F474423
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 675 | 320 | 1350 | 162 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100010140|Ga0070708_1000101402 |
| Length | 193 |
| Sequence | MFAIMQSIPAIIDALRRAPEIVVPLVREVPPAILKRRPAVRRWSAHEHACHLARVHSLFFDRLDDMLTSPAPVIRPYLPGDQDPDDLLLRMNLDAALDQFVADRRRLVARLEALGGADWTRTAEHPEYRTYSVFIMFRHLALHDFLHAYRIEELLLRPEWPDTSETQPNEVASGTVRPIGLPSAQDHRPSRGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 177 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 180 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 207 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 208 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 209 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 210 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 211 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 252 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 253 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 254 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 255 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 256 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 269 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 270 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 271 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 272 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 273 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 274 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 277 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 278 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 280 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 281 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 282 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 283 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 284 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 285 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 286 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 287 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 288 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 289 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 290 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 291 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 293 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 297 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 298 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 299 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 303 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 304 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 318 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 1.63 |
| Rhizosphere | 97.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 39.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070708_100010140 | 3300005445 | Bacteria | 7624 |
| 2 | JGI25406J46586_10015303 | 3300003203 | Bacteria | 3240 |
| 3 | Ga0065704_10153711 | 3300005289 | Bacteria | 1408 |
| 4 | Ga0065707_10193666 | 3300005295 | Bacteria | 1347 |
| 5 | Ga0070676_10317839 | 3300005328 | Bacteria | 1061 |
| 6 | Ga0070683_100099398 | 3300005329 | Unclassified | 2738 |
| 7 | Ga0070683_100634144 | 3300005329 | Bacteria | 1023 |
| 8 | Ga0070690_100012200 | 3300005330 | Bacteria | 5051 |
| 9 | Ga0070690_100201022 | 3300005330 | Unclassified | 1386 |
| 10 | Ga0070690_100382231 | 3300005330 | Unclassified | 1030 |
| 11 | Ga0070690_100845324 | 3300005330 | Bacteria | 713 |
| 12 | Ga0070670_100010611 | 3300005331 | Bacteria | 7867 |
| 13 | Ga0070670_100058389 | 3300005331 | Bacteria | 3313 |
| 14 | Ga0070670_100149757 | 3300005331 | Bacteria | 2019 |
| 15 | Ga0070670_100402347 | 3300005331 | Bacteria | 1209 |
| 16 | Ga0070670_100426782 | 3300005331 | Unclassified | 1172 |
| 17 | Ga0070677_10236993 | 3300005333 | Bacteria | 899 |
| 18 | Ga0068869_100099609 | 3300005334 | Bacteria | 2197 |
| 19 | Ga0068869_100102934 | 3300005334 | Unclassified | 2163 |
| 20 | Ga0068869_100483903 | 3300005334 | Unclassified | 1031 |
| 21 | Ga0070666_10104612 | 3300005335 | Unclassified | 1954 |
| 22 | Ga0070666_10302641 | 3300005335 | Unclassified | 1139 |
| 23 | Ga0070680_100103393 | 3300005336 | Bacteria | 2366 |
| 24 | Ga0070682_100031781 | 3300005337 | Unclassified | 3195 |
| 25 | Ga0070682_100422400 | 3300005337 | Bacteria | 1013 |
| 26 | Ga0068868_100013341 | 3300005338 | Bacteria | 6024 |
| 27 | Ga0068868_100153282 | 3300005338 | Bacteria | 1899 |
| 28 | Ga0068868_100165063 | 3300005338 | Bacteria | 1831 |
| 29 | Ga0070660_100107025 | 3300005339 | Bacteria | 2221 |
| 30 | Ga0070689_100047046 | 3300005340 | Bacteria | 3326 |
| 31 | Ga0070689_100060810 | 3300005340 | Unclassified | 2937 |
| 32 | Ga0070689_100102803 | 3300005340 | Bacteria | 2264 |
| 33 | Ga0070689_100274819 | 3300005340 | Unclassified | 1396 |
| 34 | Ga0070689_101100992 | 3300005340 | Unclassified | 710 |
| 35 | Ga0070687_100100166 | 3300005343 | Unclassified | 1621 |
| 36 | Ga0070687_100221629 | 3300005343 | Unclassified | 1159 |
| 37 | Ga0070687_100777938 | 3300005343 | Bacteria | 676 |
| 38 | Ga0070661_100015507 | 3300005344 | Bacteria | 5378 |
| 39 | Ga0070661_100091238 | 3300005344 | Unclassified | 2256 |
| 40 | Ga0070692_10088275 | 3300005345 | Unclassified | 1682 |
| 41 | Ga0070669_100037556 | 3300005353 | Unclassified | 3513 |
| 42 | Ga0070669_100232762 | 3300005353 | Unclassified | 1461 |
| 43 | Ga0070675_100104539 | 3300005354 | Bacteria | 2389 |
| 44 | Ga0070675_100121807 | 3300005354 | Unclassified | 2216 |
| 45 | Ga0070675_100376546 | 3300005354 | Bacteria | 1263 |
| 46 | Ga0070675_100631732 | 3300005354 | Unclassified | 972 |
| 47 | Ga0070671_100059512 | 3300005355 | Bacteria | 3179 |
| 48 | Ga0070671_100149966 | 3300005355 | Unclassified | 1969 |
| 49 | Ga0070671_100576377 | 3300005355 | Unclassified | 972 |
| 50 | Ga0070671_100774538 | 3300005355 | Unclassified | 835 |
| 51 | Ga0070673_100262809 | 3300005364 | Bacteria | 1508 |
| 52 | Ga0070673_100317345 | 3300005364 | Unclassified | 1376 |
| 53 | Ga0070673_100606311 | 3300005364 | Bacteria | 999 |
| 54 | Ga0070688_100188849 | 3300005365 | Unclassified | 1434 |
| 55 | Ga0070688_100290773 | 3300005365 | Bacteria | 1178 |
| 56 | Ga0070688_100510778 | 3300005365 | Bacteria | 908 |
| 57 | Ga0070659_100009513 | 3300005366 | Bacteria | 7140 |
| 58 | Ga0070659_100074084 | 3300005366 | Unclassified | 2712 |
| 59 | Ga0070667_100051136 | 3300005367 | Bacteria | 3483 |
| 60 | Ga0070667_100063109 | 3300005367 | Bacteria | 3139 |
| 61 | Ga0070701_10062602 | 3300005438 | Unclassified | 1966 |
| 62 | Ga0070701_10393801 | 3300005438 | Unclassified | 876 |
| 63 | Ga0070705_100295113 | 3300005440 | Unclassified | 1159 |
| 64 | Ga0070705_100486330 | 3300005440 | Unclassified | 934 |
| 65 | Ga0070705_100793752 | 3300005440 | Unclassified | 753 |
| 66 | Ga0070700_100281447 | 3300005441 | Bacteria | 1206 |
| 67 | Ga0070694_100169439 | 3300005444 | Bacteria | 1607 |
| 68 | Ga0070694_100330727 | 3300005444 | Bacteria | 1175 |
| 69 | Ga0070708_100002362 | 3300005445 | Bacteria | 14604 |
| 70 | Ga0070708_100556891 | 3300005445 | Bacteria | 1081 |
| 71 | Ga0070708_100889164 | 3300005445 | Bacteria | 836 |
| 72 | Ga0070708_101297387 | 3300005445 | Unclassified | 680 |
| 73 | Ga0070663_100027108 | 3300005455 | Bacteria | 3886 |
| 74 | Ga0070663_100275838 | 3300005455 | Bacteria | 1338 |
| 75 | Ga0070678_100025325 | 3300005456 | Bacteria | 3989 |
| 76 | Ga0070662_100015205 | 3300005457 | Bacteria | 5151 |
| 77 | Ga0070662_100030646 | 3300005457 | Unclassified | 3766 |
| 78 | Ga0070662_100402815 | 3300005457 | Bacteria | 1129 |
| 79 | Ga0070681_10008869 | 3300005458 | Bacteria | 9881 |
| 80 | Ga0070681_10061857 | 3300005458 | Unclassified | 3718 |
| 81 | Ga0068867_100244456 | 3300005459 | Bacteria | 1457 |
| 82 | Ga0070685_10001437 | 3300005466 | Bacteria | 12492 |
| 83 | Ga0070706_100021984 | 3300005467 | Bacteria | 5874 |
| 84 | Ga0070706_100163263 | 3300005467 | Bacteria | 2080 |
| 85 | Ga0070707_100026729 | 3300005468 | Bacteria | 5482 |
| 86 | Ga0070707_100045611 | 3300005468 | Bacteria | 4195 |
| 87 | Ga0070707_100655844 | 3300005468 | Bacteria | 1012 |
| 88 | Ga0070707_101256420 | 3300005468 | Unclassified | 707 |
| 89 | Ga0070707_101486276 | 3300005468 | Unclassified | 644 |
| 90 | Ga0070698_100006142 | 3300005471 | Bacteria | 13081 |
| 91 | Ga0070698_100101538 | 3300005471 | Bacteria | 2848 |
| 92 | Ga0070698_100135054 | 3300005471 | Bacteria | 2421 |
| 93 | Ga0070698_100620836 | 3300005471 | Bacteria | 1022 |
| 94 | Ga0070698_101009736 | 3300005471 | Unclassified | 779 |
| 95 | Ga0070699_100009745 | 3300005518 | Bacteria | 8311 |
| 96 | Ga0070699_100067001 | 3300005518 | Bacteria | 3118 |
| 97 | Ga0070699_101503512 | 3300005518 | Bacteria | 617 |
| 98 | Ga0070679_100075327 | 3300005530 | Bacteria | 3364 |
| 99 | Ga0070679_100123172 | 3300005530 | Bacteria | 2576 |
| 100 | Ga0070684_100164617 | 3300005535 | Bacteria | 2013 |
| 101 | Ga0070684_100255905 | 3300005535 | Unclassified | 1601 |
| 102 | Ga0070684_100723101 | 3300005535 | Bacteria | 929 |
| 103 | Ga0070684_101759168 | 3300005535 | Unclassified | 585 |
| 104 | Ga0070697_100005043 | 3300005536 | Bacteria | 10141 |
| 105 | Ga0070697_100026034 | 3300005536 | Bacteria | 4667 |
| 106 | Ga0068853_100084583 | 3300005539 | Bacteria | 2780 |
| 107 | Ga0070672_100124299 | 3300005543 | Bacteria | 2115 |
| 108 | Ga0070672_100271107 | 3300005543 | Bacteria | 1433 |
| 109 | Ga0070672_100274378 | 3300005543 | Unclassified | 1424 |
| 110 | Ga0070672_100632582 | 3300005543 | Unclassified | 934 |
| 111 | Ga0070686_100033086 | 3300005544 | Unclassified | 3175 |
| 112 | Ga0070686_100375550 | 3300005544 | Unclassified | 1075 |
| 113 | Ga0070695_100200921 | 3300005545 | Unclassified | 1424 |
| 114 | Ga0070696_100009796 | 3300005546 | Bacteria | 6411 |
| 115 | Ga0070696_100911431 | 3300005546 | Bacteria | 730 |
| 116 | Ga0070693_100033960 | 3300005547 | Bacteria | 2820 |
| 117 | Ga0070665_100010635 | 3300005548 | Bacteria | 9313 |
| 118 | Ga0070665_101439019 | 3300005548 | Unclassified | 698 |
| 119 | Ga0070704_100240720 | 3300005549 | Bacteria | 1481 |
| 120 | Ga0068855_100389361 | 3300005563 | Bacteria | 1529 |
| 121 | Ga0070664_100009190 | 3300005564 | Bacteria | 8025 |
| 122 | Ga0070664_100020375 | 3300005564 | Bacteria | 5461 |
| 123 | Ga0070664_100190670 | 3300005564 | Bacteria | 1826 |
| 124 | Ga0070664_100374476 | 3300005564 | Unclassified | 1299 |
| 125 | Ga0070664_100391968 | 3300005564 | Bacteria | 1269 |
| 126 | Ga0070664_100517125 | 3300005564 | Unclassified | 1101 |
| 127 | Ga0070664_100617053 | 3300005564 | Unclassified | 1006 |
| 128 | Ga0070664_101141841 | 3300005564 | Unclassified | 734 |
| 129 | Ga0068857_100005243 | 3300005577 | Bacteria | 11035 |
| 130 | Ga0068857_100099928 | 3300005577 | Bacteria | 2603 |
| 131 | Ga0068857_100148065 | 3300005577 | Bacteria | 2125 |
| 132 | Ga0068857_100713426 | 3300005577 | Unclassified | 953 |
| 133 | Ga0068854_100312963 | 3300005578 | Bacteria | 1274 |
| 134 | Ga0068854_101152973 | 3300005578 | Unclassified | 693 |
| 135 | Ga0068856_100151760 | 3300005614 | Bacteria | 2326 |
| 136 | Ga0068852_100515122 | 3300005616 | Unclassified | 1193 |
| 137 | Ga0068859_100052103 | 3300005617 | Bacteria | 4114 |
| 138 | Ga0068859_100429138 | 3300005617 | Bacteria | 1418 |
| 139 | Ga0068859_100471117 | 3300005617 | Unclassified | 1351 |
| 140 | Ga0068859_100746538 | 3300005617 | Unclassified | 1068 |
| 141 | Ga0068859_100795514 | 3300005617 | Unclassified | 1034 |
| 142 | Ga0068859_102749747 | 3300005617 | Unclassified | 540 |
| 143 | Ga0068864_100013610 | 3300005618 | Bacteria | 6744 |
| 144 | Ga0068864_100033480 | 3300005618 | Bacteria | 4368 |
| 145 | Ga0068866_10331427 | 3300005718 | Bacteria | 961 |
| 146 | Ga0068861_100786677 | 3300005719 | Unclassified | 892 |
| 147 | Ga0068851_10172058 | 3300005834 | Bacteria | 1196 |
| 148 | Ga0068851_10270622 | 3300005834 | Unclassified | 969 |
| 149 | Ga0068870_10004089 | 3300005840 | Bacteria | 6240 |
| 150 | Ga0068863_100143284 | 3300005841 | Unclassified | 2285 |
| 151 | Ga0068863_100480215 | 3300005841 | Bacteria | 1222 |
| 152 | Ga0068863_101890900 | 3300005841 | Bacteria | 607 |
| 153 | Ga0068858_100019828 | 3300005842 | Bacteria | 6287 |
| 154 | Ga0068858_100212350 | 3300005842 | Unclassified | 1831 |
| 155 | Ga0068858_101003772 | 3300005842 | Bacteria | 818 |
| 156 | Ga0068860_100038677 | 3300005843 | Bacteria | 4564 |
| 157 | Ga0068862_100082810 | 3300005844 | Bacteria | 2785 |
| 158 | Ga0068862_100159698 | 3300005844 | Unclassified | 2011 |
| 159 | Ga0068862_100201251 | 3300005844 | Bacteria | 1796 |
| 160 | Ga0068862_100246245 | 3300005844 | Bacteria | 1627 |
| 161 | Ga0068862_100252889 | 3300005844 | Bacteria | 1606 |
| 162 | Ga0068862_101088995 | 3300005844 | Bacteria | 794 |
| 163 | Ga0068862_101833618 | 3300005844 | Bacteria | 616 |
| 164 | Ga0081455_10006826 | 3300005937 | Bacteria | 12167 |
| 165 | Ga0081455_10012390 | 3300005937 | Bacteria | 8509 |
| 166 | Ga0081455_10058918 | 3300005937 | Bacteria | 3246 |
| 167 | Ga0081540_1011659 | 3300005983 | Bacteria | 5860 |
| 168 | Ga0081539_10000117 | 3300005985 | Bacteria | 185868 |
| 169 | Ga0070715_10258275 | 3300006163 | Bacteria | 914 |
| 170 | Ga0070716_100926609 | 3300006173 | Unclassified | 684 |
| 171 | Ga0070712_100246568 | 3300006175 | Unclassified | 1425 |
| 172 | Ga0070712_100289636 | 3300006175 | Bacteria | 1322 |
| 173 | Ga0075427_10006684 | 3300006194 | Bacteria | 1678 |
| 174 | Ga0097621_100000461 | 3300006237 | Bacteria | 28439 |
| 175 | Ga0097621_100860122 | 3300006237 | Bacteria | 843 |
| 176 | Ga0068871_100008387 | 3300006358 | Bacteria | 7430 |
| 177 | Ga0068871_100809454 | 3300006358 | Unclassified | 864 |
| 178 | Ga0075428_100009081 | 3300006844 | Bacteria | 11032 |
| 179 | Ga0075428_100176418 | 3300006844 | Unclassified | 2314 |
| 180 | Ga0075428_100177225 | 3300006844 | Bacteria | 2309 |
| 181 | Ga0075428_100205872 | 3300006844 | Unclassified | 2126 |
| 182 | Ga0075428_100914909 | 3300006844 | Unclassified | 930 |
| 183 | Ga0075428_101607020 | 3300006844 | Bacteria | 680 |
| 184 | Ga0075430_100005748 | 3300006846 | Bacteria | 10465 |
| 185 | Ga0075430_100030396 | 3300006846 | Unclassified | 4587 |
| 186 | Ga0075430_100207802 | 3300006846 | Bacteria | 1625 |
| 187 | Ga0075430_100233217 | 3300006846 | Bacteria | 1526 |
| 188 | Ga0075430_100683620 | 3300006846 | Unclassified | 846 |
| 189 | Ga0075430_100865933 | 3300006846 | Bacteria | 744 |
| 190 | Ga0075431_100027080 | 3300006847 | Bacteria | 5880 |
| 191 | Ga0075431_100029058 | 3300006847 | Bacteria | 5688 |
| 192 | Ga0075431_100049494 | 3300006847 | Bacteria | 4333 |
| 193 | Ga0075431_100246895 | 3300006847 | Bacteria | 1814 |
| 194 | Ga0075431_100271220 | 3300006847 | Bacteria | 1719 |
| 195 | Ga0075431_100348180 | 3300006847 | Bacteria | 1490 |
| 196 | Ga0075431_100452357 | 3300006847 | Bacteria | 1280 |
| 197 | Ga0075431_100454917 | 3300006847 | Bacteria | 1275 |
| 198 | Ga0075433_10006275 | 3300006852 | Bacteria | 9388 |
| 199 | Ga0075433_10992956 | 3300006852 | Unclassified | 731 |
| 200 | Ga0075434_100061135 | 3300006871 | Bacteria | 3747 |
| 201 | Ga0075434_100291323 | 3300006871 | Bacteria | 1652 |
| 202 | Ga0075434_100418171 | 3300006871 | Unclassified | 1362 |
| 203 | Ga0075429_100004387 | 3300006880 | Bacteria | 12114 |
| 204 | Ga0075429_100040852 | 3300006880 | Unclassified | 4038 |
| 205 | Ga0075429_100195002 | 3300006880 | Bacteria | 1774 |
| 206 | Ga0075429_100271803 | 3300006880 | Bacteria | 1484 |
| 207 | Ga0068865_100002248 | 3300006881 | Bacteria | 11359 |
| 208 | Ga0068865_100031385 | 3300006881 | Unclassified | 3543 |
| 209 | Ga0075436_100131319 | 3300006914 | Bacteria | 1756 |
| 210 | Ga0097620_100052106 | 3300006931 | Bacteria | 4114 |
| 211 | Ga0097620_100396621 | 3300006931 | Bacteria | 1476 |
| 212 | Ga0097620_100429137 | 3300006931 | Bacteria | 1418 |
| 213 | Ga0097620_100471107 | 3300006931 | Unclassified | 1351 |
| 214 | Ga0097620_100746543 | 3300006931 | Unclassified | 1068 |
| 215 | Ga0097620_100795451 | 3300006931 | Unclassified | 1034 |
| 216 | Ga0097620_102749660 | 3300006931 | Unclassified | 540 |
| 217 | Ga0099795_10279437 | 3300007788 | Bacteria | 728 |
| 218 | Ga0105251_10440818 | 3300009011 | Unclassified | 603 |
| 219 | Ga0105240_10821777 | 3300009093 | Unclassified | 1005 |
| 220 | Ga0111539_10115305 | 3300009094 | Bacteria | 3151 |
| 221 | Ga0111539_10352984 | 3300009094 | Bacteria | 1711 |
| 222 | Ga0111539_12774083 | 3300009094 | Unclassified | 568 |
| 223 | Ga0105245_10043389 | 3300009098 | Bacteria | 4011 |
| 224 | Ga0105245_10322342 | 3300009098 | Unclassified | 1522 |
| 225 | Ga0105245_11418272 | 3300009098 | Unclassified | 745 |
| 226 | Ga0105245_12042121 | 3300009098 | Unclassified | 627 |
| 227 | Ga0105247_10002665 | 3300009101 | Bacteria | 12014 |
| 228 | Ga0105247_11404362 | 3300009101 | Unclassified | 565 |
| 229 | Ga0114129_10033911 | 3300009147 | Bacteria | 7211 |
| 230 | Ga0114129_10068947 | 3300009147 | Bacteria | 4930 |
| 231 | Ga0114129_10200796 | 3300009147 | Bacteria | 2701 |
| 232 | Ga0114129_10569549 | 3300009147 | Bacteria | 1471 |
| 233 | Ga0114129_10869763 | 3300009147 | Bacteria | 1144 |
| 234 | Ga0114129_11578779 | 3300009147 | Unclassified | 804 |
| 235 | Ga0114129_12312996 | 3300009147 | Unclassified | 645 |
| 236 | Ga0105243_10117512 | 3300009148 | Bacteria | 2236 |
| 237 | Ga0105243_11025661 | 3300009148 | Bacteria | 829 |
| 238 | Ga0105243_11856038 | 3300009148 | Unclassified | 635 |
| 239 | Ga0105241_10730704 | 3300009174 | Unclassified | 906 |
| 240 | Ga0105241_11136388 | 3300009174 | Unclassified | 737 |
| 241 | Ga0105242_10023016 | 3300009176 | Bacteria | 4908 |
| 242 | Ga0105242_10067997 | 3300009176 | Bacteria | 2946 |
| 243 | Ga0105248_10005035 | 3300009177 | Bacteria | 14596 |
| 244 | Ga0105248_10264697 | 3300009177 | Bacteria | 1935 |
| 245 | Ga0105248_10363338 | 3300009177 | Unclassified | 1630 |
| 246 | Ga0105248_10435448 | 3300009177 | Bacteria | 1477 |
| 247 | Ga0105248_10771458 | 3300009177 | Bacteria | 1085 |
| 248 | Ga0105238_10754035 | 3300009551 | Unclassified | 987 |
| 249 | Ga0105249_10294190 | 3300009553 | Unclassified | 1626 |
| 250 | Ga0105249_10404667 | 3300009553 | Unclassified | 1396 |
| 251 | Ga0105249_10898493 | 3300009553 | Unclassified | 953 |
| 252 | Ga0105249_11084022 | 3300009553 | Unclassified | 871 |
| 253 | Ga0105246_10177907 | 3300011119 | Bacteria | 1635 |
| 254 | Ga0157371_10939699 | 3300013102 | Unclassified | 657 |
| 255 | Ga0157369_10434064 | 3300013105 | Bacteria | 1361 |
| 256 | Ga0157374_10029195 | 3300013296 | Bacteria | 4990 |
| 257 | Ga0157374_10134480 | 3300013296 | Bacteria | 2396 |
| 258 | Ga0157378_10000609 | 3300013297 | Bacteria | 33638 |
| 259 | Ga0157378_10706805 | 3300013297 | Unclassified | 1028 |
| 260 | Ga0157378_10876757 | 3300013297 | Unclassified | 927 |
| 261 | Ga0157378_12472030 | 3300013297 | Bacteria | 571 |
| 262 | Ga0163162_10038129 | 3300013306 | Bacteria | 4796 |
| 263 | Ga0163162_10463704 | 3300013306 | Bacteria | 1398 |
| 264 | Ga0157372_11355128 | 3300013307 | Unclassified | 821 |
| 265 | Ga0157375_10266432 | 3300013308 | Bacteria | 1875 |
| 266 | Ga0157375_10279125 | 3300013308 | Unclassified | 1834 |
| 267 | Ga0157375_10414673 | 3300013308 | Bacteria | 1513 |
| 268 | Ga0157375_11020165 | 3300013308 | Unclassified | 966 |
| 269 | Ga0163163_10005970 | 3300014325 | Unclassified | 10594 |
| 270 | Ga0163163_10007410 | 3300014325 | Bacteria | 9688 |
| 271 | Ga0163163_10151297 | 3300014325 | Unclassified | 2364 |
| 272 | Ga0163163_10174204 | 3300014325 | Bacteria | 2198 |
| 273 | Ga0163163_10801092 | 3300014325 | Bacteria | 1005 |
| 274 | Ga0157380_10001729 | 3300014326 | Bacteria | 14389 |
| 275 | Ga0157380_10022247 | 3300014326 | Bacteria | 4768 |
| 276 | Ga0157380_11174112 | 3300014326 | Bacteria | 810 |
| 277 | Ga0182008_10001997 | 3300014497 | Bacteria | 13095 |
| 278 | Ga0157377_10309728 | 3300014745 | Unclassified | 1045 |
| 279 | Ga0157379_11758953 | 3300014968 | Bacteria | 608 |
| 280 | Ga0157376_10146107 | 3300014969 | Bacteria | 2127 |
| 281 | Ga0163161_10461136 | 3300017792 | Bacteria | 1029 |
| 282 | Ga0213876_10000052 | 3300021384 | Bacteria | 144098 |
| 283 | Ga0228598_1007619 | 3300024227 | Bacteria | 2199 |
| 284 | Ga0207697_10063038 | 3300025315 | Unclassified | 1545 |
| 285 | Ga0207697_10170081 | 3300025315 | Unclassified | 953 |
| 286 | Ga0207642_10202583 | 3300025899 | Bacteria | 1097 |
| 287 | Ga0207710_10027620 | 3300025900 | Unclassified | 2459 |
| 288 | Ga0207688_10243147 | 3300025901 | Bacteria | 1089 |
| 289 | Ga0207680_10154251 | 3300025903 | Bacteria | 1534 |
| 290 | Ga0207680_10539702 | 3300025903 | Unclassified | 832 |
| 291 | Ga0207647_10101594 | 3300025904 | Bacteria | 1706 |
| 292 | Ga0207645_10032316 | 3300025907 | Bacteria | 3363 |
| 293 | Ga0207645_10050823 | 3300025907 | Unclassified | 2648 |
| 294 | Ga0207643_10007117 | 3300025908 | Bacteria | 6000 |
| 295 | Ga0207643_10255949 | 3300025908 | Bacteria | 1080 |
| 296 | Ga0207684_10043569 | 3300025910 | Bacteria | 3805 |
| 297 | Ga0207684_10090783 | 3300025910 | Bacteria | 2603 |
| 298 | Ga0207654_10800030 | 3300025911 | Unclassified | 681 |
| 299 | Ga0207707_10007014 | 3300025912 | Bacteria | 9826 |
| 300 | Ga0207707_10032991 | 3300025912 | Bacteria | 4533 |
| 301 | Ga0207693_10258511 | 3300025915 | Bacteria | 1365 |
| 302 | Ga0207662_10038421 | 3300025918 | Bacteria | 2805 |
| 303 | Ga0207662_10079257 | 3300025918 | Unclassified | 2000 |
| 304 | Ga0207662_10365714 | 3300025918 | Unclassified | 972 |
| 305 | Ga0207662_10579869 | 3300025918 | Unclassified | 779 |
| 306 | Ga0207657_10053750 | 3300025919 | Bacteria | 3487 |
| 307 | Ga0207657_10424103 | 3300025919 | Bacteria | 1045 |
| 308 | Ga0207649_10216620 | 3300025920 | Bacteria | 1361 |
| 309 | Ga0207649_10389750 | 3300025920 | Unclassified | 1040 |
| 310 | Ga0207652_10052238 | 3300025921 | Bacteria | 3507 |
| 311 | Ga0207652_10081517 | 3300025921 | Bacteria | 2830 |
| 312 | Ga0207646_10019015 | 3300025922 | Bacteria | 6395 |
| 313 | Ga0207646_10029914 | 3300025922 | Bacteria | 4944 |
| 314 | Ga0207646_10499158 | 3300025922 | Bacteria | 1096 |
| 315 | Ga0207681_10000898 | 3300025923 | Bacteria | 19449 |
| 316 | Ga0207681_10064974 | 3300025923 | Bacteria | 2521 |
| 317 | Ga0207681_10191086 | 3300025923 | Unclassified | 1566 |
| 318 | Ga0207681_10722557 | 3300025923 | Bacteria | 829 |
| 319 | Ga0207694_10000042 | 3300025924 | Bacteria | 177961 |
| 320 | Ga0207650_10002300 | 3300025925 | Bacteria | 13319 |
| 321 | Ga0207650_10243936 | 3300025925 | Bacteria | 1452 |
| 322 | Ga0207650_11166698 | 3300025925 | Unclassified | 656 |
| 323 | Ga0207650_11246536 | 3300025925 | Bacteria | 633 |
| 324 | Ga0207659_10291514 | 3300025926 | Unclassified | 1337 |
| 325 | Ga0207659_10572743 | 3300025926 | Unclassified | 961 |
| 326 | Ga0207659_11092619 | 3300025926 | Bacteria | 686 |
| 327 | Ga0207687_10020075 | 3300025927 | Bacteria | 4431 |
| 328 | Ga0207687_10169391 | 3300025927 | Bacteria | 1683 |
| 329 | Ga0207687_10592194 | 3300025927 | Unclassified | 934 |
| 330 | Ga0207644_10130569 | 3300025931 | Unclassified | 1923 |
| 331 | Ga0207644_10248288 | 3300025931 | Unclassified | 1419 |
| 332 | Ga0207644_10291481 | 3300025931 | Bacteria | 1313 |
| 333 | Ga0207690_10057013 | 3300025932 | Unclassified | 2638 |
| 334 | Ga0207706_10062383 | 3300025933 | Bacteria | 3282 |
| 335 | Ga0207706_10063208 | 3300025933 | Unclassified | 3260 |
| 336 | Ga0207706_10259072 | 3300025933 | Bacteria | 1519 |
| 337 | Ga0207706_10454230 | 3300025933 | Unclassified | 1108 |
| 338 | Ga0207686_10020959 | 3300025934 | Bacteria | 3743 |
| 339 | Ga0207686_10342049 | 3300025934 | Bacteria | 1124 |
| 340 | Ga0207709_10069895 | 3300025935 | Unclassified | 2224 |
| 341 | Ga0207709_10141655 | 3300025935 | Unclassified | 1653 |
| 342 | Ga0207709_11534906 | 3300025935 | Unclassified | 553 |
| 343 | Ga0207670_10030994 | 3300025936 | Bacteria | 3420 |
| 344 | Ga0207670_10073295 | 3300025936 | Bacteria | 2374 |
| 345 | Ga0207670_10279759 | 3300025936 | Bacteria | 1300 |
| 346 | Ga0207670_10286496 | 3300025936 | Unclassified | 1285 |
| 347 | Ga0207669_10911037 | 3300025937 | Bacteria | 735 |
| 348 | Ga0207704_10015113 | 3300025938 | Unclassified | 3924 |
| 349 | Ga0207704_10280380 | 3300025938 | Bacteria | 1266 |
| 350 | Ga0207691_10094714 | 3300025940 | Bacteria | 2671 |
| 351 | Ga0207691_10114712 | 3300025940 | Bacteria | 2393 |
| 352 | Ga0207691_10186392 | 3300025940 | Unclassified | 1811 |
| 353 | Ga0207691_10332476 | 3300025940 | Unclassified | 1302 |
| 354 | Ga0207691_10363245 | 3300025940 | Unclassified | 1238 |
| 355 | Ga0207711_10081702 | 3300025941 | Unclassified | 2824 |
| 356 | Ga0207711_10170029 | 3300025941 | Unclassified | 1977 |
| 357 | Ga0207711_10219154 | 3300025941 | Bacteria | 1740 |
| 358 | Ga0207711_10262998 | 3300025941 | Bacteria | 1586 |
| 359 | Ga0207711_10780137 | 3300025941 | Unclassified | 890 |
| 360 | Ga0207689_10035542 | 3300025942 | Unclassified | 4139 |
| 361 | Ga0207689_10285593 | 3300025942 | Bacteria | 1366 |
| 362 | Ga0207689_10326270 | 3300025942 | Bacteria | 1274 |
| 363 | Ga0207689_10582240 | 3300025942 | Unclassified | 941 |
| 364 | Ga0207661_10150527 | 3300025944 | Bacteria | 2011 |
| 365 | Ga0207661_10318204 | 3300025944 | Unclassified | 1398 |
| 366 | Ga0207661_10403670 | 3300025944 | Bacteria | 1240 |
| 367 | Ga0207679_10019141 | 3300025945 | Bacteria | 4595 |
| 368 | Ga0207679_10020530 | 3300025945 | Bacteria | 4459 |
| 369 | Ga0207679_10065214 | 3300025945 | Bacteria | 2724 |
| 370 | Ga0207679_10535199 | 3300025945 | Unclassified | 1049 |
| 371 | Ga0207679_10837902 | 3300025945 | Unclassified | 839 |
| 372 | Ga0207667_11403903 | 3300025949 | Unclassified | 672 |
| 373 | Ga0207651_10312813 | 3300025960 | Bacteria | 1310 |
| 374 | Ga0207651_10548441 | 3300025960 | Bacteria | 1005 |
| 375 | Ga0207712_10014721 | 3300025961 | Bacteria | 5037 |
| 376 | Ga0207712_10093958 | 3300025961 | Unclassified | 2214 |
| 377 | Ga0207712_10771557 | 3300025961 | Unclassified | 843 |
| 378 | Ga0207712_11392114 | 3300025961 | Unclassified | 628 |
| 379 | Ga0207668_10009418 | 3300025972 | Bacteria | 5854 |
| 380 | Ga0207640_10792167 | 3300025981 | Unclassified | 820 |
| 381 | Ga0207658_10032114 | 3300025986 | Bacteria | 3734 |
| 382 | Ga0207658_10367618 | 3300025986 | Bacteria | 1257 |
| 383 | Ga0207677_10255683 | 3300026023 | Unclassified | 1425 |
| 384 | Ga0207677_10341351 | 3300026023 | Bacteria | 1251 |
| 385 | Ga0207677_10519254 | 3300026023 | Unclassified | 1033 |
| 386 | Ga0207703_10031360 | 3300026035 | Bacteria | 4202 |
| 387 | Ga0207703_10045433 | 3300026035 | Bacteria | 3533 |
| 388 | Ga0207703_10254243 | 3300026035 | Unclassified | 1585 |
| 389 | Ga0207639_10028871 | 3300026041 | Bacteria | 4055 |
| 390 | Ga0207639_10952988 | 3300026041 | Unclassified | 803 |
| 391 | Ga0207678_10263524 | 3300026067 | Bacteria | 1477 |
| 392 | Ga0207678_10551322 | 3300026067 | Unclassified | 1008 |
| 393 | Ga0207708_10050353 | 3300026075 | Unclassified | 3170 |
| 394 | Ga0207708_10411684 | 3300026075 | Bacteria | 1120 |
| 395 | Ga0207702_10295586 | 3300026078 | Bacteria | 1536 |
| 396 | Ga0207641_10100278 | 3300026088 | Unclassified | 2550 |
| 397 | Ga0207641_10149824 | 3300026088 | Unclassified | 2112 |
| 398 | Ga0207641_10625030 | 3300026088 | Bacteria | 1056 |
| 399 | Ga0207648_10134588 | 3300026089 | Bacteria | 2177 |
| 400 | Ga0207648_10212564 | 3300026089 | Unclassified | 1717 |
| 401 | Ga0207648_10256901 | 3300026089 | Bacteria | 1558 |
| 402 | Ga0207648_11710160 | 3300026089 | Unclassified | 591 |
| 403 | Ga0207676_11409387 | 3300026095 | Bacteria | 693 |
| 404 | Ga0207674_10001906 | 3300026116 | Bacteria | 26496 |
| 405 | Ga0207674_10007618 | 3300026116 | Bacteria | 12611 |
| 406 | Ga0207674_10191906 | 3300026116 | Unclassified | 1993 |
| 407 | Ga0207674_11063015 | 3300026116 | Unclassified | 779 |
| 408 | Ga0207675_100231569 | 3300026118 | Bacteria | 1783 |
| 409 | Ga0207675_100283668 | 3300026118 | Unclassified | 1610 |
| 410 | Ga0207675_101168407 | 3300026118 | Unclassified | 790 |
| 411 | Ga0207683_10079407 | 3300026121 | Bacteria | 2909 |
| 412 | Ga0207683_10266931 | 3300026121 | Bacteria | 1563 |
| 413 | Ga0207698_10077346 | 3300026142 | Bacteria | 2668 |
| 414 | Ga0207698_11161582 | 3300026142 | Unclassified | 786 |
| 415 | Ga0207428_10157638 | 3300027907 | Unclassified | 1725 |
| 416 | Ga0268266_10044946 | 3300028379 | Bacteria | 3776 |
| 417 | Ga0268265_10099319 | 3300028380 | Bacteria | 2346 |
| 418 | Ga0268265_10226505 | 3300028380 | Bacteria | 1640 |
| 419 | Ga0268265_10238283 | 3300028380 | Unclassified | 1603 |
| 420 | Ga0268265_10879451 | 3300028380 | Unclassified | 878 |
| 421 | Ga0268265_11320204 | 3300028380 | Bacteria | 722 |
| 422 | Ga0268265_11671653 | 3300028380 | Bacteria | 642 |
| 423 | Ga0268264_10343275 | 3300028381 | Bacteria | 1419 |
| 424 | Ga0268264_10735017 | 3300028381 | Unclassified | 982 |
| 425 | Ga0265319_1006777 | 3300028563 | Bacteria | 5247 |
| 426 | Ga0265318_10006297 | 3300028577 | Bacteria | 5481 |
| 427 | Ga0316182_1425907 | 3300030745 | Bacteria | 573 |
| 428 | Ga0265320_10001947 | 3300031240 | Bacteria | 14572 |
| 429 | Ga0265329_10000949 | 3300031242 | Bacteria | 14584 |
| 430 | Ga0265340_10014477 | 3300031247 | Bacteria | 4117 |
| 431 | Ga0265339_10053113 | 3300031249 | Bacteria | 2204 |
| 432 | Ga0265331_10001914 | 3300031250 | Bacteria | 14585 |
| 433 | Ga0265316_10214960 | 3300031344 | Bacteria | 1420 |
| 434 | Ga0307408_100034362 | 3300031548 | Bacteria | 3551 |
| 435 | Ga0307408_100193277 | 3300031548 | Bacteria | 1641 |
| 436 | Ga0307408_100434739 | 3300031548 | Bacteria | 1135 |
| 437 | Ga0307408_101333004 | 3300031548 | Unclassified | 674 |
| 438 | Ga0265313_10026529 | 3300031595 | Bacteria | 3050 |
| 439 | Ga0265314_10055316 | 3300031711 | Bacteria | 2740 |
| 440 | Ga0265342_10006879 | 3300031712 | Bacteria | 8404 |
| 441 | Ga0307405_10050906 | 3300031731 | Unclassified | 2568 |
| 442 | Ga0307405_10058491 | 3300031731 | Unclassified | 2426 |
| 443 | Ga0307405_10193243 | 3300031731 | Unclassified | 1472 |
| 444 | Ga0307405_10897563 | 3300031731 | Unclassified | 749 |
| 445 | Ga0307405_11401125 | 3300031731 | Unclassified | 611 |
| 446 | Ga0307413_10195476 | 3300031824 | Unclassified | 1456 |
| 447 | Ga0307413_10284700 | 3300031824 | Unclassified | 1245 |
| 448 | Ga0307413_10496054 | 3300031824 | Unclassified | 979 |
| 449 | Ga0307413_10747544 | 3300031824 | Unclassified | 817 |
| 450 | Ga0307413_10819276 | 3300031824 | Bacteria | 784 |
| 451 | Ga0307410_10080285 | 3300031852 | Unclassified | 2288 |
| 452 | Ga0307410_10156127 | 3300031852 | Bacteria | 1704 |
| 453 | Ga0307410_10270891 | 3300031852 | Bacteria | 1328 |
| 454 | Ga0307410_10712884 | 3300031852 | Bacteria | 847 |
| 455 | Ga0307410_11021947 | 3300031852 | Bacteria | 714 |
| 456 | Ga0307406_10036634 | 3300031901 | Unclassified | 3024 |
| 457 | Ga0307406_10061512 | 3300031901 | Bacteria | 2425 |
| 458 | Ga0307406_10412449 | 3300031901 | Bacteria | 1074 |
| 459 | Ga0307407_10124925 | 3300031903 | Bacteria | 1637 |
| 460 | Ga0307407_10435432 | 3300031903 | Bacteria | 948 |
| 461 | Ga0307407_10585918 | 3300031903 | Unclassified | 829 |
| 462 | Ga0307407_10625738 | 3300031903 | Unclassified | 804 |
| 463 | Ga0307409_100054196 | 3300031995 | Unclassified | 3087 |
| 464 | Ga0307409_100127824 | 3300031995 | Unclassified | 2165 |
| 465 | Ga0307416_100005840 | 3300032002 | Bacteria | 7634 |
| 466 | Ga0307416_100092072 | 3300032002 | Bacteria | 2606 |
| 467 | Ga0307416_100237192 | 3300032002 | Unclassified | 1764 |
| 468 | Ga0307416_100387439 | 3300032002 | Bacteria | 1430 |
| 469 | Ga0307416_100565663 | 3300032002 | Unclassified | 1212 |
| 470 | Ga0307416_100697275 | 3300032002 | Unclassified | 1104 |
| 471 | Ga0307411_10169191 | 3300032005 | Bacteria | 1646 |
| 472 | Ga0307411_10658422 | 3300032005 | Bacteria | 907 |
| 473 | Ga0307411_11862113 | 3300032005 | Unclassified | 559 |
| 474 | Ga0307415_100070417 | 3300032126 | Unclassified | 2456 |
| 475 | Ga0307415_100093595 | 3300032126 | Unclassified | 2183 |
| 476 | Ga0307415_100190305 | 3300032126 | Bacteria | 1619 |
| 477 | Ga0307415_100751182 | 3300032126 | Unclassified | 885 |
| 478 | Ga0373959_0000079 | 3300034820 | Bacteria | 21563 |
| 479 | Ga0373936_0199485 | 3300035113 | Unclassified | 883 |
| 480 | Ga0373943_0075022 | 3300035170 | Bacteria | 1721 |
| 481 | Ga0373943_0173065 | 3300035170 | Bacteria | 1182 |
| 482 | Ga0373927_0164208 | 3300035695 | Bacteria | 1455 |
| 483 | Ga0373937_0132304 | 3300036401 | Bacteria | 2330 |
| 484 | Ga0373925_0032294 | 3300037068 | Bacteria | 3853 |
| 485 | Ga0373925_0119633 | 3300037068 | Bacteria | 2043 |
| 486 | Ga0395900_0966510 | 3300037418 | Unclassified | 773 |
| 487 | Ga0395905_0709430 | 3300037471 | Unclassified | 908 |
| 488 | Ga0395905_1297373 | 3300037471 | Unclassified | 632 |
| 489 | Ga0242420_044323 | 3300038996 | Bacteria | 856 |
| 490 | Ga0436365_0406589 | 3300039437 | Bacteria | 138542 |
| 491 | Ga0436365_1764576 | 3300039437 | Bacteria | 1230 |
| 492 | Ga0439435_0042661 | 3300042436 | Bacteria | 1274 |
| 493 | Ga0439460_0237759 | 3300042461 | Bacteria | 627 |
| 494 | Ga0450893_0071512 | 3300042532 | Bacteria | 675 |
| 495 | Ga0453684_1147603 | 3300044712 | Bacteria | 818 |
| 496 | Ga0451576_0000338 | 3300045051 | Bacteria | 112906 |
| 497 | Ga0451576_0137139 | 3300045051 | Bacteria | 2552 |
| 498 | Ga0451576_0286278 | 3300045051 | Bacteria | 1723 |
| 499 | Ga0451576_0483239 | 3300045051 | Bacteria | 1301 |
| 500 | Ga0466958_0032814 | 3300045836 | Bacteria | 3091 |
| 501 | Ga0495629_0546627 | 3300046459 | Unclassified | 778 |
| 502 | Ga0495651_0001811 | 3300046462 | Bacteria | 16494 |
| 503 | Ga0495651_0157712 | 3300046462 | Bacteria | 1629 |
| 504 | Ga0495653_0389415 | 3300046463 | Unclassified | 888 |
| 505 | Ga0495639_0018207 | 3300046475 | Bacteria | 3056 |
| 506 | Ga0495639_0022195 | 3300046475 | Bacteria | 2783 |
| 507 | Ga0495639_0284761 | 3300046475 | Bacteria | 822 |
| 508 | Ga0495662_0022976 | 3300046476 | Unclassified | 3011 |
| 509 | Ga0495664_0055043 | 3300046477 | Bacteria | 2367 |
| 510 | Ga0495594_0024934 | 3300046499 | Bacteria | 3213 |
| 511 | Ga0495594_0113904 | 3300046499 | Unclassified | 1526 |
| 512 | Ga0495594_0131444 | 3300046499 | Bacteria | 1418 |
| 513 | Ga0495608_0060802 | 3300046511 | Unclassified | 2486 |
| 514 | Ga0495618_0008177 | 3300046514 | Bacteria | 6336 |
| 515 | Ga0495628_0154067 | 3300046516 | Unclassified | 1749 |
| 516 | Ga0495630_0003087 | 3300046517 | Bacteria | 11556 |
| 517 | Ga0495630_0022090 | 3300046517 | Bacteria | 4701 |
| 518 | Ga0495630_0113793 | 3300046517 | Bacteria | 2050 |
| 519 | Ga0495666_0263333 | 3300046526 | Bacteria | 784 |
| 520 | Ga0495652_0308398 | 3300046529 | Bacteria | 1148 |
| 521 | Ga0495665_0010993 | 3300046531 | Bacteria | 4897 |
| 522 | Ga0495665_0068922 | 3300046531 | Bacteria | 1865 |
| 523 | Ga0495640_0031975 | 3300046533 | Bacteria | 3752 |
| 524 | Ga0495640_0058754 | 3300046533 | Bacteria | 2622 |
| 525 | Ga0495640_0105521 | 3300046533 | Bacteria | 1846 |
| 526 | Ga0495586_0026269 | 3300046535 | Unclassified | 3115 |
| 527 | Ga0495586_0209484 | 3300046535 | Unclassified | 1106 |
| 528 | Ga0495586_0287184 | 3300046535 | Bacteria | 942 |
| 529 | Ga0495645_0046224 | 3300046543 | Bacteria | 3173 |
| 530 | Ga0495645_0193905 | 3300046543 | Unclassified | 1382 |
| 531 | Ga0495622_0214222 | 3300046557 | Unclassified | 855 |
| 532 | Ga0495635_0008012 | 3300046663 | Bacteria | 7381 |
| 533 | Ga0495588_0008279 | 3300046674 | Bacteria | 4764 |
| 534 | Ga0495599_0601534 | 3300046678 | Bacteria | 640 |
| 535 | Ga0495647_0035786 | 3300046681 | Bacteria | 1866 |
| 536 | Ga0495647_0088266 | 3300046681 | Unclassified | 1267 |
| 537 | Ga0495647_0167023 | 3300046681 | Bacteria | 951 |
| 538 | Ga0495658_0025177 | 3300046683 | Unclassified | 3178 |
| 539 | Ga0495658_0028304 | 3300046683 | Bacteria | 3024 |
| 540 | Ga0495613_0150844 | 3300046689 | Bacteria | 1658 |
| 541 | Ga0495613_0387835 | 3300046689 | Unclassified | 954 |
| 542 | Ga0495613_0542307 | 3300046689 | Unclassified | 779 |
| 543 | Ga0495600_0040605 | 3300046809 | Bacteria | 3031 |
| 544 | Ga0495600_0188226 | 3300046809 | Unclassified | 1328 |
| 545 | Ga0495581_0044420 | 3300047315 | Unclassified | 2569 |
| 546 | Ga0495581_0052636 | 3300047315 | Bacteria | 2351 |
| 547 | Ga0495674_0096593 | 3300047319 | Bacteria | 2518 |
| 548 | Ga0495680_0002068 | 3300047322 | Bacteria | 20911 |
| 549 | Ga0495675_0297002 | 3300047444 | Unclassified | 960 |
| 550 | Ga0495675_0329587 | 3300047444 | Unclassified | 902 |
| 551 | Ga0495684_0062017 | 3300047471 | Unclassified | 2844 |
| 552 | Ga0495684_0090086 | 3300047471 | Bacteria | 2324 |
| 553 | Ga0495593_0008134 | 3300047673 | Bacteria | 6104 |
| 554 | Ga0495593_0078357 | 3300047673 | Bacteria | 1712 |
| 555 | Ga0495614_0015800 | 3300048089 | Unclassified | 3287 |
| 556 | Ga0496104_0157266 | 3300048907 | Unclassified | 2181 |
| 557 | Ga0496108_0323414 | 3300048911 | Bacteria | 1345 |
| 558 | Ga0496109_0000231 | 3300048912 | Bacteria | 54570 |
| 559 | Ga0496109_0059124 | 3300048912 | Unclassified | 3502 |
| 560 | Ga0496111_0778201 | 3300048914 | Unclassified | 693 |
| 561 | Ga0496112_0007127 | 3300048915 | Bacteria | 9892 |
| 562 | Ga0496112_0900507 | 3300048915 | Unclassified | 807 |
| 563 | Ga0496112_1235733 | 3300048915 | Bacteria | 663 |
| 564 | Ga0496113_0038185 | 3300048916 | Bacteria | 3530 |
| 565 | Ga0496114_0100041 | 3300048917 | Bacteria | 2474 |
| 566 | Ga0496114_0146968 | 3300048917 | Bacteria | 2044 |
| 567 | Ga0501291_066214 | 3300049514 | Unclassified | 691 |
| 568 | Ga0501292_007330 | 3300049515 | Unclassified | 1591 |
| 569 | Ga0501295_063436 | 3300049518 | Bacteria | 813 |
| 570 | Ga0501299_040599 | 3300049522 | Bacteria | 932 |
| 571 | Ga0501300_028641 | 3300049523 | Unclassified | 820 |
| 572 | Ga0501033_0757994 | 3300049570 | Bacteria | 658 |
| 573 | Ga0501036_0167726 | 3300049572 | Bacteria | 1850 |
| 574 | Ga0501039_0115452 | 3300049575 | Bacteria | 2101 |
| 575 | Ga0501040_0243056 | 3300049576 | Bacteria | 1283 |
| 576 | Ga0501041_0113132 | 3300049577 | Bacteria | 1684 |
| 577 | Ga0501042_0094735 | 3300049578 | Bacteria | 2144 |
| 578 | Ga0501046_0417797 | 3300049580 | Bacteria | 967 |
| 579 | Ga0501067_0404108 | 3300049583 | Unclassified | 762 |
| 580 | Ga0501068_0574866 | 3300049584 | Unclassified | 733 |
| 581 | Ga0501069_0158793 | 3300049585 | Bacteria | 1302 |
| 582 | Ga0501072_0078114 | 3300049588 | Unclassified | 2621 |
| 583 | Ga0501077_0129445 | 3300049593 | Bacteria | 1600 |
| 584 | Ga0501198_019950 | 3300049649 | Unclassified | 1060 |
| 585 | Ga0501202_013805 | 3300049652 | Unclassified | 1540 |
| 586 | Ga0501202_052358 | 3300049652 | Bacteria | 907 |
| 587 | Ga0501207_013022 | 3300049654 | Bacteria | 1256 |
| 588 | Ga0501208_031360 | 3300049655 | Unclassified | 940 |
| 589 | Ga0501216_020928 | 3300049660 | Unclassified | 1146 |
| 590 | Ga0501217_006240 | 3300049661 | Unclassified | 2524 |
| 591 | Ga0501217_078596 | 3300049661 | Bacteria | 910 |
| 592 | Ga0501223_008150 | 3300049663 | Unclassified | 2137 |
| 593 | Ga0501227_100996 | 3300049665 | Unclassified | 767 |
| 594 | Ga0501230_003528 | 3300049667 | Unclassified | 2088 |
| 595 | Ga0501235_000305 | 3300049669 | Bacteria | 9276 |
| 596 | Ga0501235_079452 | 3300049669 | Bacteria | 783 |
| 597 | Ga0501236_006429 | 3300049670 | Unclassified | 1443 |
| 598 | Ga0501239_003431 | 3300049672 | Unclassified | 1505 |
| 599 | Ga0501243_122164 | 3300049675 | Unclassified | 540 |
| 600 | Ga0501249_003044 | 3300049679 | Unclassified | 3372 |
| 601 | Ga0501249_034771 | 3300049679 | Bacteria | 1131 |
| 602 | Ga0501249_114646 | 3300049679 | Bacteria | 654 |
| 603 | Ga0501253_001827 | 3300049683 | Unclassified | 2271 |
| 604 | Ga0501256_002436 | 3300049685 | Unclassified | 1476 |
| 605 | Ga0501257_003722 | 3300049686 | Unclassified | 3296 |
| 606 | Ga0501258_009655 | 3300049687 | Unclassified | 1011 |
| 607 | Ga0501260_002660 | 3300049689 | Unclassified | 1560 |
| 608 | Ga0501261_027196 | 3300049690 | Bacteria | 850 |
| 609 | Ga0501221_003942 | 3300049704 | Unclassified | 2451 |
| 610 | Ga0501225_0005131 | 3300049705 | Unclassified | 3856 |
| 611 | Ga0501225_0085210 | 3300049705 | Bacteria | 911 |
| 612 | Ga0501225_0086966 | 3300049705 | Unclassified | 902 |
| 613 | Ga0501229_011160 | 3300049706 | Unclassified | 1138 |
| 614 | Ga0501234_005034 | 3300049707 | Unclassified | 2073 |
| 615 | Ga0501245_018975 | 3300049708 | Unclassified | 1061 |
| 616 | Ga0501245_044039 | 3300049708 | Unclassified | 775 |
| 617 | Ga0501079_1006251 | 3300049741 | Unclassified | 656 |
| 618 | Ga0501081_0045918 | 3300049743 | Bacteria | 3000 |
| 619 | Ga0501083_0227220 | 3300049744 | Bacteria | 1216 |
| 620 | Ga0501265_003782 | 3300049762 | Unclassified | 1718 |
| 621 | Ga0501266_007498 | 3300049763 | Unclassified | 1367 |
| 622 | Ga0501267_011659 | 3300049764 | Unclassified | 898 |
| 623 | Ga0501283_034036 | 3300049779 | Bacteria | 864 |
| 624 | Ga0501035_1017100 | 3300049822 | Bacteria | 651 |
| 625 | Ga0501045_0090785 | 3300049824 | Bacteria | 2257 |
| 626 | Ga0501212_003321 | 3300049851 | Unclassified | 2010 |
| 627 | Ga0501212_016587 | 3300049851 | Bacteria | 1107 |
| 628 | Ga0501226_030687 | 3300049853 | Unclassified | 610 |
| 629 | nmdc:mga06z11_408068_c1 | 3300050494 | Bacteria | 818 |
| 630 | nmdc:mga05p37_19830_c2 | 3300050507 | Bacteria | 4351 |
| 631 | nmdc:mga05p37_333023_c1 | 3300050507 | Unclassified | 1792 |
| 632 | nmdc:mga05p37_347868_c1 | 3300050507 | Bacteria | 1746 |
| 633 | nmdc:mga05p37_384965_c1 | 3300050507 | Bacteria | 1642 |
| 634 | nmdc:mga05p37_401195_c1 | 3300050507 | Unclassified | 1601 |
| 635 | nmdc:mga05p37_605667_c1 | 3300050507 | Bacteria | 1236 |
| 636 | nmdc:mga05p37_982033_c1 | 3300050507 | Bacteria | 900 |
| 637 | nmdc:mga05p37_994677_c1 | 3300050507 | Bacteria | 892 |
| 638 | nmdc:mga09592_354105_c1 | 3300050508 | Archaea | 1270 |
| 639 | nmdc:mga09592_5111_c1 | 3300050508 | Bacteria | 10653 |
| 640 | nmdc:mga0qj67_159097_c1 | 3300050509 | Bacteria | 1834 |
| 641 | nmdc:mga0qj67_184889_c1 | 3300050509 | Unclassified | 1693 |
| 642 | nmdc:mga0qj67_233966_c1 | 3300050509 | Unclassified | 1491 |
| 643 | nmdc:mga0qj67_795105_c1 | 3300050509 | Bacteria | 749 |
| 644 | nmdc:mga0qj67_816775_c1 | 3300050509 | Unclassified | 737 |
| 645 | nmdc:mga06r32_18820_c1 | 3300050510 | Bacteria | 6328 |
| 646 | nmdc:mga06r32_191724_c1 | 3300050510 | Bacteria | 2031 |
| 647 | nmdc:mga06r32_217888_c1 | 3300050510 | Bacteria | 1897 |
| 648 | nmdc:mga06r32_286896_c1 | 3300050510 | Unclassified | 1633 |
| 649 | nmdc:mga06r32_357707_c1 | 3300050510 | Bacteria | 1444 |
| 650 | nmdc:mga06r32_51202_c1 | 3300050510 | Unclassified | 3951 |
| 651 | nmdc:mga06r32_528905_c1 | 3300050510 | Unclassified | 1154 |
| 652 | nmdc:mga08y16_121115_c1 | 3300050511 | Bacteria | 2723 |
| 653 | nmdc:mga08y16_184049_c1 | 3300050511 | Bacteria | 2168 |
| 654 | nmdc:mga08y16_1855623_c1 | 3300050511 | Unclassified | 555 |
| 655 | nmdc:mga0n895_112237_c1 | 3300050512 | Bacteria | 2743 |
| 656 | nmdc:mga0n895_1314533_c1 | 3300050512 | Bacteria | 694 |
| 657 | nmdc:mga0n895_794864_c1 | 3300050512 | Bacteria | 937 |
| 658 | nmdc:mga0n895_85870_c1 | 3300050512 | Bacteria | 3142 |
| 659 | nmdc:mga0rr50_311802_c1 | 3300050513 | Bacteria | 1318 |
| 660 | nmdc:mga0rr50_743465_c1 | 3300050513 | Unclassified | 837 |
| 661 | nmdc:mga0rr50_877487_c1 | 3300050513 | Bacteria | 765 |
| 662 | nmdc:mga08x19_86804_c1 | 3300050514 | Bacteria | 2060 |
| 663 | nmdc:mga0a205_1127702_c1 | 3300050515 | Unclassified | 632 |
| 664 | nmdc:mga0a205_141101_c1 | 3300050515 | Bacteria | 2310 |
| 665 | nmdc:mga0a205_20937_c1 | 3300050515 | Bacteria | 6180 |
| 666 | nmdc:mga0a205_392689_c1 | 3300050515 | Unclassified | 1251 |
| 667 | nmdc:mga0a205_808630_c1 | 3300050515 | Unclassified | 785 |
| 668 | nmdc:mga0a205_9559_c1 | 3300050515 | Bacteria | 8872 |
| 669 | Ga0495601_0065740 | 3300053077 | Bacteria | 2308 |
| 670 | Ga0495595_0225192 | 3300053084 | Bacteria | 936 |
| 671 | Ga0495619_0093698 | 3300053085 | Bacteria | 2036 |
| 672 | Ga0500555_030309 | 3300053103 | Bacteria | 1536 |
| 673 | Ga0501084_0042969 | 3300054114 | Bacteria | 3780 |
| 674 | Ga0501082_0268557 | 3300060353 | Bacteria | 1484 |
| 675 | Ga0530510_0107539 | 3300061734 | Bacteria | 2041 |
| 676 | Ga0070708_100010140 | |||
| 677 | JGI25406J46586_10015303 | |||
| 678 | Ga0065704_10153711 | |||
| 679 | Ga0065707_10193666 | |||
| 680 | Ga0070676_10317839 | |||
| 681 | Ga0070683_100099398 | |||
| 682 | Ga0070683_100634144 | |||
| 683 | Ga0070690_100012200 | |||
| 684 | Ga0070690_100201022 | |||
| 685 | Ga0070690_100382231 | |||
| 686 | Ga0070690_100845324 | |||
| 687 | Ga0070670_100010611 | |||
| 688 | Ga0070670_100058389 | |||
| 689 | Ga0070670_100149757 | |||
| 690 | Ga0070670_100402347 | |||
| 691 | Ga0070670_100426782 | |||
| 692 | Ga0070677_10236993 | |||
| 693 | Ga0068869_100099609 | |||
| 694 | Ga0068869_100102934 | |||
| 695 | Ga0068869_100483903 | |||
| 696 | Ga0070666_10104612 | |||
| 697 | Ga0070666_10302641 | |||
| 698 | Ga0070680_100103393 | |||
| 699 | Ga0070682_100031781 | |||
| 700 | Ga0070682_100422400 | |||
| 701 | Ga0068868_100013341 | |||
| 702 | Ga0068868_100153282 | |||
| 703 | Ga0068868_100165063 | |||
| 704 | Ga0070660_100107025 | |||
| 705 | Ga0070689_100047046 | |||
| 706 | Ga0070689_100060810 | |||
| 707 | Ga0070689_100102803 | |||
| 708 | Ga0070689_100274819 | |||
| 709 | Ga0070689_101100992 | |||
| 710 | Ga0070687_100100166 | |||
| 711 | Ga0070687_100221629 | |||
| 712 | Ga0070687_100777938 | |||
| 713 | Ga0070661_100015507 | |||
| 714 | Ga0070661_100091238 | |||
| 715 | Ga0070692_10088275 | |||
| 716 | Ga0070669_100037556 | |||
| 717 | Ga0070669_100232762 | |||
| 718 | Ga0070675_100104539 | |||
| 719 | Ga0070675_100121807 | |||
| 720 | Ga0070675_100376546 | |||
| 721 | Ga0070675_100631732 | |||
| 722 | Ga0070671_100059512 | |||
| 723 | Ga0070671_100149966 | |||
| 724 | Ga0070671_100576377 | |||
| 725 | Ga0070671_100774538 | |||
| 726 | Ga0070673_100262809 | |||
| 727 | Ga0070673_100317345 | |||
| 728 | Ga0070673_100606311 | |||
| 729 | Ga0070688_100188849 | |||
| 730 | Ga0070688_100290773 | |||
| 731 | Ga0070688_100510778 | |||
| 732 | Ga0070659_100009513 | |||
| 733 | Ga0070659_100074084 | |||
| 734 | Ga0070667_100051136 | |||
| 735 | Ga0070667_100063109 | |||
| 736 | Ga0070701_10062602 | |||
| 737 | Ga0070701_10393801 | |||
| 738 | Ga0070705_100295113 | |||
| 739 | Ga0070705_100486330 | |||
| 740 | Ga0070705_100793752 | |||
| 741 | Ga0070700_100281447 | |||
| 742 | Ga0070694_100169439 | |||
| 743 | Ga0070694_100330727 | |||
| 744 | Ga0070708_100002362 | |||
| 745 | Ga0070708_100556891 | |||
| 746 | Ga0070708_100889164 | |||
| 747 | Ga0070708_101297387 | |||
| 748 | Ga0070663_100027108 | |||
| 749 | Ga0070663_100275838 | |||
| 750 | Ga0070678_100025325 | |||
| 751 | Ga0070662_100015205 | |||
| 752 | Ga0070662_100030646 | |||
| 753 | Ga0070662_100402815 | |||
| 754 | Ga0070681_10008869 | |||
| 755 | Ga0070681_10061857 | |||
| 756 | Ga0068867_100244456 | |||
| 757 | Ga0070685_10001437 | |||
| 758 | Ga0070706_100021984 | |||
| 759 | Ga0070706_100163263 | |||
| 760 | Ga0070707_100026729 | |||
| 761 | Ga0070707_100045611 | |||
| 762 | Ga0070707_100655844 | |||
| 763 | Ga0070707_101256420 | |||
| 764 | Ga0070707_101486276 | |||
| 765 | Ga0070698_100006142 | |||
| 766 | Ga0070698_100101538 | |||
| 767 | Ga0070698_100135054 | |||
| 768 | Ga0070698_100620836 | |||
| 769 | Ga0070698_101009736 | |||
| 770 | Ga0070699_100009745 | |||
| 771 | Ga0070699_100067001 | |||
| 772 | Ga0070699_101503512 | |||
| 773 | Ga0070679_100075327 | |||
| 774 | Ga0070679_100123172 | |||
| 775 | Ga0070684_100164617 | |||
| 776 | Ga0070684_100255905 | |||
| 777 | Ga0070684_100723101 | |||
| 778 | Ga0070684_101759168 | |||
| 779 | Ga0070697_100005043 | |||
| 780 | Ga0070697_100026034 | |||
| 781 | Ga0068853_100084583 | |||
| 782 | Ga0070672_100124299 | |||
| 783 | Ga0070672_100271107 | |||
| 784 | Ga0070672_100274378 | |||
| 785 | Ga0070672_100632582 | |||
| 786 | Ga0070686_100033086 | |||
| 787 | Ga0070686_100375550 | |||
| 788 | Ga0070695_100200921 | |||
| 789 | Ga0070696_100009796 | |||
| 790 | Ga0070696_100911431 | |||
| 791 | Ga0070693_100033960 | |||
| 792 | Ga0070665_100010635 | |||
| 793 | Ga0070665_101439019 | |||
| 794 | Ga0070704_100240720 | |||
| 795 | Ga0068855_100389361 | |||
| 796 | Ga0070664_100009190 | |||
| 797 | Ga0070664_100020375 | |||
| 798 | Ga0070664_100190670 | |||
| 799 | Ga0070664_100374476 | |||
| 800 | Ga0070664_100391968 | |||
| 801 | Ga0070664_100517125 | |||
| 802 | Ga0070664_100617053 | |||
| 803 | Ga0070664_101141841 | |||
| 804 | Ga0068857_100005243 | |||
| 805 | Ga0068857_100099928 | |||
| 806 | Ga0068857_100148065 | |||
| 807 | Ga0068857_100713426 | |||
| 808 | Ga0068854_100312963 | |||
| 809 | Ga0068854_101152973 | |||
| 810 | Ga0068856_100151760 | |||
| 811 | Ga0068852_100515122 | |||
| 812 | Ga0068859_100052103 | |||
| 813 | Ga0068859_100429138 | |||
| 814 | Ga0068859_100471117 | |||
| 815 | Ga0068859_100746538 | |||
| 816 | Ga0068859_100795514 | |||
| 817 | Ga0068859_102749747 | |||
| 818 | Ga0068864_100013610 | |||
| 819 | Ga0068864_100033480 | |||
| 820 | Ga0068866_10331427 | |||
| 821 | Ga0068861_100786677 | |||
| 822 | Ga0068851_10172058 | |||
| 823 | Ga0068851_10270622 | |||
| 824 | Ga0068870_10004089 | |||
| 825 | Ga0068863_100143284 | |||
| 826 | Ga0068863_100480215 | |||
| 827 | Ga0068863_101890900 | |||
| 828 | Ga0068858_100019828 | |||
| 829 | Ga0068858_100212350 | |||
| 830 | Ga0068858_101003772 | |||
| 831 | Ga0068860_100038677 | |||
| 832 | Ga0068862_100082810 | |||
| 833 | Ga0068862_100159698 | |||
| 834 | Ga0068862_100201251 | |||
| 835 | Ga0068862_100246245 | |||
| 836 | Ga0068862_100252889 | |||
| 837 | Ga0068862_101088995 | |||
| 838 | Ga0068862_101833618 | |||
| 839 | Ga0081455_10006826 | |||
| 840 | Ga0081455_10012390 | |||
| 841 | Ga0081455_10058918 | |||
| 842 | Ga0081540_1011659 | |||
| 843 | Ga0081539_10000117 | |||
| 844 | Ga0070715_10258275 | |||
| 845 | Ga0070716_100926609 | |||
| 846 | Ga0070712_100246568 | |||
| 847 | Ga0070712_100289636 | |||
| 848 | Ga0075427_10006684 | |||
| 849 | Ga0097621_100000461 | |||
| 850 | Ga0097621_100860122 | |||
| 851 | Ga0068871_100008387 | |||
| 852 | Ga0068871_100809454 | |||
| 853 | Ga0075428_100009081 | |||
| 854 | Ga0075428_100176418 | |||
| 855 | Ga0075428_100177225 | |||
| 856 | Ga0075428_100205872 | |||
| 857 | Ga0075428_100914909 | |||
| 858 | Ga0075428_101607020 | |||
| 859 | Ga0075430_100005748 | |||
| 860 | Ga0075430_100030396 | |||
| 861 | Ga0075430_100207802 | |||
| 862 | Ga0075430_100233217 | |||
| 863 | Ga0075430_100683620 | |||
| 864 | Ga0075430_100865933 | |||
| 865 | Ga0075431_100027080 | |||
| 866 | Ga0075431_100029058 | |||
| 867 | Ga0075431_100049494 | |||
| 868 | Ga0075431_100246895 | |||
| 869 | Ga0075431_100271220 | |||
| 870 | Ga0075431_100348180 | |||
| 871 | Ga0075431_100452357 | |||
| 872 | Ga0075431_100454917 | |||
| 873 | Ga0075433_10006275 | |||
| 874 | Ga0075433_10992956 | |||
| 875 | Ga0075434_100061135 | |||
| 876 | Ga0075434_100291323 | |||
| 877 | Ga0075434_100418171 | |||
| 878 | Ga0075429_100004387 | |||
| 879 | Ga0075429_100040852 | |||
| 880 | Ga0075429_100195002 | |||
| 881 | Ga0075429_100271803 | |||
| 882 | Ga0068865_100002248 | |||
| 883 | Ga0068865_100031385 | |||
| 884 | Ga0075436_100131319 | |||
| 885 | Ga0097620_100052106 | |||
| 886 | Ga0097620_100396621 | |||
| 887 | Ga0097620_100429137 | |||
| 888 | Ga0097620_100471107 | |||
| 889 | Ga0097620_100746543 | |||
| 890 | Ga0097620_100795451 | |||
| 891 | Ga0097620_102749660 | |||
| 892 | Ga0099795_10279437 | |||
| 893 | Ga0105251_10440818 | |||
| 894 | Ga0105240_10821777 | |||
| 895 | Ga0111539_10115305 | |||
| 896 | Ga0111539_10352984 | |||
| 897 | Ga0111539_12774083 | |||
| 898 | Ga0105245_10043389 | |||
| 899 | Ga0105245_10322342 | |||
| 900 | Ga0105245_11418272 | |||
| 901 | Ga0105245_12042121 | |||
| 902 | Ga0105247_10002665 | |||
| 903 | Ga0105247_11404362 | |||
| 904 | Ga0114129_10033911 | |||
| 905 | Ga0114129_10068947 | |||
| 906 | Ga0114129_10200796 | |||
| 907 | Ga0114129_10569549 | |||
| 908 | Ga0114129_10869763 | |||
| 909 | Ga0114129_11578779 | |||
| 910 | Ga0114129_12312996 | |||
| 911 | Ga0105243_10117512 | |||
| 912 | Ga0105243_11025661 | |||
| 913 | Ga0105243_11856038 | |||
| 914 | Ga0105241_10730704 | |||
| 915 | Ga0105241_11136388 | |||
| 916 | Ga0105242_10023016 | |||
| 917 | Ga0105242_10067997 | |||
| 918 | Ga0105248_10005035 | |||
| 919 | Ga0105248_10264697 | |||
| 920 | Ga0105248_10363338 | |||
| 921 | Ga0105248_10435448 | |||
| 922 | Ga0105248_10771458 | |||
| 923 | Ga0105238_10754035 | |||
| 924 | Ga0105249_10294190 | |||
| 925 | Ga0105249_10404667 | |||
| 926 | Ga0105249_10898493 | |||
| 927 | Ga0105249_11084022 | |||
| 928 | Ga0105246_10177907 | |||
| 929 | Ga0157371_10939699 | |||
| 930 | Ga0157369_10434064 | |||
| 931 | Ga0157374_10029195 | |||
| 932 | Ga0157374_10134480 | |||
| 933 | Ga0157378_10000609 | |||
| 934 | Ga0157378_10706805 | |||
| 935 | Ga0157378_10876757 | |||
| 936 | Ga0157378_12472030 | |||
| 937 | Ga0163162_10038129 | |||
| 938 | Ga0163162_10463704 | |||
| 939 | Ga0157372_11355128 | |||
| 940 | Ga0157375_10266432 | |||
| 941 | Ga0157375_10279125 | |||
| 942 | Ga0157375_10414673 | |||
| 943 | Ga0157375_11020165 | |||
| 944 | Ga0163163_10005970 | |||
| 945 | Ga0163163_10007410 | |||
| 946 | Ga0163163_10151297 | |||
| 947 | Ga0163163_10174204 | |||
| 948 | Ga0163163_10801092 | |||
| 949 | Ga0157380_10001729 | |||
| 950 | Ga0157380_10022247 | |||
| 951 | Ga0157380_11174112 | |||
| 952 | Ga0182008_10001997 | |||
| 953 | Ga0157377_10309728 | |||
| 954 | Ga0157379_11758953 | |||
| 955 | Ga0157376_10146107 | |||
| 956 | Ga0163161_10461136 | |||
| 957 | Ga0213876_10000052 | |||
| 958 | Ga0228598_1007619 | |||
| 959 | Ga0207697_10063038 | |||
| 960 | Ga0207697_10170081 | |||
| 961 | Ga0207642_10202583 | |||
| 962 | Ga0207710_10027620 | |||
| 963 | Ga0207688_10243147 | |||
| 964 | Ga0207680_10154251 | |||
| 965 | Ga0207680_10539702 | |||
| 966 | Ga0207647_10101594 | |||
| 967 | Ga0207645_10032316 | |||
| 968 | Ga0207645_10050823 | |||
| 969 | Ga0207643_10007117 | |||
| 970 | Ga0207643_10255949 | |||
| 971 | Ga0207684_10043569 | |||
| 972 | Ga0207684_10090783 | |||
| 973 | Ga0207654_10800030 | |||
| 974 | Ga0207707_10007014 | |||
| 975 | Ga0207707_10032991 | |||
| 976 | Ga0207693_10258511 | |||
| 977 | Ga0207662_10038421 | |||
| 978 | Ga0207662_10079257 | |||
| 979 | Ga0207662_10365714 | |||
| 980 | Ga0207662_10579869 | |||
| 981 | Ga0207657_10053750 | |||
| 982 | Ga0207657_10424103 | |||
| 983 | Ga0207649_10216620 | |||
| 984 | Ga0207649_10389750 | |||
| 985 | Ga0207652_10052238 | |||
| 986 | Ga0207652_10081517 | |||
| 987 | Ga0207646_10019015 | |||
| 988 | Ga0207646_10029914 | |||
| 989 | Ga0207646_10499158 | |||
| 990 | Ga0207681_10000898 | |||
| 991 | Ga0207681_10064974 | |||
| 992 | Ga0207681_10191086 | |||
| 993 | Ga0207681_10722557 | |||
| 994 | Ga0207694_10000042 | |||
| 995 | Ga0207650_10002300 | |||
| 996 | Ga0207650_10243936 | |||
| 997 | Ga0207650_11166698 | |||
| 998 | Ga0207650_11246536 | |||
| 999 | Ga0207659_10291514 | |||
| 1000 | Ga0207659_10572743 | |||
| 1001 | Ga0207659_11092619 | |||
| 1002 | Ga0207687_10020075 | |||
| 1003 | Ga0207687_10169391 | |||
| 1004 | Ga0207687_10592194 | |||
| 1005 | Ga0207644_10130569 | |||
| 1006 | Ga0207644_10248288 | |||
| 1007 | Ga0207644_10291481 | |||
| 1008 | Ga0207690_10057013 | |||
| 1009 | Ga0207706_10062383 | |||
| 1010 | Ga0207706_10063208 | |||
| 1011 | Ga0207706_10259072 | |||
| 1012 | Ga0207706_10454230 | |||
| 1013 | Ga0207686_10020959 | |||
| 1014 | Ga0207686_10342049 | |||
| 1015 | Ga0207709_10069895 | |||
| 1016 | Ga0207709_10141655 | |||
| 1017 | Ga0207709_11534906 | |||
| 1018 | Ga0207670_10030994 | |||
| 1019 | Ga0207670_10073295 | |||
| 1020 | Ga0207670_10279759 | |||
| 1021 | Ga0207670_10286496 | |||
| 1022 | Ga0207669_10911037 | |||
| 1023 | Ga0207704_10015113 | |||
| 1024 | Ga0207704_10280380 | |||
| 1025 | Ga0207691_10094714 | |||
| 1026 | Ga0207691_10114712 | |||
| 1027 | Ga0207691_10186392 | |||
| 1028 | Ga0207691_10332476 | |||
| 1029 | Ga0207691_10363245 | |||
| 1030 | Ga0207711_10081702 | |||
| 1031 | Ga0207711_10170029 | |||
| 1032 | Ga0207711_10219154 | |||
| 1033 | Ga0207711_10262998 | |||
| 1034 | Ga0207711_10780137 | |||
| 1035 | Ga0207689_10035542 | |||
| 1036 | Ga0207689_10285593 | |||
| 1037 | Ga0207689_10326270 | |||
| 1038 | Ga0207689_10582240 | |||
| 1039 | Ga0207661_10150527 | |||
| 1040 | Ga0207661_10318204 | |||
| 1041 | Ga0207661_10403670 | |||
| 1042 | Ga0207679_10019141 | |||
| 1043 | Ga0207679_10020530 | |||
| 1044 | Ga0207679_10065214 | |||
| 1045 | Ga0207679_10535199 | |||
| 1046 | Ga0207679_10837902 | |||
| 1047 | Ga0207667_11403903 | |||
| 1048 | Ga0207651_10312813 | |||
| 1049 | Ga0207651_10548441 | |||
| 1050 | Ga0207712_10014721 | |||
| 1051 | Ga0207712_10093958 | |||
| 1052 | Ga0207712_10771557 | |||
| 1053 | Ga0207712_11392114 | |||
| 1054 | Ga0207668_10009418 | |||
| 1055 | Ga0207640_10792167 | |||
| 1056 | Ga0207658_10032114 | |||
| 1057 | Ga0207658_10367618 | |||
| 1058 | Ga0207677_10255683 | |||
| 1059 | Ga0207677_10341351 | |||
| 1060 | Ga0207677_10519254 | |||
| 1061 | Ga0207703_10031360 | |||
| 1062 | Ga0207703_10045433 | |||
| 1063 | Ga0207703_10254243 | |||
| 1064 | Ga0207639_10028871 | |||
| 1065 | Ga0207639_10952988 | |||
| 1066 | Ga0207678_10263524 | |||
| 1067 | Ga0207678_10551322 | |||
| 1068 | Ga0207708_10050353 | |||
| 1069 | Ga0207708_10411684 | |||
| 1070 | Ga0207702_10295586 | |||
| 1071 | Ga0207641_10100278 | |||
| 1072 | Ga0207641_10149824 | |||
| 1073 | Ga0207641_10625030 | |||
| 1074 | Ga0207648_10134588 | |||
| 1075 | Ga0207648_10212564 | |||
| 1076 | Ga0207648_10256901 | |||
| 1077 | Ga0207648_11710160 | |||
| 1078 | Ga0207676_11409387 | |||
| 1079 | Ga0207674_10001906 | |||
| 1080 | Ga0207674_10007618 | |||
| 1081 | Ga0207674_10191906 | |||
| 1082 | Ga0207674_11063015 | |||
| 1083 | Ga0207675_100231569 | |||
| 1084 | Ga0207675_100283668 | |||
| 1085 | Ga0207675_101168407 | |||
| 1086 | Ga0207683_10079407 | |||
| 1087 | Ga0207683_10266931 | |||
| 1088 | Ga0207698_10077346 | |||
| 1089 | Ga0207698_11161582 | |||
| 1090 | Ga0207428_10157638 | |||
| 1091 | Ga0268266_10044946 | |||
| 1092 | Ga0268265_10099319 | |||
| 1093 | Ga0268265_10226505 | |||
| 1094 | Ga0268265_10238283 | |||
| 1095 | Ga0268265_10879451 | |||
| 1096 | Ga0268265_11320204 | |||
| 1097 | Ga0268265_11671653 | |||
| 1098 | Ga0268264_10343275 | |||
| 1099 | Ga0268264_10735017 | |||
| 1100 | Ga0265319_1006777 | |||
| 1101 | Ga0265318_10006297 | |||
| 1102 | Ga0316182_1425907 | |||
| 1103 | Ga0265320_10001947 | |||
| 1104 | Ga0265329_10000949 | |||
| 1105 | Ga0265340_10014477 | |||
| 1106 | Ga0265339_10053113 | |||
| 1107 | Ga0265331_10001914 | |||
| 1108 | Ga0265316_10214960 | |||
| 1109 | Ga0307408_100034362 | |||
| 1110 | Ga0307408_100193277 | |||
| 1111 | Ga0307408_100434739 | |||
| 1112 | Ga0307408_101333004 | |||
| 1113 | Ga0265313_10026529 | |||
| 1114 | Ga0265314_10055316 | |||
| 1115 | Ga0265342_10006879 | |||
| 1116 | Ga0307405_10050906 | |||
| 1117 | Ga0307405_10058491 | |||
| 1118 | Ga0307405_10193243 | |||
| 1119 | Ga0307405_10897563 | |||
| 1120 | Ga0307405_11401125 | |||
| 1121 | Ga0307413_10195476 | |||
| 1122 | Ga0307413_10284700 | |||
| 1123 | Ga0307413_10496054 | |||
| 1124 | Ga0307413_10747544 | |||
| 1125 | Ga0307413_10819276 | |||
| 1126 | Ga0307410_10080285 | |||
| 1127 | Ga0307410_10156127 | |||
| 1128 | Ga0307410_10270891 | |||
| 1129 | Ga0307410_10712884 | |||
| 1130 | Ga0307410_11021947 | |||
| 1131 | Ga0307406_10036634 | |||
| 1132 | Ga0307406_10061512 | |||
| 1133 | Ga0307406_10412449 | |||
| 1134 | Ga0307407_10124925 | |||
| 1135 | Ga0307407_10435432 | |||
| 1136 | Ga0307407_10585918 | |||
| 1137 | Ga0307407_10625738 | |||
| 1138 | Ga0307409_100054196 | |||
| 1139 | Ga0307409_100127824 | |||
| 1140 | Ga0307416_100005840 | |||
| 1141 | Ga0307416_100092072 | |||
| 1142 | Ga0307416_100237192 | |||
| 1143 | Ga0307416_100387439 | |||
| 1144 | Ga0307416_100565663 | |||
| 1145 | Ga0307416_100697275 | |||
| 1146 | Ga0307411_10169191 | |||
| 1147 | Ga0307411_10658422 | |||
| 1148 | Ga0307411_11862113 | |||
| 1149 | Ga0307415_100070417 | |||
| 1150 | Ga0307415_100093595 | |||
| 1151 | Ga0307415_100190305 | |||
| 1152 | Ga0307415_100751182 | |||
| 1153 | Ga0373959_0000079 | |||
| 1154 | Ga0373936_0199485 | |||
| 1155 | Ga0373943_0075022 | |||
| 1156 | Ga0373943_0173065 | |||
| 1157 | Ga0373927_0164208 | |||
| 1158 | Ga0373937_0132304 | |||
| 1159 | Ga0373925_0032294 | |||
| 1160 | Ga0373925_0119633 | |||
| 1161 | Ga0395900_0966510 | |||
| 1162 | Ga0395905_0709430 | |||
| 1163 | Ga0395905_1297373 | |||
| 1164 | Ga0242420_044323 | |||
| 1165 | Ga0436365_0406589 | |||
| 1166 | Ga0436365_1764576 | |||
| 1167 | Ga0439435_0042661 | |||
| 1168 | Ga0439460_0237759 | |||
| 1169 | Ga0450893_0071512 | |||
| 1170 | Ga0453684_1147603 | |||
| 1171 | Ga0451576_0000338 | |||
| 1172 | Ga0451576_0137139 | |||
| 1173 | Ga0451576_0286278 | |||
| 1174 | Ga0451576_0483239 | |||
| 1175 | Ga0466958_0032814 | |||
| 1176 | Ga0495629_0546627 | |||
| 1177 | Ga0495651_0001811 | |||
| 1178 | Ga0495651_0157712 | |||
| 1179 | Ga0495653_0389415 | |||
| 1180 | Ga0495639_0018207 | |||
| 1181 | Ga0495639_0022195 | |||
| 1182 | Ga0495639_0284761 | |||
| 1183 | Ga0495662_0022976 | |||
| 1184 | Ga0495664_0055043 | |||
| 1185 | Ga0495594_0024934 | |||
| 1186 | Ga0495594_0113904 | |||
| 1187 | Ga0495594_0131444 | |||
| 1188 | Ga0495608_0060802 | |||
| 1189 | Ga0495618_0008177 | |||
| 1190 | Ga0495628_0154067 | |||
| 1191 | Ga0495630_0003087 | |||
| 1192 | Ga0495630_0022090 | |||
| 1193 | Ga0495630_0113793 | |||
| 1194 | Ga0495666_0263333 | |||
| 1195 | Ga0495652_0308398 | |||
| 1196 | Ga0495665_0010993 | |||
| 1197 | Ga0495665_0068922 | |||
| 1198 | Ga0495640_0031975 | |||
| 1199 | Ga0495640_0058754 | |||
| 1200 | Ga0495640_0105521 | |||
| 1201 | Ga0495586_0026269 | |||
| 1202 | Ga0495586_0209484 | |||
| 1203 | Ga0495586_0287184 | |||
| 1204 | Ga0495645_0046224 | |||
| 1205 | Ga0495645_0193905 | |||
| 1206 | Ga0495622_0214222 | |||
| 1207 | Ga0495635_0008012 | |||
| 1208 | Ga0495588_0008279 | |||
| 1209 | Ga0495599_0601534 | |||
| 1210 | Ga0495647_0035786 | |||
| 1211 | Ga0495647_0088266 | |||
| 1212 | Ga0495647_0167023 | |||
| 1213 | Ga0495658_0025177 | |||
| 1214 | Ga0495658_0028304 | |||
| 1215 | Ga0495613_0150844 | |||
| 1216 | Ga0495613_0387835 | |||
| 1217 | Ga0495613_0542307 | |||
| 1218 | Ga0495600_0040605 | |||
| 1219 | Ga0495600_0188226 | |||
| 1220 | Ga0495581_0044420 | |||
| 1221 | Ga0495581_0052636 | |||
| 1222 | Ga0495674_0096593 | |||
| 1223 | Ga0495680_0002068 | |||
| 1224 | Ga0495675_0297002 | |||
| 1225 | Ga0495675_0329587 | |||
| 1226 | Ga0495684_0062017 | |||
| 1227 | Ga0495684_0090086 | |||
| 1228 | Ga0495593_0008134 | |||
| 1229 | Ga0495593_0078357 | |||
| 1230 | Ga0495614_0015800 | |||
| 1231 | Ga0496104_0157266 | |||
| 1232 | Ga0496108_0323414 | |||
| 1233 | Ga0496109_0000231 | |||
| 1234 | Ga0496109_0059124 | |||
| 1235 | Ga0496111_0778201 | |||
| 1236 | Ga0496112_0007127 | |||
| 1237 | Ga0496112_0900507 | |||
| 1238 | Ga0496112_1235733 | |||
| 1239 | Ga0496113_0038185 | |||
| 1240 | Ga0496114_0100041 | |||
| 1241 | Ga0496114_0146968 | |||
| 1242 | Ga0501291_066214 | |||
| 1243 | Ga0501292_007330 | |||
| 1244 | Ga0501295_063436 | |||
| 1245 | Ga0501299_040599 | |||
| 1246 | Ga0501300_028641 | |||
| 1247 | Ga0501033_0757994 | |||
| 1248 | Ga0501036_0167726 | |||
| 1249 | Ga0501039_0115452 | |||
| 1250 | Ga0501040_0243056 | |||
| 1251 | Ga0501041_0113132 | |||
| 1252 | Ga0501042_0094735 | |||
| 1253 | Ga0501046_0417797 | |||
| 1254 | Ga0501067_0404108 | |||
| 1255 | Ga0501068_0574866 | |||
| 1256 | Ga0501069_0158793 | |||
| 1257 | Ga0501072_0078114 | |||
| 1258 | Ga0501077_0129445 | |||
| 1259 | Ga0501198_019950 | |||
| 1260 | Ga0501202_013805 | |||
| 1261 | Ga0501202_052358 | |||
| 1262 | Ga0501207_013022 | |||
| 1263 | Ga0501208_031360 | |||
| 1264 | Ga0501216_020928 | |||
| 1265 | Ga0501217_006240 | |||
| 1266 | Ga0501217_078596 | |||
| 1267 | Ga0501223_008150 | |||
| 1268 | Ga0501227_100996 | |||
| 1269 | Ga0501230_003528 | |||
| 1270 | Ga0501235_000305 | |||
| 1271 | Ga0501235_079452 | |||
| 1272 | Ga0501236_006429 | |||
| 1273 | Ga0501239_003431 | |||
| 1274 | Ga0501243_122164 | |||
| 1275 | Ga0501249_003044 | |||
| 1276 | Ga0501249_034771 | |||
| 1277 | Ga0501249_114646 | |||
| 1278 | Ga0501253_001827 | |||
| 1279 | Ga0501256_002436 | |||
| 1280 | Ga0501257_003722 | |||
| 1281 | Ga0501258_009655 | |||
| 1282 | Ga0501260_002660 | |||
| 1283 | Ga0501261_027196 | |||
| 1284 | Ga0501221_003942 | |||
| 1285 | Ga0501225_0005131 | |||
| 1286 | Ga0501225_0085210 | |||
| 1287 | Ga0501225_0086966 | |||
| 1288 | Ga0501229_011160 | |||
| 1289 | Ga0501234_005034 | |||
| 1290 | Ga0501245_018975 | |||
| 1291 | Ga0501245_044039 | |||
| 1292 | Ga0501079_1006251 | |||
| 1293 | Ga0501081_0045918 | |||
| 1294 | Ga0501083_0227220 | |||
| 1295 | Ga0501265_003782 | |||
| 1296 | Ga0501266_007498 | |||
| 1297 | Ga0501267_011659 | |||
| 1298 | Ga0501283_034036 | |||
| 1299 | Ga0501035_1017100 | |||
| 1300 | Ga0501045_0090785 | |||
| 1301 | Ga0501212_003321 | |||
| 1302 | Ga0501212_016587 | |||
| 1303 | Ga0501226_030687 | |||
| 1304 | nmdc:mga06z11_408068_c1 | |||
| 1305 | nmdc:mga05p37_19830_c2 | |||
| 1306 | nmdc:mga05p37_333023_c1 | |||
| 1307 | nmdc:mga05p37_347868_c1 | |||
| 1308 | nmdc:mga05p37_384965_c1 | |||
| 1309 | nmdc:mga05p37_401195_c1 | |||
| 1310 | nmdc:mga05p37_605667_c1 | |||
| 1311 | nmdc:mga05p37_982033_c1 | |||
| 1312 | nmdc:mga05p37_994677_c1 | |||
| 1313 | nmdc:mga09592_354105_c1 | |||
| 1314 | nmdc:mga09592_5111_c1 | |||
| 1315 | nmdc:mga0qj67_159097_c1 | |||
| 1316 | nmdc:mga0qj67_184889_c1 | |||
| 1317 | nmdc:mga0qj67_233966_c1 | |||
| 1318 | nmdc:mga0qj67_795105_c1 | |||
| 1319 | nmdc:mga0qj67_816775_c1 | |||
| 1320 | nmdc:mga06r32_18820_c1 | |||
| 1321 | nmdc:mga06r32_191724_c1 | |||
| 1322 | nmdc:mga06r32_217888_c1 | |||
| 1323 | nmdc:mga06r32_286896_c1 | |||
| 1324 | nmdc:mga06r32_357707_c1 | |||
| 1325 | nmdc:mga06r32_51202_c1 | |||
| 1326 | nmdc:mga06r32_528905_c1 | |||
| 1327 | nmdc:mga08y16_121115_c1 | |||
| 1328 | nmdc:mga08y16_184049_c1 | |||
| 1329 | nmdc:mga08y16_1855623_c1 | |||
| 1330 | nmdc:mga0n895_112237_c1 | |||
| 1331 | nmdc:mga0n895_1314533_c1 | |||
| 1332 | nmdc:mga0n895_794864_c1 | |||
| 1333 | nmdc:mga0n895_85870_c1 | |||
| 1334 | nmdc:mga0rr50_311802_c1 | |||
| 1335 | nmdc:mga0rr50_743465_c1 | |||
| 1336 | nmdc:mga0rr50_877487_c1 | |||
| 1337 | nmdc:mga08x19_86804_c1 | |||
| 1338 | nmdc:mga0a205_1127702_c1 | |||
| 1339 | nmdc:mga0a205_141101_c1 | |||
| 1340 | nmdc:mga0a205_20937_c1 | |||
| 1341 | nmdc:mga0a205_392689_c1 | |||
| 1342 | nmdc:mga0a205_808630_c1 | |||
| 1343 | nmdc:mga0a205_9559_c1 | |||
| 1344 | Ga0495601_0065740 | |||
| 1345 | Ga0495595_0225192 | |||
| 1346 | Ga0495619_0093698 | |||
| 1347 | Ga0500555_030309 | |||
| 1348 | Ga0501084_0042969 | |||
| 1349 | Ga0501082_0268557 | |||
| 1350 | Ga0530510_0107539 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1rxq-assembly1.cif.gz_B | yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology | 0.8721 | 1 | 151 |
| 2yqy-assembly2.cif.gz_B | crystal structure of tt2238, a four-helix bundle protein | 0.8172 | 6 | 149 |
| 2rd9-assembly3.cif.gz_B | crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution | 0.8137 | 1 | 152 |
| 1rxq-assembly1.cif.gz_B | yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology | 0.799 | 1 | 151 |
| 2rd9-assembly1.cif.gz_A | crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution | 0.7871 | 1 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1rxqD00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8567 | 1 | 151 | 1.20.120.450 |
| 2rd9B01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8214 | 6 | 151 | 1.20.120.450 |
| 2yqyB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8172 | 6 | 149 | 1.20.120.450 |
| 1rxqD00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7852 | 1 | 151 | 1.20.120.450 |
| 2yqyB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7836 | 6 | 149 | 1.20.120.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521T5U3-F1-model_v4 | DinB family protein | 0.9952 | 5 | 156 |
|
| AF-A0A2E2B5T9-F1-model_v4 | DinB-like domain-containing protein | 0.9865 | 1 | 156 |
|
| AF-A0A317HFV2-F1-model_v4 | DinB-like domain-containing protein | 0.9838 | 1 | 157 |
|
| AF-A0A3M8G2W4-F1-model_v4 | DinB family protein | 0.9768 | 1 | 153 |
|
| AF-A0A2V8RYX4-F1-model_v4 | DinB-like domain-containing protein | 0.9716 | 5 | 157 |
|