria | 3107 |
| 262 | Ga0207695_10258881 | 3300025913 | Bacteria | 1638 |
| 263 | Ga0207671_10035144 | 3300025914 | Bacteria | 3721 |
| 264 | Ga0207660_10141322 | 3300025917 | Bacteria | 1841 |
| 265 | Ga0207662_10165251 | 3300025918 | Bacteria | 1416 |
| 266 | Ga0207657_10002308 | 3300025919 | Bacteria | 20679 |
| 267 | Ga0207657_10135699 | 3300025919 | Bacteria | 2014 |
| 268 | Ga0207649_10000030 | 3300025920 | Bacteria | 154458 |
| 269 | Ga0207649_10061744 | 3300025920 | Bacteria | 2360 |
| 270 | Ga0207652_10081244 | 3300025921 | Bacteria | 2835 |
| 271 | Ga0207652_10214880 | 3300025921 | Bacteria | 1732 |
| 272 | Ga0207681_10000795 | 3300025923 | Bacteria | 20798 |
| 273 | Ga0207681_10017788 | 3300025923 | Bacteria | 4469 |
| 274 | Ga0207681_10033597 | 3300025923 | Bacteria | 3365 |
| 275 | Ga0207681_10084985 | 3300025923 | Bacteria | 2244 |
| 276 | Ga0207681_10193930 | 3300025923 | Bacteria | 1556 |
| 277 | Ga0207694_10004060 | 3300025924 | Bacteria | 11503 |
| 278 | Ga0207650_10002550 | 3300025925 | Bacteria | 12629 |
| 279 | Ga0207650_10004501 | 3300025925 | Bacteria | 9532 |
| 280 | Ga0207650_10014903 | 3300025925 | Bacteria | 5408 |
| 281 | Ga0207650_10209144 | 3300025925 | Bacteria | 1566 |
| 282 | Ga0207650_10544990 | 3300025925 | Bacteria | 972 |
| 283 | Ga0207659_10013398 | 3300025926 | Bacteria | 5249 |
| 284 | Ga0207659_10020083 | 3300025926 | Bacteria | 4408 |
| 285 | Ga0207659_10032887 | 3300025926 | Bacteria | 3563 |
| 286 | Ga0207659_10037282 | 3300025926 | Bacteria | 3374 |
| 287 | Ga0207659_10201000 | 3300025926 | Bacteria | 1592 |
| 288 | Ga0207687_10359395 | 3300025927 | Bacteria | 1188 |
| 289 | Ga0207664_10025828 | 3300025929 | Bacteria | 4431 |
| 290 | Ga0207644_10002048 | 3300025931 | Bacteria | 13051 |
| 291 | Ga0207644_10002949 | 3300025931 | Bacteria | 10959 |
| 292 | Ga0207644_10067753 | 3300025931 | Bacteria | 2602 |
| 293 | Ga0207690_10005174 | 3300025932 | Bacteria | 7694 |
| 294 | Ga0207690_10219101 | 3300025932 | Bacteria | 1455 |
| 295 | Ga0207686_10015629 | 3300025934 | Bacteria | 4246 |
| 296 | Ga0207686_10047390 | 3300025934 | Bacteria | 2657 |
| 297 | Ga0207686_10525821 | 3300025934 | Bacteria | 921 |
| 298 | Ga0207709_10000622 | 3300025935 | Bacteria | 29028 |
| 299 | Ga0207709_10001296 | 3300025935 | Bacteria | 17820 |
| 300 | Ga0207709_10014336 | 3300025935 | Bacteria | 4375 |
| 301 | Ga0207709_10027125 | 3300025935 | Bacteria | 3296 |
| 302 | Ga0207709_10030033 | 3300025935 | Bacteria | 3158 |
| 303 | Ga0207709_10523836 | 3300025935 | Bacteria | 928 |
| 304 | Ga0207669_10031874 | 3300025937 | Bacteria | 2951 |
| 305 | Ga0207669_10041654 | 3300025937 | Bacteria | 2675 |
| 306 | Ga0207669_10521049 | 3300025937 | Bacteria | 954 |
| 307 | Ga0207704_10084777 | 3300025938 | Bacteria | 2060 |
| 308 | Ga0207704_10276966 | 3300025938 | Bacteria | 1273 |
| 309 | Ga0207665_10028082 | 3300025939 | Bacteria | 3716 |
| 310 | Ga0207691_10005390 | 3300025940 | Bacteria | 12350 |
| 311 | Ga0207691_10007761 | 3300025940 | Bacteria | 10333 |
| 312 | Ga0207691_10012093 | 3300025940 | Bacteria | 8276 |
| 313 | Ga0207691_10012813 | 3300025940 | Bacteria | 8026 |
| 314 | Ga0207691_10026402 | 3300025940 | Bacteria | 5449 |
| 315 | Ga0207711_10012457 | 3300025941 | Bacteria | 7068 |
| 316 | Ga0207711_10067509 | 3300025941 | Bacteria | 3096 |
| 317 | Ga0207711_10126201 | 3300025941 | Bacteria | 2289 |
| 318 | Ga0207689_10003512 | 3300025942 | Bacteria | 14319 |
| 319 | Ga0207689_10004908 | 3300025942 | Bacteria | 12049 |
| 320 | Ga0207689_10016046 | 3300025942 | Bacteria | 6341 |
| 321 | Ga0207689_10075589 | 3300025942 | Bacteria | 2769 |
| 322 | Ga0207661_10140288 | 3300025944 | Bacteria | 2079 |
| 323 | Ga0207661_10191726 | 3300025944 | Bacteria | 1792 |
| 324 | Ga0207679_10000004 | 3300025945 | Bacteria | 589021 |
| 325 | Ga0207679_10014481 | 3300025945 | Bacteria | 5189 |
| 326 | Ga0207679_10053631 | 3300025945 | Bacteria | 2964 |
| 327 | Ga0207667_10002655 | 3300025949 | Bacteria | 22096 |
| 328 | Ga0207667_10009860 | 3300025949 | Bacteria | 11213 |
| 329 | Ga0207667_10011386 | 3300025949 | Bacteria | 10342 |
| 330 | Ga0207667_10437689 | 3300025949 | Bacteria | 1329 |
| 331 | Ga0207651_10025563 | 3300025960 | Bacteria | 3672 |
| 332 | Ga0207651_10060152 | 3300025960 | Bacteria | 2635 |
| 333 | Ga0207651_10137004 | 3300025960 | Bacteria | 1884 |
| 334 | Ga0207651_10510441 | 3300025960 | Bacteria | 1040 |
| 335 | Ga0207712_10041139 | 3300025961 | Bacteria | 3175 |
| 336 | Ga0207668_10017712 | 3300025972 | Bacteria | 4469 |
| 337 | Ga0207668_10126010 | 3300025972 | Bacteria | 1947 |
| 338 | Ga0207640_10000731 | 3300025981 | Bacteria | 18898 |
| 339 | Ga0207640_10025789 | 3300025981 | Bacteria | 3562 |
| 340 | Ga0207640_10140289 | 3300025981 | Bacteria | 1761 |
| 341 | Ga0207640_10229824 | 3300025981 | Bacteria | 1426 |
| 342 | Ga0207640_10535755 | 3300025981 | Bacteria | 981 |
| 343 | Ga0207658_10001151 | 3300025986 | Bacteria | 21193 |
| 344 | Ga0207658_10005593 | 3300025986 | Bacteria | 8597 |
| 345 | Ga0207658_10259456 | 3300025986 | Bacteria | 1480 |
| 346 | Ga0207677_10000452 | 3300026023 | Bacteria | 27626 |
| 347 | Ga0207677_10074683 | 3300026023 | Bacteria | 2407 |
| 348 | Ga0207703_10001999 | 3300026035 | Bacteria | 17992 |
| 349 | Ga0207703_10003262 | 3300026035 | Bacteria | 13624 |
| 350 | Ga0207703_10121427 | 3300026035 | Bacteria | 2243 |
| 351 | Ga0207678_10000006 | 3300026067 | Bacteria | 188733 |
| 352 | Ga0207678_10073289 | 3300026067 | Bacteria | 2935 |
| 353 | Ga0207678_10224502 | 3300026067 | Bacteria | 1608 |
| 354 | Ga0207678_10442869 | 3300026067 | Bacteria | 1129 |
| 355 | Ga0207702_10000472 | 3300026078 | Bacteria | 45492 |
| 356 | Ga0207702_10044080 | 3300026078 | Bacteria | 3748 |
| 357 | Ga0207702_10731382 | 3300026078 | Bacteria | 976 |
| 358 | Ga0207641_10026325 | 3300026088 | Bacteria | 4799 |
| 359 | Ga0207641_10038644 | 3300026088 | Bacteria | 3990 |
| 360 | Ga0207648_10000439 | 3300026089 | Bacteria | 46028 |
| 361 | Ga0207648_10000748 | 3300026089 | Bacteria | 36506 |
| 362 | Ga0207648_10015290 | 3300026089 | Bacteria | 7061 |
| 363 | Ga0207648_10159491 | 3300026089 | Bacteria | 1992 |
| 364 | Ga0207676_10012508 | 3300026095 | Bacteria | 6084 |
| 365 | Ga0207676_10042218 | 3300026095 | Bacteria | 3506 |
| 366 | Ga0207676_10052796 | 3300026095 | Bacteria | 3179 |
| 367 | Ga0207676_10716159 | 3300026095 | Bacteria | 971 |
| 368 | Ga0207674_10000040 | 3300026116 | Bacteria | 130571 |
| 369 | Ga0207674_10009428 | 3300026116 | Bacteria | 11151 |
| 370 | Ga0207674_10020895 | 3300026116 | Bacteria | 7065 |
| 371 | Ga0207674_10078389 | 3300026116 | Bacteria | 3309 |
| 372 | Ga0207675_100005550 | 3300026118 | Bacteria | 12070 |
| 373 | Ga0207675_100013133 | 3300026118 | Bacteria | 7730 |
| 374 | Ga0207675_100059119 | 3300026118 | Bacteria | 3577 |
| 375 | Ga0207683_10008569 | 3300026121 | Bacteria | 8752 |
| 376 | Ga0207683_10058774 | 3300026121 | Bacteria | 3377 |
| 377 | Ga0207683_10278749 | 3300026121 | Bacteria | 1528 |
| 378 | Ga0207698_10011131 | 3300026142 | Bacteria | 5817 |
| 379 | Ga0207698_10092330 | 3300026142 | Bacteria | 2481 |
| 380 | Ga0207698_10100721 | 3300026142 | Bacteria | 2394 |
| 381 | Ga0207698_10469712 | 3300026142 | Bacteria | 1218 |
| 382 | Ga0209281_1000074 | 3300027111 | Bacteria | 267848 |
| 383 | Ga0209281_1000599 | 3300027111 | Bacteria | 41033 |
| 384 | Ga0209973_1005973 | 3300027252 | Bacteria | 1313 |
| 385 | Ga0209389_1015570 | 3300027296 | Bacteria | 6905 |
| 386 | Ga0209371_1022371 | 3300027312 | Bacteria | 1512 |
| 387 | Ga0209974_10000798 | 3300027876 | Bacteria | 10761 |
| 388 | Ga0209974_10006661 | 3300027876 | Bacteria | 4017 |
| 389 | Ga0268266_10054826 | 3300028379 | Bacteria | 3426 |
| 390 | Ga0268265_10013319 | 3300028380 | Bacteria | 5587 |
| 391 | Ga0268265_10098075 | 3300028380 | Bacteria | 2359 |
| 392 | Ga0268265_10121264 | 3300028380 | Bacteria | 2154 |
| 393 | Ga0268265_10122583 | 3300028380 | Bacteria | 2144 |
| 394 | Ga0268264_10003378 | 3300028381 | Bacteria | 13783 |
| 395 | Ga0268264_10003920 | 3300028381 | Bacteria | 12743 |
| 396 | Ga0268264_10013375 | 3300028381 | Bacteria | 6753 |
| 397 | Ga0268264_10141634 | 3300028381 | Bacteria | 2145 |
| 398 | Ga0268264_10284576 | 3300028381 | Bacteria | 1550 |
| 399 | Ga0265336_10000022 | 3300028666 | Bacteria | 192716 |
| 400 | Ga0307517_10005592 | 3300028786 | Bacteria | 18878 |
| 401 | Ga0307517_10026165 | 3300028786 | Bacteria | 7086 |
| 402 | Ga0307515_10000165 | 3300028794 | Bacteria | 162589 |
| 403 | Ga0307515_10000188 | 3300028794 | Bacteria | 151439 |
| 404 | Ga0307515_10000232 | 3300028794 | Bacteria | 137778 |
| 405 | Ga0307515_10001456 | 3300028794 | Bacteria | 53165 |
| 406 | Ga0307515_10003451 | 3300028794 | Bacteria | 33263 |
| 407 | Ga0307515_10009711 | 3300028794 | Bacteria | 18549 |
| 408 | Ga0307515_10049534 | 3300028794 | Bacteria | 6315 |
| 409 | Ga0307515_10100821 | 3300028794 | Bacteria | 3492 |
| 410 | Ga0307515_10229842 | 3300028794 | Bacteria | 1650 |
| 411 | Ga0265324_10000645 | 3300029957 | Bacteria | 23682 |
| 412 | Ga0265324_10050632 | 3300029957 | Bacteria | 1427 |
| 413 | Ga0307512_10047346 | 3300030522 | Bacteria | 3495 |
| 414 | Ga0307512_10201451 | 3300030522 | Bacteria | 1076 |
| 415 | Ga0265332_10000187 | 3300031238 | Bacteria | 50563 |
| 416 | Ga0265328_10004603 | 3300031239 | Bacteria | 5974 |
| 417 | Ga0265331_10002534 | 3300031250 | Bacteria | 12300 |
| 418 | Ga0265327_10000028 | 3300031251 | Bacteria | 361066 |
| 419 | Ga0265327_10001301 | 3300031251 | Bacteria | 32649 |
| 420 | Ga0307513_10020857 | 3300031456 | Bacteria | 7755 |
| 421 | Ga0307513_10043401 | 3300031456 | Bacteria | 4938 |
| 422 | Ga0307513_10065125 | 3300031456 | Bacteria | 3835 |
| 423 | Ga0307513_10155349 | 3300031456 | Bacteria | 2189 |
| 424 | Ga0307509_10003083 | 3300031507 | Bacteria | 25889 |
| 425 | Ga0307509_10070806 | 3300031507 | Bacteria | 3640 |
| 426 | Ga0307509_10224368 | 3300031507 | Bacteria | 1688 |
| 427 | Ga0307408_100000096 | 3300031548 | Bacteria | 97068 |
| 428 | Ga0307408_100000160 | 3300031548 | Bacteria | 74342 |
| 429 | Ga0307408_100008311 | 3300031548 | Bacteria | 6853 |
| 430 | Ga0307408_100081746 | 3300031548 | Bacteria | 2416 |
| 431 | Ga0307508_10001467 | 3300031616 | Bacteria | 26444 |
| 432 | Ga0307508_10327809 | 3300031616 | Bacteria | 1123 |
| 433 | Ga0307514_10000711 | 3300031649 | Bacteria | 57628 |
| 434 | Ga0307514_10119814 | 3300031649 | Bacteria | 1839 |
| 435 | Ga0307514_10201358 | 3300031649 | Bacteria | 1251 |
| 436 | Ga0307516_10004400 | 3300031730 | Bacteria | 17413 |
| 437 | Ga0307516_10005959 | 3300031730 | Bacteria | 14408 |
| 438 | Ga0307516_10074947 | 3300031730 | Bacteria | 3238 |
| 439 | Ga0307516_10128425 | 3300031730 | Bacteria | 2317 |
| 440 | Ga0307516_10155668 | 3300031730 | Bacteria | 2041 |
| 441 | Ga0307405_10021832 | 3300031731 | Bacteria | 3606 |
| 442 | Ga0307405_10053071 | 3300031731 | Bacteria | 2523 |
| 443 | Ga0307405_10190515 | 3300031731 | Bacteria | 1481 |
| 444 | Ga0307410_10006186 | 3300031852 | Bacteria | 6431 |
| 445 | Ga0307406_10000669 | 3300031901 | Bacteria | 19388 |
| 446 | Ga0307406_10037621 | 3300031901 | Bacteria | 2990 |
| 447 | Ga0307407_10197530 | 3300031903 | Bacteria | 1345 |
| 448 | Ga0307412_10106523 | 3300031911 | Bacteria | 1993 |
| 449 | Ga0307412_10152178 | 3300031911 | Bacteria | 1708 |
| 450 | Ga0307412_10691512 | 3300031911 | Bacteria | 874 |
| 451 | Ga0307409_100001314 | 3300031995 | Bacteria | 12044 |
| 452 | Ga0307409_100049671 | 3300031995 | Bacteria | 3200 |
| 453 | Ga0307409_100065516 | 3300031995 | Bacteria | 2859 |
| 454 | Ga0307416_100020404 | 3300032002 | Bacteria | 4727 |
| 455 | Ga0307416_100071278 | 3300032002 | Bacteria | 2886 |
| 456 | Ga0307416_100087114 | 3300032002 | Bacteria | 2665 |
| 457 | Ga0307414_10057023 | 3300032004 | Bacteria | 2743 |
| 458 | Ga0307414_10149621 | 3300032004 | Bacteria | 1840 |
| 459 | Ga0307411_10006938 | 3300032005 | Bacteria | 5714 |
| 460 | Ga0307415_100124110 | 3300032126 | Bacteria | 1942 |
| 461 | Ga0307510_10076751 | 3300033180 | Bacteria | 3283 |
| 462 | Ga0307510_10285068 | 3300033180 | Bacteria | 1120 |
| 463 | Ga0373948_0008268 | 3300034817 | Bacteria | 1769 |
| 464 | Ga0373950_0004635 | 3300034818 | Bacteria | 2022 |
| 465 | Ga0373926_0127566 | 3300035083 | Bacteria | 962 |
| 466 | Ga0373940_0002695 | 3300035088 | Bacteria | 3505 |
| 467 | Ga0373932_0018539 | 3300035112 | Bacteria | 1801 |
| 468 | Ga0373939_0000133 | 3300035114 | Bacteria | 21457 |
| 469 | Ga0373960_0001339 | 3300035121 | Bacteria | 5422 |
| 470 | Ga0373943_0040156 | 3300035170 | Bacteria | 2259 |
| 471 | Ga0373962_0026901 | 3300035242 | Bacteria | 1553 |
| 472 | Ga0373924_0050922 | 3300035410 | Bacteria | 1716 |
| 473 | Ga0373931_0000375 | 3300035691 | Bacteria | 18351 |
| 474 | Ga0373931_0174722 | 3300035691 | Bacteria | 1268 |
| 475 | Ga0373927_0076004 | 3300035695 | Bacteria | 2175 |
| 476 | Ga0373937_0168463 | 3300036401 | Bacteria | 2055 |
| 477 | Ga0395900_0002257 | 3300037418 | Bacteria | 21429 |
| 478 | Ga0395900_0024352 | 3300037418 | Bacteria | 6198 |
| 479 | Ga0395898_0002077 | 3300037466 | Bacteria | 24918 |
| 480 | Ga0395905_0000071 | 3300037471 | Bacteria | 174580 |
| 481 | Ga0395905_0003377 | 3300037471 | Bacteria | 17102 |
| 482 | Ga0395905_0205360 | 3300037471 | Bacteria | 1846 |
| 483 | Ga0395905_0379559 | 3300037471 | Bacteria | 1307 |
| 484 | Ga0395905_0389214 | 3300037471 | Bacteria | 1288 |
| 485 | Ga0395905_0683056 | 3300037471 | Bacteria | 929 |
| 486 | Ga0436361_0030837 | 3300039447 | Bacteria | 2410 |
| 487 | Ga0436361_0086324 | 3300039447 | Bacteria | 39001 |
| 488 | Ga0436361_0228735 | 3300039447 | Bacteria | 2038 |
| 489 | Ga0436361_0916039 | 3300039447 | Bacteria | 3570 |
| 490 | Ga0436363_1612144 | 3300039450 | Bacteria | 2536 |
| 491 | Ga0451789_1195116 | 3300041443 | Bacteria | 1937 |
| 492 | Ga0451791_1734106 | 3300041451 | Bacteria | 1124 |
| 493 | Ga0451793_0166077 | 3300041452 | Bacteria | 1452 |
| 494 | Ga0451798_0244844 | 3300041458 | Bacteria | 919 |
| 495 | Ga0451800_0192177 | 3300041459 | Bacteria | 1048 |
| 496 | Ga0451802_0517703 | 3300041460 | Bacteria | 2677 |
| 497 | Ga0451841_0612080 | 3300041498 | Bacteria | 1131 |
| 498 | Ga0439437_000403 | 3300042000 | Bacteria | 4173 |
| 499 | Ga0439448_0068765 | 3300042005 | Bacteria | 1178 |
| 500 | Ga0450911_000798 | 3300042115 | Bacteria | 8724 |
| 501 | Ga0450923_040228 | 3300042125 | Bacteria | 980 |
| 502 | Ga0450888_000730 | 3300042126 | Bacteria | 3140 |
| 503 | Ga0450891_000064 | 3300042129 | Bacteria | 8447 |
| 504 | Ga0450892_003526 | 3300042130 | Bacteria | 1283 |
| 505 | Ga0450898_015580 | 3300042134 | Bacteria | 1289 |
| 506 | Ga0439464_0021522 | 3300042439 | Bacteria | 1771 |
| 507 | Ga0450918_000344 | 3300042531 | Bacteria | 10277 |
| 508 | Ga0451577_0001807 | 3300042876 | Bacteria | 27374 |
| 509 | Ga0451577_0459358 | 3300042876 | Bacteria | 1156 |
| 510 | Ga0466969_0037790 | 3300044656 | Bacteria | 2433 |
| 511 | Ga0466972_0003244 | 3300044658 | Bacteria | 8066 |
| 512 | Ga0466972_0020558 | 3300044658 | Bacteria | 3298 |
| 513 | Ga0466965_0068051 | 3300044683 | Bacteria | 1787 |
| 514 | Ga0466966_0015315 | 3300044684 | Bacteria | 5070 |
| 515 | Ga0466961_0000221 | 3300044693 | Bacteria | 38736 |
| 516 | Ga0466961_0006410 | 3300044693 | Bacteria | 7472 |
| 517 | Ga0466963_0000935 | 3300044694 | Bacteria | 14918 |
| 518 | Ga0466964_0003021 | 3300044706 | Bacteria | 6099 |
| 519 | Ga0466964_0023625 | 3300044706 | Bacteria | 2390 |
| 520 | Ga0453684_0007748 | 3300044712 | Bacteria | 19588 |
| 521 | Ga0453684_0131943 | 3300044712 | Bacteria | 2996 |
| 522 | Ga0453684_0187709 | 3300044712 | Bacteria | 2421 |
| 523 | Ga0453684_0283535 | 3300044712 | Bacteria | 1888 |
| 524 | Ga0466971_0020029 | 3300044719 | Bacteria | 2973 |
| 525 | Ga0466968_0005264 | 3300044735 | Bacteria | 4847 |
| 526 | Ga0466968_0057029 | 3300044735 | Bacteria | 1678 |
| 527 | Ga0466960_0012592 | 3300044901 | Bacteria | 3575 |
| 528 | Ga0466959_0013106 | 3300045049 | Bacteria | 6003 |
| 529 | Ga0466959_0015936 | 3300045049 | Bacteria | 5483 |
| 530 | Ga0451576_0016908 | 3300045051 | Bacteria | 8033 |
| 531 | Ga0451576_0126973 | 3300045051 | Bacteria | 2657 |
| 532 | Ga0451576_0407935 | 3300045051 | Bacteria | 1425 |
| 533 | Ga0451576_0422698 | 3300045051 | Bacteria | 1398 |
| 534 | Ga0451576_0548244 | 3300045051 | Bacteria | 1215 |
| 535 | Ga0466958_0369987 | 3300045836 | Bacteria | 923 |
| 536 | Ga0466967_0021184 | 3300045976 | Bacteria | 5272 |
| 537 | Ga0495627_075952 | 3300046453 | Bacteria | 977 |
| 538 | Ga0495592_0000213 | 3300046454 | Bacteria | 49631 |
| 539 | Ga0495629_0040968 | 3300046459 | Bacteria | 3259 |
| 540 | Ga0495651_0129527 | 3300046462 | Bacteria | 1844 |
| 541 | Ga0495650_0002988 | 3300046471 | Bacteria | 12804 |
| 542 | Ga0495664_0294883 | 3300046477 | Bacteria | 979 |
| 543 | Ga0495606_0105851 | 3300046507 | Bacteria | 1704 |
| 544 | Ga0495610_0001183 | 3300046512 | Bacteria | 23602 |
| 545 | Ga0495610_0045594 | 3300046512 | Bacteria | 2168 |
| 546 | Ga0495618_0101195 | 3300046514 | Bacteria | 1845 |
| 547 | Ga0495632_0007918 | 3300046519 | Bacteria | 6606 |
| 548 | Ga0495632_0067015 | 3300046519 | Bacteria | 1731 |
| 549 | Ga0495643_0074440 | 3300046522 | Bacteria | 1778 |
| 550 | Ga0495654_0002282 | 3300046530 | Bacteria | 12409 |
| 551 | Ga0495598_0018863 | 3300046537 | Bacteria | 1799 |
| 552 | Ga0495597_0000077 | 3300046542 | Bacteria | 85280 |
| 553 | Ga0495597_0002061 | 3300046542 | Bacteria | 13405 |
| 554 | Ga0495633_0002396 | 3300046558 | Bacteria | 13280 |
| 555 | Ga0495625_0000916 | 3300046660 | Bacteria | 39677 |
| 556 | Ga0495625_0040736 | 3300046660 | Bacteria | 3384 |
| 557 | Ga0495625_0060694 | 3300046660 | Bacteria | 2678 |
| 558 | Ga0495635_0146612 | 3300046663 | Bacteria | 1607 |
| 559 | Ga0495646_0176976 | 3300046680 | Bacteria | 1173 |
| 560 | Ga0495658_0014926 | 3300046683 | Bacteria | 3979 |
| 561 | Ga0495658_0093624 | 3300046683 | Bacteria | 1783 |
| 562 | Ga0495670_0027835 | 3300046691 | Bacteria | 2802 |
| 563 | Ga0495674_0161840 | 3300047319 | Bacteria | 1872 |
| 564 | Ga0495680_0048736 | 3300047322 | Bacteria | 3325 |
| 565 | Ga0495686_0003802 | 3300047472 | Bacteria | 12817 |
| 566 | Ga0495602_0254728 | 3300048088 | Bacteria | 1306 |
| 567 | Ga0496101_0008869 | 3300048904 | Bacteria | 6584 |
| 568 | Ga0496102_0025441 | 3300048905 | Bacteria | 5269 |
| 569 | Ga0496105_0346090 | 3300048908 | Bacteria | 1188 |
| 570 | Ga0496106_0004162 | 3300048909 | Bacteria | 10783 |
| 571 | Ga0496107_0012377 | 3300048910 | Bacteria | 5954 |
| 572 | Ga0496108_0017286 | 3300048911 | Bacteria | 5899 |
| 573 | Ga0496108_0054001 | 3300048911 | Bacteria | 3371 |
| 574 | Ga0496108_0059614 | 3300048911 | Bacteria | 3209 |
| 575 | Ga0496109_0040199 | 3300048912 | Bacteria | 4235 |
| 576 | Ga0496109_0086102 | 3300048912 | Bacteria | 2902 |
| 577 | Ga0496109_0207722 | 3300048912 | Bacteria | 1841 |
| 578 | Ga0496109_0517933 | 3300048912 | Bacteria | 1126 |
| 579 | Ga0496110_0099219 | 3300048913 | Bacteria | 2611 |
| 580 | Ga0496111_0303578 | 3300048914 | Bacteria | 1183 |
| 581 | Ga0496111_0586097 | 3300048914 | Bacteria | 817 |
| 582 | Ga0496112_0063967 | 3300048915 | Bacteria | 3629 |
| 583 | Ga0496114_0642772 | 3300048917 | Bacteria | 934 |
| 584 | Ga0496115_0002077 | 3300048918 | Bacteria | 14341 |
| 585 | Ga0496122_0011024 | 3300048925 | Bacteria | 9233 |
| 586 | Ga0496123_0020213 | 3300048926 | Bacteria | 5215 |
| 587 | Ga0496123_0112315 | 3300048926 | Bacteria | 1554 |
| 588 | Ga0496125_0000542 | 3300048928 | Bacteria | 64978 |
| 589 | Ga0496126_0007499 | 3300048929 | Bacteria | 11950 |
| 590 | Ga0496126_0129068 | 3300048929 | Bacteria | 2186 |
| 591 | Ga0501306_011393 | 3300049127 | Bacteria | 1133 |
| 592 | Ga0501309_000004 | 3300049129 | Bacteria | 11581 |
| 593 | Ga0501305_001609 | 3300049161 | Bacteria | 2255 |
| 594 | Ga0501312_011215 | 3300049528 | Bacteria | 1214 |
| 595 | Ga0501198_000047 | 3300049649 | Bacteria | 40126 |
| 596 | Ga0501201_004855 | 3300049651 | Bacteria | 1251 |
| 597 | Ga0501211_000442 | 3300049658 | Bacteria | 4005 |
| 598 | Ga0501222_000056 | 3300049662 | Bacteria | 40303 |
| 599 | Ga0501222_010931 | 3300049662 | Bacteria | 1197 |
| 600 | Ga0501221_000933 | 3300049704 | Bacteria | 4793 |
| 601 | Ga0501225_0032891 | 3300049705 | Bacteria | 1426 |
| 602 | Ga0501229_000077 | 3300049706 | Bacteria | 9792 |
| 603 | Ga0501232_004559 | 3300049757 | Bacteria | 1331 |
| 604 | Ga0501262_009951 | 3300049759 | Bacteria | 1183 |
| 605 | Ga0501265_002252 | 3300049762 | Bacteria | 2185 |
| 606 | Ga0501265_007761 | 3300049762 | Bacteria | 1268 |
| 607 | Ga0501268_021296 | 3300049765 | Bacteria | 1112 |
| 608 | Ga0501276_008540 | 3300049773 | Bacteria | 835 |
| 609 | nmdc:mga0k408_10460_c1 | 3300050493 | Bacteria | 5017 |
| 610 | nmdc:mga0k408_18200_c2 | 3300050493 | Bacteria | 3187 |
| 611 | nmdc:mga0k408_268410_c1 | 3300050493 | Bacteria | 1019 |
| 612 | nmdc:mga0k408_506_c1 | 3300050493 | Bacteria | 21412 |
| 613 | nmdc:mga07m45_18856_c1 | 3300050496 | Bacteria | 3732 |
| 614 | nmdc:mga07m45_21210_c1 | 3300050496 | Bacteria | 3535 |
| 615 | nmdc:mga07m45_93480_c1 | 3300050496 | Bacteria | 1724 |
| 616 | nmdc:mga05p37_182246_c1 | 3300050507 | Bacteria | 2554 |
| 617 | Ga0495612_0091577 | 3300053078 | Bacteria | 1288 |
| 618 | Ga0500578_0000006 | 3300053086 | Bacteria | 234598 |
| 619 | Ga0500644_0002443 | 3300053088 | Bacteria | 4643 |
| 620 | Ga0500647_0144256 | 3300053091 | Bacteria | 1115 |
| 621 | Ga0500569_056658 | 3300053109 | Bacteria | 1199 |
| 622 | Ga0500623_007865 | 3300053127 | Bacteria | 5280 |
| 623 | Ga0500642_0005616 | 3300053130 | Bacteria | 4063 |
| 624 | Ga0500652_001283 | 3300053131 | Bacteria | 7966 |
| 625 | Ga0500655_020988 | 3300053133 | Bacteria | 1222 |
| 626 | Ga0500658_0183594 | 3300053134 | Bacteria | 953 |
| 627 | Ga0500559_0118872 | 3300053136 | Bacteria | 1228 |
| 628 | Ga0500568_0006807 | 3300053139 | Bacteria | 5696 |
| 629 | Ga0500586_021156 | 3300053145 | Bacteria | 2047 |
| 630 | Ga0500604_0019070 | 3300053151 | Bacteria | 1917 |
| 631 | Ga0500619_000073 | 3300053154 | Bacteria | 28363 |
| 632 | Ga0500622_0001738 | 3300053156 | Bacteria | 16832 |
| 633 | Ga0500622_0003844 | 3300053156 | Bacteria | 9770 |
| 634 | Ga0500622_0013320 | 3300053156 | Bacteria | 4436 |
| 635 | Ga0500634_0005385 | 3300053161 | Bacteria | 6066 |
| 636 | Ga0500570_126587 | 3300053724 | Bacteria | 984 |
| 637 | Ga0500645_007607 | 3300053730 | Bacteria | 3758 |
| 638 | Ga0587067_001860 | 3300059640 | Bacteria | 2384 |
| 639 | Ga0466962_0127631 | 3300061719 | Bacteria | 1228 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300027312 | Ga0209371_1022371 | Ga0209371_10223713 | 225 |
| 2 | 3300005530 | Ga0070679_100043614 | Ga0070679_1000436146 | 226 |
| 3 | 3300014968 | Ga0157379_10031084 | Ga0157379_100310847 | 226 |
| 4 | 3300025921 | Ga0207652_10214880 | Ga0207652_102148802 | 226 |
| 5 | 3300039450 | Ga0436363_1612144 | Ga0436363_1612144_1412_2263 | 226 |
| 6 | 3300025295 | Ga0209564_1000051 | Ga0209564_1000051121 | 229 |
| 7 | 3300046691 | Ga0495670_0027835 | Ga0495670_0027835_809_1621 | 229 |
| 8 | 3300053156 | Ga0500622_0003844 | Ga0500622_0003844_3752_4564 | 229 |
| 9 | 3300026088 | Ga0207641_10026325 | Ga0207641_100263255 | 230 |
| 10 | 3300046507 | Ga0495606_0105851 | Ga0495606_0105851_805_1581 | 230 |
| 11 | 3300046512 | Ga0495610_0001183 | Ga0495610_0001183_14206_14982 | 230 |
| 12 | 3300046512 | Ga0495610_0045594 | Ga0495610_0045594_559_1335 | 230 |
| 13 | 3300046542 | Ga0495597_0002061 | Ga0495597_0002061_12019_12795 | 230 |
| 14 | 3300046558 | Ga0495633_0002396 | Ga0495633_0002396_20_796 | 230 |
| 15 | 3300046660 | Ga0495625_0000916 | Ga0495625_0000916_35199_35975 | 230 |
| 16 | 3300053145 | Ga0500586_021156 | Ga0500586_021156_912_1688 | 230 |
| 17 | 3300004625 | Ga0055543_1001524 | Ga0055543_10015245 | 232 |
| 18 | 3300005262 | Ga0065165_1000390 | Ga0065165_100039059 | 232 |
| 19 | 3300005614 | Ga0068856_100586060 | Ga0068856_1005860602 | 234 |
| 20 | 3300031239 | Ga0265328_10004603 | Ga0265328_100046036 | 234 |
| 21 | 3300031250 | Ga0265331_10002534 | Ga0265331_1000253413 | 234 |
| 22 | 3300031251 | Ga0265327_10000028 | Ga0265327_10000028171 | 234 |
| 23 | 3300048929 | Ga0496126_0129068 | Ga0496126_0129068_611_1369 | 234 |
| 24 | 3300014325 | Ga0163163_10008768 | Ga0163163_100087684 | 235 |
| 25 | 3300031731 | Ga0307405_10021832 | Ga0307405_100218325 | 235 |
| 26 | 3300031995 | Ga0307409_100001314 | Ga0307409_10000131411 | 235 |
| 27 | 3300032002 | Ga0307416_100020404 | Ga0307416_1000204045 | 235 |
| 28 | 3300005262 | Ga0065165_1003619 | Ga0065165_10036199 | 236 |
| 29 | 3300005334 | Ga0068869_100067518 | Ga0068869_1000675182 | 236 |
| 30 | 3300005335 | Ga0070666_10071419 | Ga0070666_100714194 | 236 |
| 31 | 3300005338 | Ga0068868_100003711 | Ga0068868_10000371110 | 236 |
| 32 | 3300005340 | Ga0070689_100021223 | Ga0070689_1000212233 | 236 |
| 33 | 3300005354 | Ga0070675_100003213 | Ga0070675_1000032135 | 236 |
| 34 | 3300005355 | Ga0070671_100006682 | Ga0070671_10000668210 | 236 |
| 35 | 3300005364 | Ga0070673_100073056 | Ga0070673_1000730563 | 236 |
| 36 | 3300005456 | Ga0070678_100093252 | Ga0070678_1000932522 | 236 |
| 37 | 3300005618 | Ga0068864_100008283 | Ga0068864_10000828310 | 236 |
| 38 | 3300005718 | Ga0068866_10092812 | Ga0068866_100928122 | 236 |
| 39 | 3300005834 | Ga0068851_10049026 | Ga0068851_100490263 | 236 |
| 40 | 3300005842 | Ga0068858_100001818 | Ga0068858_10000181815 | 236 |
| 41 | 3300005843 | Ga0068860_100057253 | Ga0068860_1000572533 | 236 |
| 42 | 3300006358 | Ga0068871_100236059 | Ga0068871_1002360592 | 236 |
| 43 | 3300009147 | Ga0114129_10023973 | Ga0114129_100239734 | 236 |
| 44 | 3300013296 | Ga0157374_10047442 | Ga0157374_100474424 | 236 |
| 45 | 3300013308 | Ga0157375_10024076 | Ga0157375_100240767 | 236 |
| 46 | 3300025273 | Ga0209673_1038095 | Ga0209673_10380952 | 236 |
| 47 | 3300025321 | Ga0207656_10071784 | Ga0207656_100717842 | 236 |
| 48 | 3300025899 | Ga0207642_10006194 | Ga0207642_100061945 | 236 |
| 49 | 3300025903 | Ga0207680_10002216 | Ga0207680_100022165 | 236 |
| 50 | 3300025926 | Ga0207659_10201000 | Ga0207659_102010002 | 236 |
| 51 | 3300025931 | Ga0207644_10002949 | Ga0207644_100029492 | 236 |
| 52 | 3300025941 | Ga0207711_10012457 | Ga0207711_100124578 | 236 |
| 53 | 3300025942 | Ga0207689_10075589 | Ga0207689_100755892 | 236 |
| 54 | 3300025960 | Ga0207651_10060152 | Ga0207651_100601522 | 236 |
| 55 | 3300025986 | Ga0207658_10005593 | Ga0207658_100055937 | 236 |
| 56 | 3300025986 | Ga0207658_10259456 | Ga0207658_102594562 | 236 |
| 57 | 3300026023 | Ga0207677_10000452 | Ga0207677_100004525 | 236 |
| 58 | 3300026035 | Ga0207703_10003262 | Ga0207703_1000326211 | 236 |
| 59 | 3300026088 | Ga0207641_10038644 | Ga0207641_100386445 | 236 |
| 60 | 3300026095 | Ga0207676_10042218 | Ga0207676_100422182 | 236 |
| 61 | 3300028381 | Ga0268264_10003378 | Ga0268264_1000337816 | 236 |
| 62 | 3300028381 | Ga0268264_10141634 | Ga0268264_101416343 | 236 |
| 63 | 3300028794 | Ga0307515_10009711 | Ga0307515_1000971117 | 236 |
| 64 | 3300031507 | Ga0307509_10224368 | Ga0307509_102243682 | 236 |
| 65 | 3300031616 | Ga0307508_10001467 | Ga0307508_1000146729 | 236 |
| 66 | 3300031649 | Ga0307514_10119814 | Ga0307514_101198141 | 236 |
| 67 | 3300031911 | Ga0307412_10106523 | Ga0307412_101065232 | 236 |
| 68 | 3300032002 | Ga0307416_100087114 | Ga0307416_1000871143 | 236 |
| 69 | 3300039447 | Ga0436361_0228735 | Ga0436361_0228735_175_936 | 236 |
| 70 | 3300048911 | Ga0496108_0017286 | Ga0496108_0017286_4759_5610 | 236 |
| 71 | 3300005328 | Ga0070676_10001849 | Ga0070676_1000184913 | 237 |
| 72 | 3300005347 | Ga0070668_100013101 | Ga0070668_1000131017 | 237 |
| 73 | 3300005364 | Ga0070673_100324082 | Ga0070673_1003240822 | 237 |
| 74 | 3300005578 | Ga0068854_100173915 | Ga0068854_1001739152 | 237 |
| 75 | 3300005617 | Ga0068859_100205505 | Ga0068859_1002055053 | 237 |
| 76 | 3300005842 | Ga0068858_100363431 | Ga0068858_1003634312 | 237 |
| 77 | 3300006931 | Ga0097620_100205485 | Ga0097620_1002054853 | 237 |
| 78 | 3300009093 | Ga0105240_10221428 | Ga0105240_102214283 | 237 |
| 79 | 3300009147 | Ga0114129_10267738 | Ga0114129_102677381 | 237 |
| 80 | 3300025913 | Ga0207695_10088943 | Ga0207695_100889434 | 237 |
| 81 | 3300025941 | Ga0207711_10126201 | Ga0207711_101262013 | 237 |
| 82 | 3300050507 | nmdc:mga05p37_182246_c1 | nmdc:mga05p37_182246_c1_296_1033 | 237 |
| 83 | 3300005563 | Ga0068855_100015066 | Ga0068855_10001506611 | 238 |
| 84 | 3300006195 | Ga0075366_10025896 | Ga0075366_100258964 | 238 |
| 85 | 3300025949 | Ga0207667_10009860 | Ga0207667_1000986011 | 238 |
| 86 | 3300025949 | Ga0207667_10011386 | Ga0207667_100113869 | 238 |
| 87 | 3300031456 | Ga0307513_10065125 | Ga0307513_100651252 | 238 |
| 88 | 3300050493 | nmdc:mga0k408_18200_c2 | nmdc:mga0k408_18200_c2_1474_2208 | 238 |
| 89 | iso_pu_bacteria | 2596583598 | 2597028212 | 238 |
| 90 | iso_pu_bacteria | 2599185178 | 2599444958 | 238 |
| 91 | iso_pu_bacteria | 2643221639 | 2644217211 | 238 |
| 92 | iso_pu_bacteria | 2643221646 | 2644259021 | 238 |
| 93 | iso_pu_bacteria | 2900577576 | 2900581445 | 238 |
| 94 | iso_pu_bacteria | 2928058823 | 2928060116 | 238 |
| 95 | 3300005616 | Ga0068852_100005883 | Ga0068852_1000058833 | 239 |
| 96 | 3300026142 | Ga0207698_10011131 | Ga0207698_100111315 | 239 |
| 97 | 3300041498 | Ga0451841_0612080 | Ga0451841_0612080_43_837 | 239 |
| 98 | 3300046683 | Ga0495658_0093624 | Ga0495658_0093624_616_1467 | 239 |
| 99 | iso_pu_bacteria | 2643221544 | 2643743908 | 239 |
| 100 | iso_pu_bacteria | 2643221585 | 2643933068 | 239 |
| 101 | iso_pu_bacteria | 2643221656 | 2644314317 | 239 |
| 102 | iso_pu_bacteria | 2738541337 | 2739055758 | 239 |
| 103 | 3300001915 | JGI24741J21665_1000016 | JGI24741J21665_100001623 | 240 |
| 104 | 3300001979 | JGI24740J21852_10000113 | JGI24740J21852_100001138 | 240 |
| 105 | 3300003578 | Ga0006562J51391_1019837 | Ga0006562J51391_10198376 | 240 |
| 106 | 3300003752 | Ga0055539_1000127 | Ga0055539_100012747 | 240 |
| 107 | 3300003758 | Ga0055532_1000054 | Ga0055532_1000054141 | 240 |
| 108 | 3300003759 | Ga0055525_1000278 | Ga0055525_10002786 | 240 |
| 109 | 3300003760 | Ga0055527_1001718 | Ga0055527_10017183 | 240 |
| 110 | 3300003761 | Ga0055535_1000037 | Ga0055535_100003730 | 240 |
| 111 | 3300003763 | Ga0055529_1000070 | Ga0055529_1000070141 | 240 |
| 112 | 3300005344 | Ga0070661_100000068 | Ga0070661_10000006840 | 240 |
| 113 | 3300005455 | Ga0070663_100000008 | Ga0070663_100000008158 | 240 |
| 114 | 3300005564 | Ga0070664_100000009 | Ga0070664_100000009158 | 240 |
| 115 | 3300005577 | Ga0068857_100015752 | Ga0068857_1000157528 | 240 |
| 116 | 3300005578 | Ga0068854_100000696 | Ga0068854_10000069612 | 240 |
| 117 | 3300005614 | Ga0068856_100000019 | Ga0068856_10000001930 | 240 |
| 118 | 3300005616 | Ga0068852_100123382 | Ga0068852_1001233823 | 240 |
| 119 | 3300005617 | Ga0068859_100367200 | Ga0068859_1003672003 | 240 |
| 120 | 3300005842 | Ga0068858_100001515 | Ga0068858_10000151519 | 240 |
| 121 | 3300006931 | Ga0097620_100367195 | Ga0097620_1003671952 | 240 |
| 122 | 3300009093 | Ga0105240_10030303 | Ga0105240_100303036 | 240 |
| 123 | 3300009148 | Ga0105243_10008438 | Ga0105243_100084384 | 240 |
| 124 | 3300013100 | Ga0157373_10000617 | Ga0157373_1000061727 | 240 |
| 125 | 3300013102 | Ga0157371_10000047 | Ga0157371_1000004726 | 240 |
| 126 | 3300013104 | Ga0157370_10000004 | Ga0157370_10000004314 | 240 |
| 127 | 3300013105 | Ga0157369_10004067 | Ga0157369_1000406712 | 240 |
| 128 | 3300013307 | Ga0157372_10001037 | Ga0157372_1000103730 | 240 |
| 129 | 3300013308 | Ga0157375_10376569 | Ga0157375_103765693 | 240 |
| 130 | 3300014968 | Ga0157379_10039682 | Ga0157379_100396823 | 240 |
| 131 | 3300015261 | Ga0182006_1008279 | Ga0182006_10082794 | 240 |
| 132 | 3300020077 | Ga0206351_10859076 | Ga0206351_108590764 | 240 |
| 133 | 3300020610 | Ga0154015_1245876 | Ga0154015_124587627 | 240 |
| 134 | 3300025224 | Ga0209784_100029 | Ga0209784_10002945 | 240 |
| 135 | 3300025224 | Ga0209784_100318 | Ga0209784_10031817 | 240 |
| 136 | 3300025224 | Ga0209784_102235 | Ga0209784_1022352 | 240 |
| 137 | 3300025225 | Ga0209566_100030 | Ga0209566_100030293 | 240 |
| 138 | 3300025226 | Ga0209674_100075 | Ga0209674_100075175 | 240 |
| 139 | 3300025226 | Ga0209674_102415 | Ga0209674_1024153 | 240 |
| 140 | 3300025228 | Ga0209672_100710 | Ga0209672_1007103 | 240 |
| 141 | 3300025229 | Ga0209147_100008 | Ga0209147_100008408 | 240 |
| 142 | 3300025230 | Ga0209563_100117 | Ga0209563_100117109 | 240 |
| 143 | 3300025230 | Ga0209563_109069 | Ga0209563_1090693 | 240 |
| 144 | 3300025242 | Ga0209258_100013 | Ga0209258_100013408 | 240 |
| 145 | 3300025253 | Ga0209677_100030 | Ga0209677_100030293 | 240 |
| 146 | 3300025272 | Ga0209455_1000130 | Ga0209455_1000130140 | 240 |
| 147 | 3300025299 | Ga0209256_1036914 | Ga0209256_10369142 | 240 |
| 148 | 3300025913 | Ga0207695_10002229 | Ga0207695_1000222912 | 240 |
| 149 | 3300025918 | Ga0207662_10165251 | Ga0207662_101652511 | 240 |
| 150 | 3300025920 | Ga0207649_10000030 | Ga0207649_1000003082 | 240 |
| 151 | 3300025935 | Ga0207709_10014336 | Ga0207709_100143365 | 240 |
| 152 | 3300025945 | Ga0207679_10000004 | Ga0207679_10000004156 | 240 |
| 153 | 3300025981 | Ga0207640_10000731 | Ga0207640_1000073118 | 240 |
| 154 | 3300026035 | Ga0207703_10121427 | Ga0207703_101214274 | 240 |
| 155 | 3300026067 | Ga0207678_10000006 | Ga0207678_10000006156 | 240 |
| 156 | 3300026078 | Ga0207702_10000472 | Ga0207702_1000047221 | 240 |
| 157 | 3300026116 | Ga0207674_10020895 | Ga0207674_100208953 | 240 |
| 158 | 3300026142 | Ga0207698_10100721 | Ga0207698_101007213 | 240 |
| 159 | 3300036401 | Ga0373937_0168463 | Ga0373937_0168463_571_1428 | 240 |
| 160 | 3300037418 | Ga0395900_0024352 | Ga0395900_0024352_3029_3778 | 240 |
| 161 | 3300037471 | Ga0395905_0000071 | Ga0395905_0000071_44731_45471 | 240 |
| 162 | 3300037471 | Ga0395905_0683056 | Ga0395905_0683056_135_884 | 240 |
| 163 | 3300042876 | Ga0451577_0459358 | Ga0451577_0459358_143_886 | 240 |
| 164 | 3300044658 | Ga0466972_0003244 | Ga0466972_0003244_7228_7977 | 240 |
| 165 | 3300044684 | Ga0466966_0015315 | Ga0466966_0015315_3819_4598 | 240 |
| 166 | 3300044693 | Ga0466961_0000221 | Ga0466961_0000221_26200_26949 | 240 |
| 167 | 3300044706 | Ga0466964_0003021 | Ga0466964_0003021_4015_4794 | 240 |
| 168 | 3300044706 | Ga0466964_0023625 | Ga0466964_0023625_411_1160 | 240 |
| 169 | 3300044735 | Ga0466968_0057029 | Ga0466968_0057029_862_1611 | 240 |
| 170 | 3300045049 | Ga0466959_0013106 | Ga0466959_0013106_2405_3184 | 240 |
| 171 | 3300050496 | nmdc:mga07m45_18856_c1 | nmdc:mga07m45_18856_c1_467_1207 | 240 |
| 172 | 3300053139 | Ga0500568_0006807 | Ga0500568_0006807_1655_2413 | 240 |
| 173 | 3300059640 | Ga0587067_001860 | Ga0587067_001860_124_873 | 240 |
| 174 | iso_pu_bacteria | 2885266251 | 2885269828 | 240 |
| 175 | 3300003794 | Ga0055531_10000043 | Ga0055531_1000004357 | 241 |
| 176 | 3300005331 | Ga0070670_100037154 | Ga0070670_1000371543 | 241 |
| 177 | 3300005354 | Ga0070675_100012571 | Ga0070675_1000125717 | 241 |
| 178 | 3300005618 | Ga0068864_100003978 | Ga0068864_1000039789 | 241 |
| 179 | 3300009036 | Ga0105244_10000750 | Ga0105244_1000075011 | 241 |
| 180 | 3300025298 | Ga0209050_1001300 | Ga0209050_100130014 | 241 |
| 181 | 3300025304 | Ga0209257_1000182 | Ga0209257_100018248 | 241 |
| 182 | 3300025925 | Ga0207650_10002550 | Ga0207650_100025505 | 241 |
| 183 | 3300025926 | Ga0207659_10037282 | Ga0207659_100372823 | 241 |
| 184 | 3300025940 | Ga0207691_10005390 | Ga0207691_1000539013 | 241 |
| 185 | 3300025960 | Ga0207651_10137004 | Ga0207651_101370042 | 241 |
| 186 | 3300026095 | Ga0207676_10012508 | Ga0207676_100125082 | 241 |
| 187 | 3300028794 | Ga0307515_10000188 | Ga0307515_10000188118 | 241 |
| 188 | 3300029957 | Ga0265324_10050632 | Ga0265324_100506323 | 241 |
| 189 | 3300037418 | Ga0395900_0002257 | Ga0395900_0002257_3285_4031 | 241 |
| 190 | 3300037471 | Ga0395905_0389214 | Ga0395905_0389214_81_827 | 241 |
| 191 | 3300048911 | Ga0496108_0054001 | Ga0496108_0054001_2306_3154 | 241 |
| 192 | 3300048912 | Ga0496109_0207722 | Ga0496109_0207722_714_1562 | 241 |
| 193 | iso_pu_bacteria | 2643221654 | 2644301596 | 241 |
| 194 | iso_pu_bacteria | 2842711865 | 2842717297 | 241 |
| 195 | 3300003792 | Ga0055540_1018737 | Ga0055540_10187373 | 242 |
| 196 | 3300005328 | Ga0070676_10019835 | Ga0070676_100198355 | 242 |
| 197 | 3300005337 | Ga0070682_100015765 | Ga0070682_1000157655 | 242 |
| 198 | 3300005347 | Ga0070668_100019903 | Ga0070668_1000199032 | 242 |
| 199 | 3300005843 | Ga0068860_100001009 | Ga0068860_10000100913 | 242 |
| 200 | 3300005844 | Ga0068862_100036617 | Ga0068862_1000366175 | 242 |
| 201 | 3300006195 | Ga0075366_10089230 | Ga0075366_100892302 | 242 |
| 202 | 3300006944 | Ga0099823_1000163 | Ga0099823_100016317 | 242 |
| 203 | 3300009098 | Ga0105245_10061364 | Ga0105245_100613642 | 242 |
| 204 | 3300009148 | Ga0105243_10083870 | Ga0105243_100838702 | 242 |
| 205 | 3300025298 | Ga0209050_1008874 | Ga0209050_10088747 | 242 |
| 206 | 3300025303 | Ga0209051_1000981 | Ga0209051_100098120 | 242 |
| 207 | 3300025304 | Ga0209257_1002753 | Ga0209257_100275314 | 242 |
| 208 | 3300025899 | Ga0207642_10008862 | Ga0207642_100088625 | 242 |
| 209 | 3300025923 | Ga0207681_10000795 | Ga0207681_1000079515 | 242 |
| 210 | 3300025923 | Ga0207681_10084985 | Ga0207681_100849853 | 242 |
| 211 | 3300025934 | Ga0207686_10047390 | Ga0207686_100473903 | 242 |
| 212 | 3300025935 | Ga0207709_10030033 | Ga0207709_100300332 | 242 |
| 213 | 3300025938 | Ga0207704_10276966 | Ga0207704_102769662 | 242 |
| 214 | 3300025942 | Ga0207689_10003512 | Ga0207689_100035123 | 242 |
| 215 | 3300025972 | Ga0207668_10017712 | Ga0207668_100177124 | 242 |
| 216 | 3300025972 | Ga0207668_10126010 | Ga0207668_101260102 | 242 |
| 217 | 3300025986 | Ga0207658_10001151 | Ga0207658_100011515 | 242 |
| 218 | 3300026035 | Ga0207703_10001999 | Ga0207703_100019999 | 242 |
| 219 | 3300026118 | Ga0207675_100059119 | Ga0207675_1000591193 | 242 |
| 220 | 3300027296 | Ga0209389_1015570 | Ga0209389_10155705 | 242 |
| 221 | 3300028380 | Ga0268265_10098075 | Ga0268265_100980753 | 242 |
| 222 | 3300028380 | Ga0268265_10121264 | Ga0268265_101212643 | 242 |
| 223 | 3300028381 | Ga0268264_10003920 | Ga0268264_100039205 | 242 |
| 224 | 3300031548 | Ga0307408_100000160 | Ga0307408_10000016078 | 242 |
| 225 | 3300031616 | Ga0307508_10327809 | Ga0307508_103278092 | 242 |
| 226 | 3300031731 | Ga0307405_10190515 | Ga0307405_101905153 | 242 |
| 227 | 3300035170 | Ga0373943_0040156 | Ga0373943_0040156_1316_2161 | 242 |
| 228 | 3300035410 | Ga0373924_0050922 | Ga0373924_0050922_105_953 | 242 |
| 229 | 3300044683 | Ga0466965_0068051 | Ga0466965_0068051_527_1306 | 242 |
| 230 | 3300044694 | Ga0466963_0000935 | Ga0466963_0000935_10445_11224 | 242 |
| 231 | 3300044712 | Ga0453684_0131943 | Ga0453684_0131943_1143_1922 | 242 |
| 232 | 3300044719 | Ga0466971_0020029 | Ga0466971_0020029_25_804 | 242 |
| 233 | 3300045051 | Ga0451576_0016908 | Ga0451576_0016908_2641_3420 | 242 |
| 234 | 3300045051 | Ga0451576_0126973 | Ga0451576_0126973_133_885 | 242 |
| 235 | 3300045836 | Ga0466958_0369987 | Ga0466958_0369987_47_826 | 242 |
| 236 | 3300045976 | Ga0466967_0021184 | Ga0466967_0021184_1306_2085 | 242 |
| 237 | 3300046459 | Ga0495629_0040968 | Ga0495629_0040968_1101_1949 | 242 |
| 238 | 3300046514 | Ga0495618_0101195 | Ga0495618_0101195_885_1733 | 242 |
| 239 | 3300046537 | Ga0495598_0018863 | Ga0495598_0018863_477_1334 | 242 |
| 240 | 3300046663 | Ga0495635_0146612 | Ga0495635_0146612_89_934 | 242 |
| 241 | 3300046683 | Ga0495658_0014926 | Ga0495658_0014926_2670_3518 | 242 |
| 242 | 3300047319 | Ga0495674_0161840 | Ga0495674_0161840_903_1751 | 242 |
| 243 | 3300047322 | Ga0495680_0048736 | Ga0495680_0048736_533_1381 | 242 |
| 244 | 3300048925 | Ga0496122_0011024 | Ga0496122_0011024_7844_8584 | 242 |
| 245 | 3300048926 | Ga0496123_0020213 | Ga0496123_0020213_1930_2670 | 242 |
| 246 | 3300048928 | Ga0496125_0000542 | Ga0496125_0000542_52005_52745 | 242 |
| 247 | 3300048929 | Ga0496126_0007499 | Ga0496126_0007499_10555_11295 | 242 |
| 248 | 3300050496 | nmdc:mga07m45_93480_c1 | nmdc:mga07m45_93480_c1_406_1164 | 242 |
| 249 | iso_pu_bacteria | 2643221644 | 2644248386 | 242 |
| 250 | 3300025935 | Ga0207709_10523836 | Ga0207709_105238361 | 243 |
| 251 | 3300025939 | Ga0207665_10028082 | Ga0207665_100280824 | 243 |
| 252 | 3300026095 | Ga0207676_10716159 | Ga0207676_107161592 | 243 |
| 253 | 3300028794 | Ga0307515_10003451 | Ga0307515_1000345114 | 243 |
| 254 | 3300031456 | Ga0307513_10043401 | Ga0307513_100434015 | 243 |
| 255 | 3300031649 | Ga0307514_10000711 | Ga0307514_1000071141 | 243 |
| 256 | 3300033180 | Ga0307510_10076751 | Ga0307510_100767512 | 243 |
| 257 | 3300042000 | Ga0439437_000403 | Ga0439437_000403_332_1081 | 243 |
| 258 | 3300042126 | Ga0450888_000730 | Ga0450888_000730_201_950 | 243 |
| 259 | 3300042129 | Ga0450891_000064 | Ga0450891_000064_6524_7273 | 243 |
| 260 | 3300042130 | Ga0450892_003526 | Ga0450892_003526_520_1269 | 243 |
| 261 | 3300042134 | Ga0450898_015580 | Ga0450898_015580_165_932 | 243 |
| 262 | 3300044656 | Ga0466969_0037790 | Ga0466969_0037790_1029_1781 | 243 |
| 263 | 3300044693 | Ga0466961_0006410 | Ga0466961_0006410_5429_6181 | 243 |
| 264 | 3300044712 | Ga0453684_0187709 | Ga0453684_0187709_508_1263 | 243 |
| 265 | 3300045049 | Ga0466959_0015936 | Ga0466959_0015936_48_800 | 243 |
| 266 | 3300049127 | Ga0501306_011393 | Ga0501306_011393_121_870 | 243 |
| 267 | 3300049129 | Ga0501309_000004 | Ga0501309_000004_10301_11050 | 243 |
| 268 | 3300049161 | Ga0501305_001609 | Ga0501305_001609_995_1744 | 243 |
| 269 | 3300049528 | Ga0501312_011215 | Ga0501312_011215_131_880 | 243 |
| 270 | 3300049651 | Ga0501201_004855 | Ga0501201_004855_132_881 | 243 |
| 271 | 3300049658 | Ga0501211_000442 | Ga0501211_000442_3039_3788 | 243 |
| 272 | 3300049662 | Ga0501222_010931 | Ga0501222_010931_86_835 | 243 |
| 273 | 3300049704 | Ga0501221_000933 | Ga0501221_000933_3395_4144 | 243 |
| 274 | 3300049705 | Ga0501225_0032891 | Ga0501225_0032891_298_1047 | 243 |
| 275 | 3300049706 | Ga0501229_000077 | Ga0501229_000077_7659_8408 | 243 |
| 276 | 3300049757 | Ga0501232_004559 | Ga0501232_004559_163_912 | 243 |
| 277 | 3300049759 | Ga0501262_009951 | Ga0501262_009951_155_904 | 243 |
| 278 | 3300049762 | Ga0501265_007761 | Ga0501265_007761_472_1221 | 243 |
| 279 | 3300049765 | Ga0501268_021296 | Ga0501268_021296_241_990 | 243 |
| 280 | 3300061719 | Ga0466962_0127631 | Ga0466962_0127631_75_827 | 243 |
| 281 | iso_pu_bacteria | 2928115317 | 2928116006 | 243 |
| 282 | 3300005330 | Ga0070690_100017913 | Ga0070690_1000179133 | 244 |
| 283 | 3300005334 | Ga0068869_100013993 | Ga0068869_1000139932 | 244 |
| 284 | 3300005353 | Ga0070669_100081110 | Ga0070669_1000811104 | 244 |
| 285 | 3300005353 | Ga0070669_100523006 | Ga0070669_1005230061 | 244 |
| 286 | 3300005354 | Ga0070675_100025359 | Ga0070675_1000253592 | 244 |
| 287 | 3300005355 | Ga0070671_100126528 | Ga0070671_1001265283 | 244 |
| 288 | 3300005366 | Ga0070659_100362210 | Ga0070659_1003622102 | 244 |
| 289 | 3300005459 | Ga0068867_100001932 | Ga0068867_1000019326 | 244 |
| 290 | 3300005466 | Ga0070685_10168252 | Ga0070685_101682521 | 244 |
| 291 | 3300005543 | Ga0070672_100030773 | Ga0070672_1000307734 | 244 |
| 292 | 3300005616 | Ga0068852_100197993 | Ga0068852_1001979933 | 244 |
| 293 | 3300006195 | Ga0075366_10005265 | Ga0075366_100052653 | 244 |
| 294 | 3300006237 | Ga0097621_100104372 | Ga0097621_1001043723 | 244 |
| 295 | 3300009177 | Ga0105248_10031936 | Ga0105248_100319363 | 244 |
| 296 | 3300009551 | Ga0105238_10209691 | Ga0105238_102096914 | 244 |
| 297 | 3300011119 | Ga0105246_10092463 | Ga0105246_100924632 | 244 |
| 298 | 3300011119 | Ga0105246_10262745 | Ga0105246_102627452 | 244 |
| 299 | 3300014968 | Ga0157379_10137716 | Ga0157379_101377162 | 244 |
| 300 | 3300025242 | Ga0209258_100567 | Ga0209258_1005675 | 244 |
| 301 | 3300025907 | Ga0207645_10392566 | Ga0207645_103925662 | 244 |
| 302 | 3300025920 | Ga0207649_10061744 | Ga0207649_100617441 | 244 |
| 303 | 3300025923 | Ga0207681_10033597 | Ga0207681_100335974 | 244 |
| 304 | 3300025926 | Ga0207659_10020083 | Ga0207659_100200834 | 244 |
| 305 | 3300025931 | Ga0207644_10002048 | Ga0207644_1000204815 | 244 |
| 306 | 3300025940 | Ga0207691_10012093 | Ga0207691_100120933 | 244 |
| 307 | 3300025941 | Ga0207711_10067509 | Ga0207711_100675095 | 244 |
| 308 | 3300025942 | Ga0207689_10016046 | Ga0207689_100160469 | 244 |
| 309 | 3300025981 | Ga0207640_10140289 | Ga0207640_101402893 | 244 |
| 310 | 3300026116 | Ga0207674_10009428 | Ga0207674_100094286 | 244 |
| 311 | 3300026142 | Ga0207698_10092330 | Ga0207698_100923303 | 244 |
| 312 | 3300027876 | Ga0209974_10006661 | Ga0209974_100066613 | 244 |
| 313 | 3300028666 | Ga0265336_10000022 | Ga0265336_100000226 | 244 |
| 314 | 3300029957 | Ga0265324_10000645 | Ga0265324_100006457 | 244 |
| 315 | 3300030522 | Ga0307512_10047346 | Ga0307512_100473465 | 244 |
| 316 | 3300031507 | Ga0307509_10003083 | Ga0307509_100030834 | 244 |
| 317 | 3300032002 | Ga0307416_100071278 | Ga0307416_1000712783 | 244 |
| 318 | 3300033180 | Ga0307510_10285068 | Ga0307510_102850682 | 244 |
| 319 | 3300037471 | Ga0395905_0003377 | Ga0395905_0003377_10486_11265 | 244 |
| 320 | 3300037471 | Ga0395905_0205360 | Ga0395905_0205360_285_1037 | 244 |
| 321 | 3300039447 | Ga0436361_0916039 | Ga0436361_0916039_894_1652 | 244 |
| 322 | 3300041458 | Ga0451798_0244844 | Ga0451798_0244844_114_881 | 244 |
| 323 | 3300041460 | Ga0451802_0517703 | Ga0451802_0517703_1252_2019 | 244 |
| 324 | 3300042876 | Ga0451577_0001807 | Ga0451577_0001807_2624_3388 | 244 |
| 325 | 3300044658 | Ga0466972_0020558 | Ga0466972_0020558_1583_2431 | 244 |
| 326 | 3300044901 | Ga0466960_0012592 | Ga0466960_0012592_2273_3034 | 244 |
| 327 | 3300045051 | Ga0451576_0422698 | Ga0451576_0422698_164_928 | 244 |
| 328 | 3300046454 | Ga0495592_0000213 | Ga0495592_0000213_33389_34138 | 244 |
| 329 | 3300046471 | Ga0495650_0002988 | Ga0495650_0002988_4182_4940 | 244 |
| 330 | 3300046680 | Ga0495646_0176976 | Ga0495646_0176976_302_1066 | 244 |
| 331 | 3300047472 | Ga0495686_0003802 | Ga0495686_0003802_8039_8803 | 244 |
| 332 | 3300049649 | Ga0501198_000047 | Ga0501198_000047_3418_4176 | 244 |
| 333 | 3300049662 | Ga0501222_000056 | Ga0501222_000056_3419_4177 | 244 |
| 334 | 3300049762 | Ga0501265_002252 | Ga0501265_002252_379_1146 | 244 |
| 335 | 3300049773 | Ga0501276_008540 | Ga0501276_008540_36_803 | 244 |
| 336 | 3300050493 | nmdc:mga0k408_268410_c1 | nmdc:mga0k408_268410_c1_74_838 | 244 |
| 337 | 3300053088 | Ga0500644_0002443 | Ga0500644_0002443_1099_1848 | 244 |
| 338 | 3300053156 | Ga0500622_0013320 | Ga0500622_0013320_2530_3279 | 244 |
| 339 | iso_pu_bacteria | 2585428062 | 2587756190 | 244 |
| 340 | iso_pu_bacteria | 2904541872 | 2904548252 | 244 |
| 341 | 3300005367 | Ga0070667_100067360 | Ga0070667_1000673603 | 245 |
| 342 | 3300005543 | Ga0070672_100015547 | Ga0070672_1000155476 | 245 |
| 343 | 3300005548 | Ga0070665_100294589 | Ga0070665_1002945892 | 245 |
| 344 | 3300006358 | Ga0068871_100191582 | Ga0068871_1001915823 | 245 |
| 345 | 3300006880 | Ga0075429_100008966 | Ga0075429_1000089666 | 245 |
| 346 | 3300009176 | Ga0105242_10002491 | Ga0105242_1000249111 | 245 |
| 347 | 3300009545 | Ga0105237_10073055 | Ga0105237_100730554 | 245 |
| 348 | 3300014325 | Ga0163163_10527368 | Ga0163163_105273681 | 245 |
| 349 | 3300021361 | Ga0213872_10056148 | Ga0213872_100561483 | 245 |
| 350 | 3300025934 | Ga0207686_10015629 | Ga0207686_100156295 | 245 |
| 351 | 3300026121 | Ga0207683_10058774 | Ga0207683_100587744 | 245 |
| 352 | 3300028786 | Ga0307517_10005592 | Ga0307517_1000559217 | 245 |
| 353 | 3300028794 | Ga0307515_10000165 | Ga0307515_1000016594 | 245 |
| 354 | 3300028794 | Ga0307515_10100821 | Ga0307515_101008214 | 245 |
| 355 | 3300039447 | Ga0436361_0030837 | Ga0436361_0030837_927_1688 | 245 |
| 356 | 3300042115 | Ga0450911_000798 | Ga0450911_000798_1219_1959 | 245 |
| 357 | 3300046530 | Ga0495654_0002282 | Ga0495654_0002282_1594_2364 | 245 |
| 358 | 3300046660 | Ga0495625_0060694 | Ga0495625_0060694_1419_2174 | 245 |
| 359 | 3300053086 | Ga0500578_0000006 | Ga0500578_0000006_96830_97582 | 245 |
| 360 | 3300053091 | Ga0500647_0144256 | Ga0500647_0144256_55_825 | 245 |
| 361 | 3300053136 | Ga0500559_0118872 | Ga0500559_0118872_424_1209 | 245 |
| 362 | iso_pu_bacteria | 2929160207 | 2929163242 | 245 |
| 363 | 3300005457 | Ga0070662_100052894 | Ga0070662_1000528943 | 246 |
| 364 | 3300006051 | Ga0075364_10011206 | Ga0075364_100112063 | 246 |
| 365 | 3300006195 | Ga0075366_10259869 | Ga0075366_102598692 | 246 |
| 366 | 3300025298 | Ga0209050_1001233 | Ga0209050_100123313 | 246 |
| 367 | 3300025303 | Ga0209051_1054597 | Ga0209051_10545972 | 246 |
| 368 | 3300028794 | Ga0307515_10001456 | Ga0307515_1000145645 | 246 |
| 369 | 3300031995 | Ga0307409_100049671 | Ga0307409_1000496714 | 246 |
| 370 | 3300032004 | Ga0307414_10149621 | Ga0307414_101496213 | 246 |
| 371 | 3300035691 | Ga0373931_0174722 | Ga0373931_0174722_161_919 | 246 |
| 372 | 3300044712 | Ga0453684_0283535 | Ga0453684_0283535_217_969 | 246 |
| 373 | 3300044735 | Ga0466968_0005264 | Ga0466968_0005264_3133_3972 | 246 |
| 374 | 3300046453 | Ga0495627_075952 | Ga0495627_075952_82_846 | 246 |
| 375 | 3300048908 | Ga0496105_0346090 | Ga0496105_0346090_314_1171 | 246 |
| 376 | 3300053156 | Ga0500622_0001738 | Ga0500622_0001738_12829_13587 | 246 |
| 377 | iso_pu_bacteria | 2585428057 | 2587725129 | 246 |
| 378 | iso_pu_bacteria | 2585428058 | 2587731511 | 246 |
| 379 | iso_pu_bacteria | 2588253510 | 2588295156 | 246 |
| 380 | iso_pu_bacteria | 2643221592 | 2643966983 | 246 |
| 381 | iso_pu_bacteria | 2643221625 | 2644142648 | 246 |
| 382 | iso_pu_bacteria | 2643221648 | 2644273677 | 246 |
| 383 | 3300005289 | Ga0065704_10072289 | Ga0065704_100722897 | 247 |
| 384 | 3300005295 | Ga0065707_10029338 | Ga0065707_100293381 | 247 |
| 385 | 3300005355 | Ga0070671_100152385 | Ga0070671_1001523853 | 247 |
| 386 | 3300005546 | Ga0070696_100360898 | Ga0070696_1003608982 | 247 |
| 387 | 3300025315 | Ga0207697_10105617 | Ga0207697_101056172 | 247 |
| 388 | 3300025321 | Ga0207656_10078424 | Ga0207656_100784242 | 247 |
| 389 | 3300025893 | Ga0207682_10008487 | Ga0207682_100084874 | 247 |
| 390 | 3300025923 | Ga0207681_10193930 | Ga0207681_101939303 | 247 |
| 391 | 3300025925 | Ga0207650_10004501 | Ga0207650_100045013 | 247 |
| 392 | 3300025925 | Ga0207650_10544990 | Ga0207650_105449901 | 247 |
| 393 | 3300025940 | Ga0207691_10026402 | Ga0207691_100264024 | 247 |
| 394 | 3300025960 | Ga0207651_10510441 | Ga0207651_105104412 | 247 |
| 395 | 3300026067 | Ga0207678_10442869 | Ga0207678_104428692 | 247 |
| 396 | 3300031548 | Ga0307408_100081746 | Ga0307408_1000817464 | 247 |
| 397 | 3300031911 | Ga0307412_10691512 | Ga0307412_106915121 | 247 |
| 398 | 3300035083 | Ga0373926_0127566 | Ga0373926_0127566_94_879 | 247 |
| 399 | 3300035695 | Ga0373927_0076004 | Ga0373927_0076004_924_1709 | 247 |
| 400 | 3300044712 | Ga0453684_0007748 | Ga0453684_0007748_8177_8953 | 247 |
| 401 | 3300046477 | Ga0495664_0294883 | Ga0495664_0294883_150_935 | 247 |
| 402 | 3300046542 | Ga0495597_0000077 | Ga0495597_0000077_14288_15061 | 247 |
| 403 | 3300048088 | Ga0495602_0254728 | Ga0495602_0254728_31_891 | 247 |
| 404 | 3300048926 | Ga0496123_0112315 | Ga0496123_0112315_243_1001 | 247 |
| 405 | 3300050493 | nmdc:mga0k408_506_c1 | nmdc:mga0k408_506_c1_9200_9991 | 247 |
| 406 | iso_pu_bacteria | 2990710928 | 2990715571 | 247 |
| 407 | 3300005262 | Ga0065165_1001585 | Ga0065165_100158513 | 248 |
| 408 | 3300005290 | Ga0065712_10257904 | Ga0065712_102579042 | 248 |
| 409 | 3300005293 | Ga0065715_10145513 | Ga0065715_101455132 | 248 |
| 410 | 3300005329 | Ga0070683_100032863 | Ga0070683_1000328636 | 248 |
| 411 | 3300005331 | Ga0070670_100095571 | Ga0070670_1000955713 | 248 |
| 412 | 3300005336 | Ga0070680_100121871 | Ga0070680_1001218714 | 248 |
| 413 | 3300005338 | Ga0068868_100052781 | Ga0068868_1000527814 | 248 |
| 414 | 3300005338 | Ga0068868_100140028 | Ga0068868_1001400281 | 248 |
| 415 | 3300005339 | Ga0070660_100002224 | Ga0070660_1000022245 | 248 |
| 416 | 3300005344 | Ga0070661_100005152 | Ga0070661_1000051527 | 248 |
| 417 | 3300005354 | Ga0070675_100011215 | Ga0070675_1000112158 | 248 |
| 418 | 3300005355 | Ga0070671_100104203 | Ga0070671_1001042031 | 248 |
| 419 | 3300005356 | Ga0070674_100029632 | Ga0070674_1000296322 | 248 |
| 420 | 3300005356 | Ga0070674_100038484 | Ga0070674_1000384844 | 248 |
| 421 | 3300005364 | Ga0070673_100027009 | Ga0070673_1000270094 | 248 |
| 422 | 3300005364 | Ga0070673_100274931 | Ga0070673_1002749311 | 248 |
| 423 | 3300005366 | Ga0070659_100008671 | Ga0070659_1000086718 | 248 |
| 424 | 3300005456 | Ga0070678_100099107 | Ga0070678_1000991074 | 248 |
| 425 | 3300005459 | Ga0068867_100000329 | Ga0068867_10000032918 | 248 |
| 426 | 3300005459 | Ga0068867_100020667 | Ga0068867_1000206674 | 248 |
| 427 | 3300005467 | Ga0070706_100096620 | Ga0070706_1000966201 | 248 |
| 428 | 3300005530 | Ga0070679_100212093 | Ga0070679_1002120933 | 248 |
| 429 | 3300005543 | Ga0070672_100027777 | Ga0070672_1000277773 | 248 |
| 430 | 3300005547 | Ga0070693_100026317 | Ga0070693_1000263173 | 248 |
| 431 | 3300005563 | Ga0068855_100019544 | Ga0068855_1000195447 | 248 |
| 432 | 3300005564 | Ga0070664_100001831 | Ga0070664_1000018319 | 248 |
| 433 | 3300005577 | Ga0068857_100001323 | Ga0068857_1000013232 | 248 |
| 434 | 3300005578 | Ga0068854_100285357 | Ga0068854_1002853573 | 248 |
| 435 | 3300005615 | Ga0070702_100217785 | Ga0070702_1002177852 | 248 |
| 436 | 3300005616 | Ga0068852_100003215 | Ga0068852_1000032159 | 248 |
| 437 | 3300005617 | Ga0068859_100111138 | Ga0068859_1001111383 | 248 |
| 438 | 3300005618 | Ga0068864_100026806 | Ga0068864_1000268064 | 248 |
| 439 | 3300005834 | Ga0068851_10110219 | Ga0068851_101102193 | 248 |
| 440 | 3300005840 | Ga0068870_10013055 | Ga0068870_100130556 | 248 |
| 441 | 3300005843 | Ga0068860_100249680 | Ga0068860_1002496801 | 248 |
| 442 | 3300005844 | Ga0068862_100016575 | Ga0068862_1000165756 | 248 |
| 443 | 3300006237 | Ga0097621_100056447 | Ga0097621_1000564473 | 248 |
| 444 | 3300006931 | Ga0097620_100111147 | Ga0097620_1001111473 | 248 |
| 445 | 3300009093 | Ga0105240_10023967 | Ga0105240_100239672 | 248 |
| 446 | 3300009148 | Ga0105243_10018872 | Ga0105243_100188721 | 248 |
| 447 | 3300009148 | Ga0105243_10107737 | Ga0105243_101077372 | 248 |
| 448 | 3300009545 | Ga0105237_10452160 | Ga0105237_104521603 | 248 |
| 449 | 3300009551 | Ga0105238_10001575 | Ga0105238_100015758 | 248 |
| 450 | 3300013100 | Ga0157373_10020413 | Ga0157373_100204136 | 248 |
| 451 | 3300013102 | Ga0157371_10094994 | Ga0157371_100949943 | 248 |
| 452 | 3300013104 | Ga0157370_10026238 | Ga0157370_100262386 | 248 |
| 453 | 3300013105 | Ga0157369_10014312 | Ga0157369_100143128 | 248 |
| 454 | 3300013307 | Ga0157372_10010263 | Ga0157372_100102637 | 248 |
| 455 | 3300013307 | Ga0157372_10059208 | Ga0157372_100592085 | 248 |
| 456 | 3300014745 | Ga0157377_10000170 | Ga0157377_1000017025 | 248 |
| 457 | 3300014968 | Ga0157379_10086468 | Ga0157379_100864682 | 248 |
| 458 | 3300025294 | Ga0209025_1000073 | Ga0209025_100007338 | 248 |
| 459 | 3300025315 | Ga0207697_10046050 | Ga0207697_100460503 | 248 |
| 460 | 3300025893 | Ga0207682_10002310 | Ga0207682_100023105 | 248 |
| 461 | 3300025899 | Ga0207642_10058739 | Ga0207642_100587392 | 248 |
| 462 | 3300025907 | Ga0207645_10143291 | Ga0207645_101432912 | 248 |
| 463 | 3300025909 | Ga0207705_10033984 | Ga0207705_100339845 | 248 |
| 464 | 3300025910 | Ga0207684_10071919 | Ga0207684_100719193 | 248 |
| 465 | 3300025911 | Ga0207654_10146490 | Ga0207654_101464903 | 248 |
| 466 | 3300025912 | Ga0207707_10034849 | Ga0207707_100348492 | 248 |
| 467 | 3300025913 | Ga0207695_10258881 | Ga0207695_102588813 | 248 |
| 468 | 3300025917 | Ga0207660_10141322 | Ga0207660_101413222 | 248 |
| 469 | 3300025919 | Ga0207657_10002308 | Ga0207657_1000230817 | 248 |
| 470 | 3300025919 | Ga0207657_10135699 | Ga0207657_101356994 | 248 |
| 471 | 3300025921 | Ga0207652_10081244 | Ga0207652_100812442 | 248 |
| 472 | 3300025923 | Ga0207681_10017788 | Ga0207681_100177884 | 248 |
| 473 | 3300025924 | Ga0207694_10004060 | Ga0207694_100040608 | 248 |
| 474 | 3300025925 | Ga0207650_10014903 | Ga0207650_100149032 | 248 |
| 475 | 3300025925 | Ga0207650_10209144 | Ga0207650_102091443 | 248 |
| 476 | 3300025926 | Ga0207659_10013398 | Ga0207659_100133984 | 248 |
| 477 | 3300025929 | Ga0207664_10025828 | Ga0207664_100258286 | 248 |
| 478 | 3300025931 | Ga0207644_10067753 | Ga0207644_100677534 | 248 |
| 479 | 3300025932 | Ga0207690_10005174 | Ga0207690_100051745 | 248 |
| 480 | 3300025932 | Ga0207690_10219101 | Ga0207690_102191012 | 248 |
| 481 | 3300025934 | Ga0207686_10525821 | Ga0207686_105258212 | 248 |
| 482 | 3300025935 | Ga0207709_10001296 | Ga0207709_100012967 | 248 |
| 483 | 3300025935 | Ga0207709_10027125 | Ga0207709_100271253 | 248 |
| 484 | 3300025937 | Ga0207669_10041654 | Ga0207669_100416542 | 248 |
| 485 | 3300025937 | Ga0207669_10521049 | Ga0207669_105210492 | 248 |
| 486 | 3300025940 | Ga0207691_10007761 | Ga0207691_100077619 | 248 |
| 487 | 3300025944 | Ga0207661_10140288 | Ga0207661_101402884 | 248 |
| 488 | 3300025944 | Ga0207661_10191726 | Ga0207661_101917263 | 248 |
| 489 | 3300025945 | Ga0207679_10014481 | Ga0207679_100144812 | 248 |
| 490 | 3300025945 | Ga0207679_10053631 | Ga0207679_100536313 | 248 |
| 491 | 3300025949 | Ga0207667_10002655 | Ga0207667_1000265518 | 248 |
| 492 | 3300025960 | Ga0207651_10025563 | Ga0207651_100255634 | 248 |
| 493 | 3300025981 | Ga0207640_10025789 | Ga0207640_100257895 | 248 |
| 494 | 3300025981 | Ga0207640_10535755 | Ga0207640_105357552 | 248 |
| 495 | 3300026023 | Ga0207677_10074683 | Ga0207677_100746834 | 248 |
| 496 | 3300026078 | Ga0207702_10044080 | Ga0207702_100440805 | 248 |
| 497 | 3300026078 | Ga0207702_10731382 | Ga0207702_107313822 | 248 |
| 498 | 3300026089 | Ga0207648_10000748 | Ga0207648_1000074822 | 248 |
| 499 | 3300026089 | Ga0207648_10015290 | Ga0207648_100152904 | 248 |
| 500 | 3300026089 | Ga0207648_10159491 | Ga0207648_101594913 | 248 |
| 501 | 3300026095 | Ga0207676_10052796 | Ga0207676_100527964 | 248 |
| 502 | 3300026116 | Ga0207674_10000040 | Ga0207674_1000004092 | 248 |
| 503 | 3300026116 | Ga0207674_10078389 | Ga0207674_100783894 | 248 |
| 504 | 3300026121 | Ga0207683_10008569 | Ga0207683_100085698 | 248 |
| 505 | 3300026142 | Ga0207698_10469712 | Ga0207698_104697122 | 248 |
| 506 | 3300028379 | Ga0268266_10054826 | Ga0268266_100548264 | 248 |
| 507 | 3300028380 | Ga0268265_10013319 | Ga0268265_100133196 | 248 |
| 508 | 3300028381 | Ga0268264_10284576 | Ga0268264_102845762 | 248 |
| 509 | 3300028786 | Ga0307517_10026165 | Ga0307517_100261657 | 248 |
| 510 | 3300028794 | Ga0307515_10000232 | Ga0307515_1000023252 | 248 |
| 511 | 3300028794 | Ga0307515_10229842 | Ga0307515_102298423 | 248 |
| 512 | 3300030522 | Ga0307512_10201451 | Ga0307512_102014511 | 248 |
| 513 | 3300031251 | Ga0265327_10001301 | Ga0265327_1000130110 | 248 |
| 514 | 3300031507 | Ga0307509_10070806 | Ga0307509_100708063 | 248 |
| 515 | 3300031649 | Ga0307514_10201358 | Ga0307514_102013582 | 248 |
| 516 | 3300031730 | Ga0307516_10004400 | Ga0307516_1000440019 | 248 |
| 517 | 3300031730 | Ga0307516_10005959 | Ga0307516_100059596 | 248 |
| 518 | 3300031730 | Ga0307516_10074947 | Ga0307516_100749475 | 248 |
| 519 | 3300031730 | Ga0307516_10128425 | Ga0307516_101284253 | 248 |
| 520 | 3300037466 | Ga0395898_0002077 | Ga0395898_0002077_10822_11631 | 248 |
| 521 | 3300041451 | Ga0451791_1734106 | Ga0451791_1734106_239_1024 | 248 |
| 522 | 3300042439 | Ga0439464_0021522 | Ga0439464_0021522_337_1191 | 248 |
| 523 | 3300046462 | Ga0495651_0129527 | Ga0495651_0129527_641_1417 | 248 |
| 524 | 3300046519 | Ga0495632_0067015 | Ga0495632_0067015_385_1170 | 248 |
| 525 | 3300046522 | Ga0495643_0074440 | Ga0495643_0074440_226_1011 | 248 |
| 526 | 3300046660 | Ga0495625_0040736 | Ga0495625_0040736_133_918 | 248 |
| 527 | 3300048912 | Ga0496109_0517933 | Ga0496109_0517933_217_993 | 248 |
| 528 | 3300053078 | Ga0495612_0091577 | Ga0495612_0091577_368_1228 | 248 |
| 529 | 3300053154 | Ga0500619_000073 | Ga0500619_000073_3237_4022 | 248 |
| 530 | 3300053730 | Ga0500645_007607 | Ga0500645_007607_2424_3209 | 248 |
| 531 | 3300005356 | Ga0070674_100021390 | Ga0070674_1000213904 | 249 |
| 532 | 3300005367 | Ga0070667_100080718 | Ga0070667_1000807183 | 249 |
| 533 | 3300005459 | Ga0068867_100023879 | Ga0068867_1000238795 | 249 |
| 534 | 3300005543 | Ga0070672_100021732 | Ga0070672_1000217325 | 249 |
| 535 | 3300005718 | Ga0068866_10002548 | Ga0068866_100025488 | 249 |
| 536 | 3300005719 | Ga0068861_100010826 | Ga0068861_1000108265 | 249 |
| 537 | 3300005843 | Ga0068860_100001710 | Ga0068860_10000171030 | 249 |
| 538 | 3300006881 | Ga0068865_100040116 | Ga0068865_1000401165 | 249 |
| 539 | 3300006946 | Ga0079104_1000040 | Ga0079104_100004053 | 249 |
| 540 | 3300009148 | Ga0105243_10040342 | Ga0105243_100403425 | 249 |
| 541 | 3300009553 | Ga0105249_10042407 | Ga0105249_100424074 | 249 |
| 542 | 3300013297 | Ga0157378_10020973 | Ga0157378_100209736 | 249 |
| 543 | 3300013306 | Ga0163162_10024300 | Ga0163162_100243006 | 249 |
| 544 | 3300013308 | Ga0157375_10027569 | Ga0157375_100275696 | 249 |
| 545 | 3300014968 | Ga0157379_10096959 | Ga0157379_100969593 | 249 |
| 546 | 3300017792 | Ga0163161_10169258 | Ga0163161_101692582 | 249 |
| 547 | 3300025899 | Ga0207642_10002846 | Ga0207642_100028466 | 249 |
| 548 | 3300025907 | Ga0207645_10397960 | Ga0207645_103979601 | 249 |
| 549 | 3300025937 | Ga0207669_10031874 | Ga0207669_100318744 | 249 |
| 550 | 3300025938 | Ga0207704_10084777 | Ga0207704_100847774 | 249 |
| 551 | 3300025940 | Ga0207691_10012813 | Ga0207691_100128135 | 249 |
| 552 | 3300025961 | Ga0207712_10041139 | Ga0207712_100411394 | 249 |
| 553 | 3300026067 | Ga0207678_10073289 | Ga0207678_100732895 | 249 |
| 554 | 3300026089 | Ga0207648_10000439 | Ga0207648_1000043943 | 249 |
| 555 | 3300026118 | Ga0207675_100013133 | Ga0207675_1000131338 | 249 |
| 556 | 3300027111 | Ga0209281_1000074 | Ga0209281_1000074133 | 249 |
| 557 | 3300028380 | Ga0268265_10122583 | Ga0268265_101225834 | 249 |
| 558 | 3300028381 | Ga0268264_10013375 | Ga0268264_100133756 | 249 |
| 559 | 3300031731 | Ga0307405_10053071 | Ga0307405_100530714 | 249 |
| 560 | 3300031852 | Ga0307410_10006186 | Ga0307410_100061867 | 249 |
| 561 | 3300031901 | Ga0307406_10037621 | Ga0307406_100376211 | 249 |
| 562 | 3300031903 | Ga0307407_10197530 | Ga0307407_101975302 | 249 |
| 563 | 3300031911 | Ga0307412_10152178 | Ga0307412_101521782 | 249 |
| 564 | 3300031995 | Ga0307409_100065516 | Ga0307409_1000655164 | 249 |
| 565 | 3300032004 | Ga0307414_10057023 | Ga0307414_100570234 | 249 |
| 566 | 3300032005 | Ga0307411_10006938 | Ga0307411_100069385 | 249 |
| 567 | 3300032126 | Ga0307415_100124110 | Ga0307415_1001241102 | 249 |
| 568 | 3300034817 | Ga0373948_0008268 | Ga0373948_0008268_296_1210 | 249 |
| 569 | 3300035088 | Ga0373940_0002695 | Ga0373940_0002695_401_1315 | 249 |
| 570 | 3300035114 | Ga0373939_0000133 | Ga0373939_0000133_18634_19548 | 249 |
| 571 | 3300035121 | Ga0373960_0001339 | Ga0373960_0001339_906_1820 | 249 |
| 572 | 3300035242 | Ga0373962_0026901 | Ga0373962_0026901_242_1156 | 249 |
| 573 | 3300035691 | Ga0373931_0000375 | Ga0373931_0000375_13983_14897 | 249 |
| 574 | 3300037471 | Ga0395905_0379559 | Ga0395905_0379559_367_1158 | 249 |
| 575 | 3300042005 | Ga0439448_0068765 | Ga0439448_0068765_167_1021 | 249 |
| 576 | 3300042125 | Ga0450923_040228 | Ga0450923_040228_91_885 | 249 |
| 577 | 3300042531 | Ga0450918_000344 | Ga0450918_000344_5774_6568 | 249 |
| 578 | 3300045051 | Ga0451576_0548244 | Ga0451576_0548244_313_1191 | 249 |
| 579 | 3300048905 | Ga0496102_0025441 | Ga0496102_0025441_1291_2079 | 249 |
| 580 | 3300048912 | Ga0496109_0086102 | Ga0496109_0086102_586_1362 | 249 |
| 581 | 3300048913 | Ga0496110_0099219 | Ga0496110_0099219_412_1188 | 249 |
| 582 | 3300048914 | Ga0496111_0586097 | Ga0496111_0586097_15_791 | 249 |
| 583 | iso_pu_bacteria | 2547132374 | 2548501225 | 249 |
| 584 | iso_pu_bacteria | 2643221717 | 2644649230 | 249 |
| 585 | 3300002773 | JGI25152J39213_1003322 | JGI25152J39213_10033226 | 250 |
| 586 | 3300003215 | JGI25153J46596_10012754 | JGI25153J46596_100127542 | 250 |
| 587 | 3300003771 | Ga0055526_1002532 | Ga0055526_100253212 | 250 |
| 588 | 3300005347 | Ga0070668_100130926 | Ga0070668_1001309261 | 250 |
| 589 | 3300005455 | Ga0070663_100193644 | Ga0070663_1001936443 | 250 |
| 590 | 3300005563 | Ga0068855_100225804 | Ga0068855_1002258042 | 250 |
| 591 | 3300005578 | Ga0068854_100183822 | Ga0068854_1001838223 | 250 |
| 592 | 3300005719 | Ga0068861_100007969 | Ga0068861_1000079695 | 250 |
| 593 | 3300005841 | Ga0068863_100160408 | Ga0068863_1001604083 | 250 |
| 594 | 3300006195 | Ga0075366_10083646 | Ga0075366_100836463 | 250 |
| 595 | 3300006237 | Ga0097621_100454272 | Ga0097621_1004542722 | 250 |
| 596 | 3300006353 | Ga0075370_10010292 | Ga0075370_100102923 | 250 |
| 597 | 3300006852 | Ga0075433_10616817 | Ga0075433_106168171 | 250 |
| 598 | 3300006871 | Ga0075434_100130115 | Ga0075434_1001301152 | 250 |
| 599 | 3300009098 | Ga0105245_10008631 | Ga0105245_100086315 | 250 |
| 600 | 3300009545 | Ga0105237_10024647 | Ga0105237_100246475 | 250 |
| 601 | 3300013296 | Ga0157374_10007375 | Ga0157374_100073754 | 250 |
| 602 | 3300013306 | Ga0163162_10080866 | Ga0163162_100808664 | 250 |
| 603 | 3300014968 | Ga0157379_10006124 | Ga0157379_100061243 | 250 |
| 604 | 3300025245 | Ga0207425_1000881 | Ga0207425_10008816 | 250 |
| 605 | 3300025258 | Ga0209129_1000027 | Ga0209129_1000027333 | 250 |
| 606 | 3300025273 | Ga0209673_1005247 | Ga0209673_10052473 | 250 |
| 607 | 3300025295 | Ga0209564_1000014 | Ga0209564_1000014449 | 250 |
| 608 | 3300025297 | Ga0209758_1000193 | Ga0209758_1000193119 | 250 |
| 609 | 3300025297 | Ga0209758_1000208 | Ga0209758_10002084 | 250 |
| 610 | 3300025304 | Ga0209257_1028057 | Ga0209257_10280573 | 250 |
| 611 | 3300025901 | Ga0207688_10009912 | Ga0207688_100099126 | 250 |
| 612 | 3300025914 | Ga0207671_10035144 | Ga0207671_100351444 | 250 |
| 613 | 3300025926 | Ga0207659_10032887 | Ga0207659_100328874 | 250 |
| 614 | 3300025927 | Ga0207687_10359395 | Ga0207687_103593952 | 250 |
| 615 | 3300025942 | Ga0207689_10004908 | Ga0207689_100049083 | 250 |
| 616 | 3300025949 | Ga0207667_10437689 | Ga0207667_104376892 | 250 |
| 617 | 3300025981 | Ga0207640_10229824 | Ga0207640_102298242 | 250 |
| 618 | 3300026067 | Ga0207678_10224502 | Ga0207678_102245023 | 250 |
| 619 | 3300026118 | Ga0207675_100005550 | Ga0207675_1000055503 | 250 |
| 620 | 3300026121 | Ga0207683_10278749 | Ga0207683_102787492 | 250 |
| 621 | 3300031238 | Ga0265332_10000187 | Ga0265332_1000018716 | 250 |
| 622 | 3300034818 | Ga0373950_0004635 | Ga0373950_0004635_525_1379 | 250 |
| 623 | 3300035112 | Ga0373932_0018539 | Ga0373932_0018539_90_944 | 250 |
| 624 | 3300041443 | Ga0451789_1195116 | Ga0451789_1195116_525_1316 | 250 |
| 625 | 3300041452 | Ga0451793_0166077 | Ga0451793_0166077_46_837 | 250 |
| 626 | 3300041459 | Ga0451800_0192177 | Ga0451800_0192177_110_901 | 250 |
| 627 | 3300045051 | Ga0451576_0407935 | Ga0451576_0407935_194_1048 | 250 |
| 628 | 3300048904 | Ga0496101_0008869 | Ga0496101_0008869_2286_3140 | 250 |
| 629 | 3300048909 | Ga0496106_0004162 | Ga0496106_0004162_1228_2082 | 250 |
| 630 | 3300048910 | Ga0496107_0012377 | Ga0496107_0012377_3742_4596 | 250 |
| 631 | 3300048911 | Ga0496108_0059614 | Ga0496108_0059614_1163_2017 | 250 |
| 632 | 3300048912 | Ga0496109_0040199 | Ga0496109_0040199_263_1117 | 250 |
| 633 | 3300048914 | Ga0496111_0303578 | Ga0496111_0303578_182_1036 | 250 |
| 634 | 3300048915 | Ga0496112_0063967 | Ga0496112_0063967_2729_3583 | 250 |
| 635 | 3300048917 | Ga0496114_0642772 | Ga0496114_0642772_24_878 | 250 |
| 636 | 3300048918 | Ga0496115_0002077 | Ga0496115_0002077_12596_13450 | 250 |
| 637 | 3300050493 | nmdc:mga0k408_10460_c1 | nmdc:mga0k408_10460_c1_2407_3198 | 250 |
| 638 | 3300050496 | nmdc:mga07m45_21210_c1 | nmdc:mga07m45_21210_c1_110_901 | 250 |
| 639 | 3300053109 | Ga0500569_056658 | Ga0500569_056658_281_1072 | 250 |
| 640 | 3300053133 | Ga0500655_020988 | Ga0500655_020988_311_1102 | 250 |
| 641 | 3300053151 | Ga0500604_0019070 | Ga0500604_0019070_582_1373 | 250 |
| 642 | iso_pu_bacteria | 2643221596 | 2643994633 | 250 |
| 643 | 3300031456 | Ga0307513_10020857 | Ga0307513_100208573 | 251 |
| 644 | 3300031730 | Ga0307516_10155668 | Ga0307516_101556682 | 251 |
| 645 | 3300053161 | Ga0500634_0005385 | Ga0500634_0005385_1108_1869 | 251 |
| 646 | iso_pu_bacteria | 2974320154 | 2974321997 | 251 |
| 647 | iso_pu_bacteria | 2904479285 | 2904480530 | 252 |
| 648 | 3300013308 | Ga0157375_10543308 | Ga0157375_105433081 | 253 |
| 649 | 3300021361 | Ga0213872_10009666 | Ga0213872_100096666 | 253 |
| 650 | 3300027252 | Ga0209973_1005973 | Ga0209973_10059732 | 253 |
| 651 | 3300027876 | Ga0209974_10000798 | Ga0209974_100007989 | 253 |
| 652 | 3300031548 | Ga0307408_100000096 | Ga0307408_10000009678 | 253 |
| 653 | 3300031548 | Ga0307408_100008311 | Ga0307408_1000083118 | 253 |
| 654 | 3300031901 | Ga0307406_10000669 | Ga0307406_1000066910 | 253 |
| 655 | 3300039447 | Ga0436361_0086324 | Ga0436361_0086324_11980_12759 | 253 |
| 656 | iso_pu_bacteria | 2643221609 | 2644061691 | 254 |
| 657 | iso_pu_bacteria | 2643221611 | 2644075222 | 254 |
| 658 | iso_pu_bacteria | 2738543012 | 2739243387 | 255 |
| 659 | iso_pu_bacteria | 2816332133 | 2816473966 | 255 |
| 660 | 3300046519 | Ga0495632_0007918 | Ga0495632_0007918_1958_2767 | 256 |
| 661 | 3300053127 | Ga0500623_007865 | Ga0500623_007865_2454_3263 | 256 |
| 662 | 3300053130 | Ga0500642_0005616 | Ga0500642_0005616_3200_4009 | 256 |
| 663 | 3300053131 | Ga0500652_001283 | Ga0500652_001283_3167_3976 | 256 |
| 664 | 3300053134 | Ga0500658_0183594 | Ga0500658_0183594_66_875 | 256 |
| 665 | 3300053724 | Ga0500570_126587 | Ga0500570_126587_59_868 | 256 |
| 666 | iso_pu_bacteria | 2721755523 | 2722881426 | 257 |
| 667 | iso_pu_bacteria | 2839138175 | 2839140672 | 257 |
| 668 | 2162886007 | SwRhRL2b_contig_2574424 | SwRhRL2b_0335.00001890 | 261 |
| 669 | 3300005289 | Ga0065704_10183301 | Ga0065704_101833012 | 261 |
| 670 | 3300006946 | Ga0079104_1000530 | Ga0079104_100053033 | 261 |
| 671 | 3300009148 | Ga0105243_10008894 | Ga0105243_100088948 | 261 |
| 672 | 3300025935 | Ga0207709_10000622 | Ga0207709_1000062214 | 261 |
| 673 | 3300027111 | Ga0209281_1000599 | Ga0209281_100059933 | 261 |
| 674 | 3300028794 | Ga0307515_10049534 | Ga0307515_100495345 | 261 |
| 675 | 3300031456 | Ga0307513_10155349 | Ga0307513_101553493 | 261 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6s3s-assembly1.cif.gz_E | structure of the flipqr complex from the flagellar type 3 secretion system of vibrio mimicus. | 0.6628 | 80 | 261 |
| 6s3s-assembly1.cif.gz_E | structure of the flipqr complex from the flagellar type 3 secretion system of vibrio mimicus. | 0.6404 | 80 | 261 |
| 6s3s-assembly1.cif.gz_D | structure of the flipqr complex from the flagellar type 3 secretion system of vibrio mimicus. | 0.6369 | 69 | 261 |
| 6s3l-assembly1.cif.gz_C | structure of the core of the flagellar export apparatus from vibrio mimicus, the flipqr-flhb complex. | 0.6353 | 67 | 261 |
| 6s3l-assembly1.cif.gz_C | structure of the core of the flagellar export apparatus from vibrio mimicus, the flipqr-flhb complex. | 0.6263 | 67 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_G5EF26_216_316_1.20.81.10 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;RAP domain | 0.4872 | 158 | 260 | 1.20.81.10 |
| af_G5EF26_216_316_1.20.81.10 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;RAP domain | 0.4591 | 158 | 260 | 1.20.81.10 |
| 3rrkA02 | Mainly Alpha;Up-down Bundle;subunit c (vma5p) of the yeast v-atpase, domain 2; | 0.4292 | 143 | 257 | 1.20.1460.20 |
| af_Q9NUZ1_433_546_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.3538 | 111 | 200 | 1.20.140.10 |
| af_H2L011_34_168_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.3463 | 109 | 198 | 1.20.120.230 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q2LCN4-F1-model_v4 | deleted | 0.8949 | 91 | 227 |
|
| AF-A0A4Q2LCN4-F1-model_v4 | deleted | 0.8887 | 91 | 227 |
|
| AF-Q3HWF8-F1-model_v4 | Flagellar biosynthetic protein FliP | 0.8542 | 106 | 243 |
GO:0005886
GO:0009306 GO:0009425 GO:0044781 |
| AF-Q3HWF8-F1-model_v4 | Flagellar biosynthetic protein FliP | 0.837 | 106 | 243 |
GO:0005886
GO:0009306 GO:0009425 GO:0044781 |
| AF-A0A379CZP5-F1-model_v4 | deleted | 0.8155 | 80 | 230 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar