F474193

General Info

Members Datasets Scaffolds Average Seq Length
671 277 666 203

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_326364_c1|nmdc:mga0qj67_326364_c1_412_1041
Length 209
Sequence MQANPRKTSSLRHLGKVDIAQLREAVLTIPESVWDAEDQNKPNRRYQQVVGGAWVPVPGRVFATTRHIIFRFIASQQDWRESADWPLWXXXRERLLPVMEQATRPYGYVHAAYPRVMLARMASGAEILPHMDNKPAAQWPHKIHVPLLTNPQVGFRIGDTIHHLPEGEAVEVNNLGIHAVRNDGTTDRIHLIFEYYDLDQPDPDWMLAR

Samples

Sample ID Description Type Environment
1 2643221573 Lysobacter sp. Root604 Isolate Unclassified
2 2643221695 Lysobacter sp. Root494 Isolate Unclassified
3 2643221720 Lysobacter sp. Root916 Isolate Unclassified
4 2643221728 Lysobacter sp. Root983 Isolate Unclassified
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
193 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
194 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
195 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
200 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
202 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
203 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
204 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
205 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
206 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
207 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
208 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
209 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
223 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
224 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
259 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
260 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
261 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
262 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
268 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
269 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
270 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
271 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
272 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
273 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
274 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
275 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
276 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
277 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.9
Nodule 0
Rhizoplane 4.17
Rhizosphere 85.54
Stem 0
Stem Tuber 0
Unclassified 2.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1003534 3300001915 Bacteria 3699
2 JGI24740J21852_10000857 3300001979 Bacteria 13446
3 JGI24740J21852_10001632 3300001979 Bacteria 10338
4 JGI24739J22299_10003054 3300001989 Bacteria 6393
5 JGI24739J22299_10042028 3300001989 Bacteria 1517
6 JGI24737J22298_10000013 3300001990 Bacteria 50248
7 JGI24737J22298_10012867 3300001990 Bacteria 2728
8 JGI24743J22301_10049743 3300001991 Bacteria 852
9 JGI24735J21928_10009048 3300002067 Bacteria 3207
10 JGI24735J21928_10025709 3300002067 Bacteria 1775
11 JGI24738J21930_10000935 3300002075 Bacteria 8390
12 JGI24738J21930_10001252 3300002075 Bacteria 7139
13 JGI24034J26672_10003481 3300002239 Bacteria 2198
14 JGI25151J46595_10031913 3300003187 Bacteria 2050
15 rootL2_10004035 3300003322 Bacteria 4936
16 rootL2_10285272 3300003322 Bacteria 1196
17 rootH1_10017335 3300003323 Bacteria 2589
18 Ga0055526_1033652 3300003771 Bacteria 1418
19 Ga0055524_1028215 3300003775 Bacteria 1686
20 Ga0055524_1030132 3300003775 Bacteria 1587
21 Ga0055524_1043564 3300003775 Bacteria 1102
22 Ga0055536_1010416 3300003781 Bacteria 3692
23 Ga0055536_1010650 3300003781 Bacteria 3618
24 Ga0055536_1033813 3300003781 Bacteria 1300
25 Ga0055536_1035068 3300003781 Bacteria 1259
26 Ga0055536_1061546 3300003781 Bacteria 775
27 Ga0055530_10001236 3300003791 Bacteria 19505
28 Ga0055531_10003252 3300003794 Bacteria 10433
29 Ga0055531_10005027 3300003794 Bacteria 7838
30 Ga0055531_10006427 3300003794 Bacteria 6675
31 Ga0055531_10010682 3300003794 Bacteria 4530
32 Ga0055531_10060621 3300003794 Bacteria 927
33 Ga0065715_10117808 3300005293 Bacteria 2333
34 Ga0065715_10132066 3300005293 Bacteria 1996
35 Ga0065715_10175878 3300005293 Unclassified 1512
36 Ga0065707_10355873 3300005295 Bacteria 911
37 Ga0070658_10018232 3300005327 Bacteria 5617
38 Ga0070658_10100047 3300005327 Bacteria 2396
39 Ga0070658_10399850 3300005327 Bacteria 1180
40 Ga0070676_10005926 3300005328 Bacteria 6524
41 Ga0070676_10160367 3300005328 Bacteria 1447
42 Ga0070670_100015868 3300005331 Bacteria 6463
43 Ga0070670_100092998 3300005331 Bacteria 2593
44 Ga0070670_100149741 3300005331 Bacteria 2020
45 Ga0070670_100329365 3300005331 Bacteria 1339
46 Ga0070670_100334446 3300005331 Bacteria 1329
47 Ga0068869_100000651 3300005334 Bacteria 19629
48 Ga0068869_100018311 3300005334 Bacteria 4766
49 Ga0068869_101054087 3300005334 Bacteria 710
50 Ga0070666_10002844 3300005335 Bacteria 10459
51 Ga0070666_10007885 3300005335 Bacteria 6579
52 Ga0070680_100172409 3300005336 Unclassified 1821
53 Ga0070680_100244956 3300005336 Bacteria 1515
54 Ga0070682_100009836 3300005337 Bacteria 5416
55 Ga0068868_100005000 3300005338 Bacteria 9316
56 Ga0068868_100005456 3300005338 Bacteria 8939
57 Ga0070660_100004844 3300005339 Bacteria 9298
58 Ga0070660_100015525 3300005339 Bacteria 5503
59 Ga0070660_100041116 3300005339 Bacteria 3522
60 Ga0070660_100163807 3300005339 Bacteria 1793
61 Ga0070689_100035338 3300005340 Bacteria 3819
62 Ga0070687_100019629 3300005343 Bacteria 3148
63 Ga0070661_100014003 3300005344 Bacteria 5640
64 Ga0070661_100029851 3300005344 Bacteria 3937
65 Ga0070661_100059002 3300005344 Bacteria 2813
66 Ga0070661_100134669 3300005344 Bacteria 1858
67 Ga0070661_100848087 3300005344 Bacteria 752
68 Ga0070692_10008464 3300005345 Bacteria 4591
69 Ga0070692_10020838 3300005345 Bacteria 3183
70 Ga0070668_100006224 3300005347 Bacteria 8841
71 Ga0070668_100063822 3300005347 Bacteria 2855
72 Ga0070668_100111974 3300005347 Bacteria 2173
73 Ga0070668_100124506 3300005347 Bacteria 2064
74 Ga0070668_100376224 3300005347 Bacteria 1208
75 Ga0070668_100488934 3300005347 Bacteria 1064
76 Ga0070669_100000319 3300005353 Bacteria 37553
77 Ga0070669_100090988 3300005353 Bacteria 2287
78 Ga0070669_100210320 3300005353 Bacteria 1534
79 Ga0070669_100300199 3300005353 Unclassified 1291
80 Ga0070669_100437139 3300005353 Bacteria 1076
81 Ga0070669_100494997 3300005353 Bacteria 1013
82 Ga0070675_100008839 3300005354 Bacteria 7830
83 Ga0070675_100010756 3300005354 Bacteria 7158
84 Ga0070675_100354169 3300005354 Bacteria 1302
85 Ga0070671_100000356 3300005355 Bacteria 31426
86 Ga0070671_100001617 3300005355 Bacteria 16971
87 Ga0070671_100003440 3300005355 Bacteria 12355
88 Ga0070671_100004676 3300005355 Bacteria 10862
89 Ga0070671_100036498 3300005355 Bacteria 4076
90 Ga0070671_100068598 3300005355 Bacteria 2958
91 Ga0070671_100238383 3300005355 Bacteria 1544
92 Ga0070674_100010722 3300005356 Bacteria 5554
93 Ga0070674_100017030 3300005356 Bacteria 4563
94 Ga0070674_100052279 3300005356 Bacteria 2818
95 Ga0070674_100085184 3300005356 Bacteria 2267
96 Ga0070674_100170102 3300005356 Bacteria 1660
97 Ga0070674_100286761 3300005356 Bacteria 1307
98 Ga0070674_100432097 3300005356 Bacteria 1083
99 Ga0070674_100525659 3300005356 Bacteria 989
100 Ga0070673_100000675 3300005364 Bacteria 18818
101 Ga0070673_100025388 3300005364 Bacteria 4360
102 Ga0070673_100440349 3300005364 Bacteria 1171
103 Ga0070673_100561239 3300005364 Bacteria 1038
104 Ga0070659_100001722 3300005366 Bacteria 15711
105 Ga0070659_100007979 3300005366 Bacteria 7715
106 Ga0070659_100045598 3300005366 Bacteria 3434
107 Ga0070659_100129051 3300005366 Bacteria 2052
108 Ga0070659_100174895 3300005366 Bacteria 1760
109 Ga0070659_100411285 3300005366 Bacteria 1143
110 Ga0070667_100001265 3300005367 Bacteria 22928
111 Ga0070667_100008606 3300005367 Bacteria 8459
112 Ga0070667_100044671 3300005367 Bacteria 3722
113 Ga0070667_100639329 3300005367 Unclassified 982
114 Ga0070714_100043979 3300005435 Bacteria 3780
115 Ga0070713_100693070 3300005436 Unclassified 972
116 Ga0070694_100007483 3300005444 Bacteria 6660
117 Ga0070663_100004495 3300005455 Bacteria 8213
118 Ga0070663_100256763 3300005455 Bacteria 1385
119 Ga0070678_100011915 3300005456 Bacteria 5382
120 Ga0070678_100012540 3300005456 Bacteria 5275
121 Ga0070662_100001355 3300005457 Bacteria 15049
122 Ga0070662_100002363 3300005457 Bacteria 11597
123 Ga0070662_100003335 3300005457 Bacteria 10015
124 Ga0070662_100014311 3300005457 Bacteria 5298
125 Ga0070662_100030837 3300005457 Bacteria 3756
126 Ga0070662_100073125 3300005457 Bacteria 2533
127 Ga0070681_10076341 3300005458 Bacteria 3309
128 Ga0070681_10319216 3300005458 Bacteria 1463
129 Ga0070681_10691809 3300005458 Bacteria 935
130 Ga0068867_100003550 3300005459 Bacteria 10965
131 Ga0068867_100010679 3300005459 Bacteria 6477
132 Ga0068867_100223897 3300005459 Bacteria 1517
133 Ga0068867_100934711 3300005459 Bacteria 782
134 Ga0070706_100165529 3300005467 Bacteria 2065
135 Ga0070679_100061978 3300005530 Unclassified 3727
136 Ga0070679_100084097 3300005530 Bacteria 3170
137 Ga0070679_100283444 3300005530 Bacteria 1609
138 Ga0070679_100309920 3300005530 Bacteria 1528
139 Ga0070679_100599459 3300005530 Bacteria 1045
140 Ga0070684_100146234 3300005535 Bacteria 2139
141 Ga0068853_100008649 3300005539 Bacteria 8184
142 Ga0068853_100146353 3300005539 Bacteria 2123
143 Ga0068853_100579055 3300005539 Bacteria 1065
144 Ga0070672_100000668 3300005543 Bacteria 20156
145 Ga0070672_100024701 3300005543 Bacteria 4446
146 Ga0070672_100027847 3300005543 Bacteria 4220
147 Ga0070672_100060167 3300005543 Bacteria 2990
148 Ga0070672_100103270 3300005543 Bacteria 2315
149 Ga0070672_100270766 3300005543 Unclassified 1434
150 Ga0070695_100033084 3300005545 Bacteria 3234
151 Ga0070696_100022566 3300005546 Bacteria 4277
152 Ga0070693_100007166 3300005547 Bacteria 5439
153 Ga0070665_100034682 3300005548 Bacteria 5076
154 Ga0070665_100120974 3300005548 Bacteria 2619
155 Ga0070665_100363178 3300005548 Bacteria 1454
156 Ga0070704_100108118 3300005549 Bacteria 2111
157 Ga0068855_100003914 3300005563 Bacteria 18177
158 Ga0068855_100038250 3300005563 Bacteria 5701
159 Ga0068855_100090451 3300005563 Bacteria 3532
160 Ga0070664_100005277 3300005564 Bacteria 10368
161 Ga0070664_100006472 3300005564 Bacteria 9442
162 Ga0070664_100034748 3300005564 Bacteria 4229
163 Ga0070664_100055635 3300005564 Bacteria 3360
164 Ga0070664_100065545 3300005564 Bacteria 3099
165 Ga0070664_100261231 3300005564 Bacteria 1558
166 Ga0070664_100679635 3300005564 Bacteria 958
167 Ga0068857_100000246 3300005577 Bacteria 36409
168 Ga0068857_100066598 3300005577 Bacteria 3205
169 Ga0068857_100079147 3300005577 Bacteria 2934
170 Ga0068857_100386753 3300005577 Bacteria 1300
171 Ga0068854_100000337 3300005578 Bacteria 30470
172 Ga0068854_100008850 3300005578 Bacteria 6479
173 Ga0068854_100052088 3300005578 Bacteria 2934
174 Ga0068854_100269087 3300005578 Unclassified 1367
175 Ga0068854_100292429 3300005578 Bacteria 1315
176 Ga0068856_100310228 3300005614 Bacteria 1595
177 Ga0068852_100004492 3300005616 Bacteria 9861
178 Ga0068852_100015237 3300005616 Bacteria 5953
179 Ga0068852_100112161 3300005616 Bacteria 2481
180 Ga0068852_100526411 3300005616 Bacteria 1180
181 Ga0068859_100020576 3300005617 Bacteria 6621
182 Ga0068859_100102752 3300005617 Bacteria 2916
183 Ga0068864_100000810 3300005618 Bacteria 26293
184 Ga0068864_100034527 3300005618 Bacteria 4302
185 Ga0068864_100069433 3300005618 Bacteria 3064
186 Ga0068864_100078348 3300005618 Bacteria 2892
187 Ga0068861_100002114 3300005719 Bacteria 12859
188 Ga0068861_100118555 3300005719 Bacteria 2132
189 Ga0068861_100376400 3300005719 Bacteria 1253
190 Ga0068851_10046854 3300005834 Bacteria 2188
191 Ga0068870_10029673 3300005840 Bacteria 2757
192 Ga0068863_100006391 3300005841 Bacteria 11555
193 Ga0068863_100711167 3300005841 Bacteria 999
194 Ga0068858_100001398 3300005842 Bacteria 24841
195 Ga0068858_100005575 3300005842 Bacteria 12316
196 Ga0068858_100546919 3300005842 Bacteria 1121
197 Ga0068858_101116584 3300005842 Bacteria 774
198 Ga0068860_100013628 3300005843 Bacteria 7969
199 Ga0068860_100107091 3300005843 Bacteria 2671
200 Ga0068860_100193083 3300005843 Bacteria 1971
201 Ga0068862_100021398 3300005844 Bacteria 5404
202 Ga0068862_100071902 3300005844 Bacteria 2987
203 Ga0068862_100276550 3300005844 Bacteria 1537
204 Ga0081540_1093870 3300005983 Bacteria 1312
205 Ga0097621_100105496 3300006237 Bacteria 2376
206 Ga0097621_100538086 3300006237 Bacteria 1062
207 Ga0097621_100820258 3300006237 Bacteria 863
208 Ga0068871_100235563 3300006358 Unclassified 1590
209 Ga0075428_100028540 3300006844 Bacteria 6173
210 Ga0075428_100284426 3300006844 Bacteria 1779
211 Ga0075431_100157480 3300006847 Bacteria 2336
212 Ga0075429_100064132 3300006880 Bacteria 3200
213 Ga0068865_100000374 3300006881 Bacteria 24788
214 Ga0068865_100470784 3300006881 Bacteria 1042
215 Ga0097620_100020575 3300006931 Bacteria 6621
216 Ga0097620_100102753 3300006931 Bacteria 2916
217 Ga0097620_100696124 3300006931 Bacteria 1107
218 Ga0105240_10031565 3300009093 Bacteria 6868
219 Ga0105240_10547186 3300009093 Unclassified 1281
220 Ga0111539_10209784 3300009094 Bacteria 2270
221 Ga0105245_10000275 3300009098 Bacteria 48749
222 Ga0105243_10100127 3300009148 Bacteria 2404
223 Ga0105241_10021669 3300009174 Bacteria 4754
224 Ga0105241_10201404 3300009174 Unclassified 1663
225 Ga0105242_10279981 3300009176 Bacteria 1515
226 Ga0105248_10000001 3300009177 Bacteria 1881304
227 Ga0105248_10001002 3300009177 Bacteria 31241
228 Ga0105248_10008541 3300009177 Bacteria 11243
229 Ga0105248_10041900 3300009177 Bacteria 5134
230 Ga0105248_10091476 3300009177 Bacteria 3426
231 Ga0105237_10003164 3300009545 Bacteria 19773
232 Ga0105238_10067722 3300009551 Bacteria 3571
233 Ga0105238_10185367 3300009551 Bacteria 2057
234 Ga0105249_10053856 3300009553 Bacteria 3678
235 Ga0105249_10095314 3300009553 Bacteria 2790
236 Ga0105239_10024971 3300010375 Bacteria 6583
237 Ga0105239_10877812 3300010375 Bacteria 1029
238 Ga0105246_10012920 3300011119 Bacteria 5224
239 Ga0157373_10025963 3300013100 Bacteria 4233
240 Ga0157373_10031370 3300013100 Bacteria 3826
241 Ga0157373_10043878 3300013100 Bacteria 3193
242 Ga0157373_10071003 3300013100 Bacteria 2460
243 Ga0157371_10000637 3300013102 Bacteria 41589
244 Ga0157371_10060928 3300013102 Bacteria 2675
245 Ga0157371_10137533 3300013102 Bacteria 1740
246 Ga0157371_10216097 3300013102 Unclassified 1376
247 Ga0157370_10006047 3300013104 Bacteria 13441
248 Ga0157374_10046999 3300013296 Bacteria 3999
249 Ga0157378_10002341 3300013297 Bacteria 16827
250 Ga0157378_10246727 3300013297 Bacteria 1708
251 Ga0163162_10058474 3300013306 Bacteria 3884
252 Ga0163162_10168603 3300013306 Bacteria 2314
253 Ga0157372_10146066 3300013307 Bacteria 2727
254 Ga0157372_10164726 3300013307 Bacteria 2563
255 Ga0157375_10088799 3300013308 Bacteria 3146
256 Ga0157375_10646789 3300013308 Bacteria 1214
257 Ga0157375_11315540 3300013308 Bacteria 850
258 Ga0157380_10009958 3300014326 Bacteria 6822
259 Ga0157380_10825366 3300014326 Bacteria 946
260 Ga0157379_10121365 3300014968 Bacteria 2351
261 Ga0207425_1017920 3300025245 Bacteria 1546
262 Ga0209130_1004853 3300025284 Bacteria 4909
263 Ga0209675_1010132 3300025291 Bacteria 3248
264 Ga0209675_1015047 3300025291 Bacteria 2319
265 Ga0209676_1000853 3300025292 Bacteria 39341
266 Ga0209676_1001374 3300025292 Bacteria 23748
267 Ga0209676_1004286 3300025292 Bacteria 8042
268 Ga0209676_1004361 3300025292 Bacteria 7920
269 Ga0209676_1009285 3300025292 Bacteria 4260
270 Ga0209676_1032853 3300025292 Bacteria 1554
271 Ga0209676_1038842 3300025292 Bacteria 1358
272 Ga0209025_1001514 3300025294 Bacteria 29830
273 Ga0209025_1045192 3300025294 Bacteria 1829
274 Ga0209050_1000652 3300025298 Bacteria 53645
275 Ga0209050_1010093 3300025298 Bacteria 4705
276 Ga0209256_1004674 3300025299 Bacteria 8409
277 Ga0209256_1005718 3300025299 Bacteria 6973
278 Ga0209256_1007836 3300025299 Bacteria 5132
279 Ga0209051_1018108 3300025303 Bacteria 3126
280 Ga0209257_1000378 3300025304 Bacteria 88945
281 Ga0209257_1001186 3300025304 Bacteria 32842
282 Ga0209257_1001359 3300025304 Bacteria 29586
283 Ga0209257_1001512 3300025304 Bacteria 27306
284 Ga0209257_1001632 3300025304 Bacteria 25694
285 Ga0209257_1031756 3300025304 Bacteria 1685
286 Ga0209257_1065175 3300025304 Bacteria 977
287 Ga0207697_10000112 3300025315 Bacteria 37791
288 Ga0207697_10128414 3300025315 Bacteria 1094
289 Ga0207656_10031573 3300025321 Bacteria 2196
290 Ga0207682_10053215 3300025893 Bacteria 1679
291 Ga0207688_10003553 3300025901 Bacteria 8506
292 Ga0207688_10042413 3300025901 Bacteria 2533
293 Ga0207688_10211327 3300025901 Bacteria 1166
294 Ga0207680_10000271 3300025903 Bacteria 24747
295 Ga0207680_10005882 3300025903 Bacteria 5891
296 Ga0207680_10077597 3300025903 Bacteria 2078
297 Ga0207647_10000101 3300025904 Bacteria 66258
298 Ga0207647_10001771 3300025904 Bacteria 16572
299 Ga0207647_10013159 3300025904 Bacteria 5748
300 Ga0207645_10000896 3300025907 Bacteria 24720
301 Ga0207645_10009043 3300025907 Bacteria 6915
302 Ga0207645_10265398 3300025907 Bacteria 1138
303 Ga0207643_10181846 3300025908 Bacteria 1273
304 Ga0207705_10001965 3300025909 Bacteria 16037
305 Ga0207705_10004972 3300025909 Bacteria 9974
306 Ga0207705_10051806 3300025909 Bacteria 2954
307 Ga0207707_10162887 3300025912 Bacteria 1950
308 Ga0207695_10070818 3300025913 Bacteria 3562
309 Ga0207671_10006191 3300025914 Bacteria 10744
310 Ga0207657_10002057 3300025919 Bacteria 21773
311 Ga0207657_10008696 3300025919 Bacteria 10278
312 Ga0207657_10020154 3300025919 Bacteria 6309
313 Ga0207657_10026236 3300025919 Bacteria 5358
314 Ga0207657_10083306 3300025919 Bacteria 2683
315 Ga0207657_10127354 3300025919 Bacteria 2090
316 Ga0207649_10009357 3300025920 Bacteria 5362
317 Ga0207649_10062811 3300025920 Bacteria 2342
318 Ga0207649_10104872 3300025920 Bacteria 1878
319 Ga0207652_10072744 3300025921 Unclassified 2990
320 Ga0207652_10215798 3300025921 Bacteria 1728
321 Ga0207652_10218738 3300025921 Bacteria 1716
322 Ga0207681_10001255 3300025923 Bacteria 16359
323 Ga0207681_10025491 3300025923 Bacteria 3804
324 Ga0207681_10402425 3300025923 Bacteria 1106
325 Ga0207681_10452786 3300025923 Bacteria 1044
326 Ga0207694_10182980 3300025924 Bacteria 1700
327 Ga0207650_10030898 3300025925 Bacteria 3863
328 Ga0207650_10710764 3300025925 Bacteria 849
329 Ga0207659_10002669 3300025926 Bacteria 10632
330 Ga0207659_10060116 3300025926 Bacteria 2734
331 Ga0207659_10173203 3300025926 Bacteria 1704
332 Ga0207687_10001375 3300025927 Bacteria 16604
333 Ga0207700_10715139 3300025928 Unclassified 894
334 Ga0207644_10000794 3300025931 Bacteria 20032
335 Ga0207644_10006565 3300025931 Bacteria 7578
336 Ga0207644_10013382 3300025931 Bacteria 5467
337 Ga0207644_10015555 3300025931 Bacteria 5110
338 Ga0207644_10083017 3300025931 Bacteria 2372
339 Ga0207644_10282663 3300025931 Bacteria 1333
340 Ga0207690_10000830 3300025932 Bacteria 19806
341 Ga0207690_10001735 3300025932 Bacteria 13389
342 Ga0207690_10012431 3300025932 Bacteria 5091
343 Ga0207690_10058154 3300025932 Bacteria 2614
344 Ga0207690_10284017 3300025932 Bacteria 1290
345 Ga0207690_10300264 3300025932 Bacteria 1256
346 Ga0207690_10515515 3300025932 Unclassified 968
347 Ga0207706_10000318 3300025933 Bacteria 52104
348 Ga0207706_10002476 3300025933 Bacteria 17998
349 Ga0207706_10004182 3300025933 Bacteria 13591
350 Ga0207706_10011384 3300025933 Bacteria 8104
351 Ga0207706_10019015 3300025933 Bacteria 6179
352 Ga0207706_10034041 3300025933 Bacteria 4534
353 Ga0207706_10037251 3300025933 Bacteria 4320
354 Ga0207706_10048438 3300025933 Bacteria 3758
355 Ga0207706_10518769 3300025933 Bacteria 1027
356 Ga0207706_10630625 3300025933 Bacteria 919
357 Ga0207686_10503411 3300025934 Bacteria 940
358 Ga0207709_10145224 3300025935 Bacteria 1636
359 Ga0207709_10228144 3300025935 Unclassified 1347
360 Ga0207670_10024552 3300025936 Bacteria 3769
361 Ga0207669_10003616 3300025937 Bacteria 6705
362 Ga0207669_10013957 3300025937 Bacteria 4012
363 Ga0207669_10020878 3300025937 Bacteria 3444
364 Ga0207669_10473846 3300025937 Bacteria 996
365 Ga0207669_10582272 3300025937 Bacteria 907
366 Ga0207704_10003539 3300025938 Bacteria 7103
367 Ga0207704_10147272 3300025938 Bacteria 1656
368 Ga0207691_10000593 3300025940 Bacteria 36106
369 Ga0207691_10002976 3300025940 Bacteria 16541
370 Ga0207691_10016716 3300025940 Bacteria 6967
371 Ga0207691_10040559 3300025940 Bacteria 4300
372 Ga0207691_10134588 3300025940 Bacteria 2181
373 Ga0207691_10157034 3300025940 Bacteria 1997
374 Ga0207691_10176782 3300025940 Bacteria 1867
375 Ga0207711_10000001 3300025941 Bacteria 1325674
376 Ga0207711_10000823 3300025941 Bacteria 30322
377 Ga0207711_10003620 3300025941 Bacteria 13367
378 Ga0207711_10077818 3300025941 Bacteria 2892
379 Ga0207689_10000016 3300025942 Bacteria 118140
380 Ga0207661_10014686 3300025944 Bacteria 5745
381 Ga0207679_10031679 3300025945 Bacteria 3703
382 Ga0207679_10089834 3300025945 Bacteria 2372
383 Ga0207679_10196631 3300025945 Bacteria 1681
384 Ga0207679_10262005 3300025945 Bacteria 1475
385 Ga0207679_10351965 3300025945 Bacteria 1284
386 Ga0207667_10015822 3300025949 Bacteria 8549
387 Ga0207667_10031806 3300025949 Bacteria 5693
388 Ga0207667_10256584 3300025949 Bacteria 1788
389 Ga0207651_10074504 3300025960 Bacteria 2418
390 Ga0207651_10198928 3300025960 Bacteria 1604
391 Ga0207651_10915413 3300025960 Bacteria 781
392 Ga0207712_10000146 3300025961 Bacteria 73378
393 Ga0207668_10000070 3300025972 Bacteria 78666
394 Ga0207668_10058010 3300025972 Bacteria 2704
395 Ga0207668_10189620 3300025972 Bacteria 1628
396 Ga0207668_10223882 3300025972 Unclassified 1512
397 Ga0207668_10669307 3300025972 Bacteria 910
398 Ga0207640_10007415 3300025981 Bacteria 6053
399 Ga0207640_10129552 3300025981 Bacteria 1821
400 Ga0207640_10263868 3300025981 Unclassified 1344
401 Ga0207658_10006101 3300025986 Bacteria 8228
402 Ga0207658_10012129 3300025986 Bacteria 5878
403 Ga0207658_10014061 3300025986 Bacteria 5479
404 Ga0207677_10001192 3300026023 Bacteria 14092
405 Ga0207677_10004539 3300026023 Bacteria 7468
406 Ga0207677_10913905 3300026023 Bacteria 792
407 Ga0207703_10004651 3300026035 Bacteria 11214
408 Ga0207703_10070440 3300026035 Bacteria 2886
409 Ga0207639_10018488 3300026041 Bacteria 4954
410 Ga0207639_10162971 3300026041 Bacteria 1881
411 Ga0207639_10330202 3300026041 Bacteria 1357
412 Ga0207678_10003724 3300026067 Bacteria 13714
413 Ga0207678_10106477 3300026067 Bacteria 2392
414 Ga0207678_10262728 3300026067 Bacteria 1479
415 Ga0207702_10020794 3300026078 Bacteria 5428
416 Ga0207702_10272806 3300026078 Bacteria 1596
417 Ga0207641_10024405 3300026088 Bacteria 4984
418 Ga0207641_10089142 3300026088 Bacteria 2695
419 Ga0207648_10001147 3300026089 Bacteria 29705
420 Ga0207648_10007206 3300026089 Bacteria 10966
421 Ga0207676_10001961 3300026095 Bacteria 14987
422 Ga0207676_10081042 3300026095 Bacteria 2636
423 Ga0207676_10094261 3300026095 Bacteria 2466
424 Ga0207676_10102195 3300026095 Bacteria 2379
425 Ga0207674_10000114 3300026116 Bacteria 93676
426 Ga0207674_10006404 3300026116 Bacteria 13848
427 Ga0207674_10078059 3300026116 Bacteria 3316
428 Ga0207675_100143220 3300026118 Bacteria 2271
429 Ga0207683_10048333 3300026121 Bacteria 3726
430 Ga0207683_10131758 3300026121 Bacteria 2249
431 Ga0207683_10484568 3300026121 Unclassified 1142
432 Ga0207683_10779031 3300026121 Bacteria 888
433 Ga0207698_10002635 3300026142 Bacteria 10659
434 Ga0207698_10068870 3300026142 Unclassified 2796
435 Ga0207698_10322858 3300026142 Bacteria 1447
436 Ga0209974_10008000 3300027876 Bacteria 3623
437 Ga0209974_10079573 3300027876 Bacteria 1126
438 Ga0268266_10022686 3300028379 Bacteria 5344
439 Ga0268266_10394512 3300028379 Bacteria 1307
440 Ga0268265_10010369 3300028380 Bacteria 6294
441 Ga0268265_10016177 3300028380 Bacteria 5121
442 Ga0268265_10151545 3300028380 Bacteria 1956
443 Ga0268264_10000594 3300028381 Bacteria 43886
444 Ga0268264_10054786 3300028381 Bacteria 3331
445 Ga0268264_10321431 3300028381 Unclassified 1463
446 Ga0265338_10082676 3300028800 Bacteria 2688
447 Ga0316182_1184530 3300030745 Bacteria 3386
448 Ga0316182_1278238 3300030745 Bacteria 3352
449 Ga0307408_100105786 3300031548 Bacteria 2152
450 Ga0307408_100142030 3300031548 Bacteria 1885
451 Ga0307408_100315572 3300031548 Bacteria 1315
452 Ga0307408_100379744 3300031548 Bacteria 1208
453 Ga0307408_100547643 3300031548 Bacteria 1020
454 Ga0265314_10004913 3300031711 Bacteria 12211
455 Ga0307405_10020352 3300031731 Bacteria 3706
456 Ga0307405_10032415 3300031731 Bacteria 3089
457 Ga0307405_10061804 3300031731 Bacteria 2369
458 Ga0307405_10331418 3300031731 Bacteria 1166
459 Ga0307413_10060648 3300031824 Bacteria 2330
460 Ga0307413_10116011 3300031824 Bacteria 1803
461 Ga0307413_10129647 3300031824 Bacteria 1723
462 Ga0307413_10140456 3300031824 Bacteria 1668
463 Ga0307413_10262954 3300031824 Unclassified 1287
464 Ga0307413_10920467 3300031824 Bacteria 744
465 Ga0307410_10005694 3300031852 Bacteria 6633
466 Ga0307410_10036610 3300031852 Bacteria 3197
467 Ga0307410_10040475 3300031852 Bacteria 3067
468 Ga0307410_10164828 3300031852 Bacteria 1664
469 Ga0307410_10169745 3300031852 Bacteria 1642
470 Ga0307410_10407287 3300031852 Bacteria 1100
471 Ga0307406_10030245 3300031901 Bacteria 3286
472 Ga0307406_10080479 3300031901 Bacteria 2163
473 Ga0307406_10194182 3300031901 Bacteria 1489
474 Ga0307407_10024481 3300031903 Bacteria 3167
475 Ga0307407_10058005 3300031903 Bacteria 2249
476 Ga0307407_10073810 3300031903 Bacteria 2040
477 Ga0307407_10300111 3300031903 Bacteria 1120
478 Ga0307407_10321665 3300031903 Bacteria 1086
479 Ga0307412_10007004 3300031911 Bacteria 6400
480 Ga0307412_10061212 3300031911 Bacteria 2530
481 Ga0307412_10125587 3300031911 Bacteria 1855
482 Ga0307412_10169349 3300031911 Bacteria 1631
483 Ga0307412_10520437 3300031911 Bacteria 994
484 Ga0307412_10749215 3300031911 Bacteria 843
485 Ga0307409_100049266 3300031995 Bacteria 3211
486 Ga0307409_100224737 3300031995 Bacteria 1697
487 Ga0307409_100495898 3300031995 Bacteria 1188
488 Ga0307416_100016481 3300032002 Bacteria 5139
489 Ga0307416_100069871 3300032002 Bacteria 2909
490 Ga0307416_100208283 3300032002 Bacteria 1862
491 Ga0307416_100228950 3300032002 Bacteria 1790
492 Ga0307416_100341072 3300032002 Bacteria 1511
493 Ga0307414_10017919 3300032004 Bacteria 4345
494 Ga0307414_10065996 3300032004 Bacteria 2585
495 Ga0307414_10108139 3300032004 Bacteria 2109
496 Ga0307414_10136988 3300032004 Bacteria 1910
497 Ga0307414_10226017 3300032004 Bacteria 1540
498 Ga0307414_10527122 3300032004 Bacteria 1049
499 Ga0307411_10003991 3300032005 Bacteria 6971
500 Ga0307411_10013366 3300032005 Bacteria 4528
501 Ga0307411_10069189 3300032005 Bacteria 2383
502 Ga0307411_10120820 3300032005 Bacteria 1895
503 Ga0307411_10187882 3300032005 Bacteria 1574
504 Ga0307411_10609363 3300032005 Bacteria 940
505 Ga0307411_11272591 3300032005 Bacteria 669
506 Ga0307415_100007851 3300032126 Bacteria 5868
507 Ga0307415_100169313 3300032126 Bacteria 1702
508 Ga0307415_100172209 3300032126 Bacteria 1689
509 Ga0307415_100533370 3300032126 Bacteria 1032
510 Ga0307415_100645149 3300032126 Bacteria 948
511 Ga0395899_0395559 3300037312 Bacteria 915
512 Ga0395900_0041349 3300037418 Bacteria 4752
513 Ga0395900_0049368 3300037418 Bacteria 4335
514 Ga0395900_0086592 3300037418 Bacteria 3219
515 Ga0395900_0317473 3300037418 Bacteria 1539
516 Ga0395900_0820216 3300037418 Bacteria 857
517 Ga0395898_0027957 3300037466 Bacteria 5656
518 Ga0395898_0093912 3300037466 Bacteria 2882
519 Ga0395898_0157863 3300037466 Bacteria 2169
520 Ga0395898_0919627 3300037466 Bacteria 812
521 Ga0395905_0000257 3300037471 Bacteria 79555
522 Ga0395905_0020203 3300037471 Bacteria 6309
523 Ga0395905_0026307 3300037471 Bacteria 5487
524 Ga0395905_0045919 3300037471 Bacteria 4097
525 Ga0395905_0046043 3300037471 Bacteria 4091
526 Ga0395905_0065556 3300037471 Bacteria 3400
527 Ga0395905_0069625 3300037471 Bacteria 3296
528 Ga0395905_0174002 3300037471 Bacteria 2021
529 Ga0395905_0204831 3300037471 Bacteria 1849
530 Ga0395905_0272106 3300037471 Unclassified 1580
531 Ga0395905_0298713 3300037471 Bacteria 1497
532 Ga0395905_0305460 3300037471 Bacteria 1479
533 Ga0395905_0317540 3300037471 Bacteria 1447
534 Ga0395905_0537686 3300037471 Unclassified 1069
535 Ga0395905_0660135 3300037471 Unclassified 948
536 Ga0395905_0817775 3300037471 Bacteria 835
537 Ga0395901_0042655 3300038443 Bacteria 4704
538 Ga0395901_0302129 3300038443 Bacteria 1659
539 Ga0395901_0393420 3300038443 Bacteria 1425
540 Ga0395901_0979877 3300038443 Bacteria 822
541 Ga0395901_1009510 3300038443 Bacteria 807
542 Ga0395901_1154210 3300038443 Bacteria 742
543 Ga0439465_0004297 3300041413 Bacteria 4625
544 Ga0451793_1352091 3300041452 Bacteria 925
545 Ga0451802_0622788 3300041460 Unclassified 1220
546 Ga0451806_810621 3300041462 Unclassified 2009
547 Ga0451807_1133111 3300041486 Bacteria 3618
548 Ga0451851_0473752 3300041507 Bacteria 1095
549 Ga0451853_0563708 3300041512 Unclassified 751
550 Ga0439441_051689 3300042001 Bacteria 848
551 Ga0439432_010691 3300042006 Bacteria 3174
552 Ga0439449_0007223 3300042007 Bacteria 4226
553 Ga0439449_0108666 3300042007 Bacteria 1027
554 Ga0439455_0063386 3300042012 Bacteria 983
555 Ga0439462_0001989 3300042015 Bacteria 4675
556 Ga0439462_0113252 3300042015 Bacteria 752
557 Ga0450917_000904 3300042120 Bacteria 2179
558 Ga0450905_002655 3300042142 Bacteria 2309
559 Ga0450889_005177 3300042144 Bacteria 1295
560 Ga0439464_0001880 3300042439 Bacteria 5076
561 Ga0439460_0004452 3300042461 Bacteria 3417
562 Ga0439440_0055322 3300042993 Bacteria 1001
563 Ga0466972_0257898 3300044658 Bacteria 815
564 Ga0466966_0012063 3300044684 Bacteria 5726
565 Ga0466966_0106303 3300044684 Bacteria 1732
566 Ga0466961_0466573 3300044693 Bacteria 764
567 Ga0466961_0485283 3300044693 Bacteria 747
568 Ga0466963_0299563 3300044694 Bacteria 1131
569 Ga0466963_0532399 3300044694 Bacteria 830
570 Ga0466957_0232497 3300044842 Bacteria 1221
571 Ga0466959_0075353 3300045049 Bacteria 2438
572 Ga0466959_0100096 3300045049 Bacteria 2075
573 Ga0466958_0134895 3300045836 Bacteria 1552
574 Ga0466958_0143927 3300045836 Bacteria 1502
575 Ga0466967_0047290 3300045976 Bacteria 3750
576 Ga0466967_0666590 3300045976 Bacteria 1029
577 Ga0495650_0000744 3300046471 Bacteria 40840
578 Ga0495650_0044906 3300046471 Bacteria 1864
579 Ga0495606_0087714 3300046507 Bacteria 1920
580 Ga0495637_0006928 3300046520 Bacteria 5655
581 Ga0495648_0000029 3300046524 Bacteria 223499
582 Ga0495663_0000865 3300046525 Bacteria 10240
583 Ga0495663_0034764 3300046525 Bacteria 1511
584 Ga0495663_0071238 3300046525 Bacteria 1107
585 Ga0495598_0009011 3300046537 Bacteria 2343
586 Ga0495598_0092411 3300046537 Bacteria 989
587 Ga0495621_0061372 3300046539 Bacteria 1365
588 Ga0495656_0081099 3300046615 Bacteria 1464
589 Ga0495668_0000014 3300046616 Bacteria 442055
590 Ga0495668_0017889 3300046616 Bacteria 4106
591 Ga0495625_0000777 3300046660 Bacteria 44363
592 Ga0495625_0337356 3300046660 Bacteria 956
593 Ga0495659_0133207 3300046664 Bacteria 987
594 Ga0495669_0000046 3300046684 Bacteria 83405
595 Ga0495669_0081276 3300046684 Bacteria 1487
596 Ga0495669_0307110 3300046684 Bacteria 765
597 Ga0495670_0077858 3300046691 Bacteria 1686
598 Ga0495636_0000118 3300047318 Bacteria 32623
599 Ga0495636_0014871 3300047318 Bacteria 3097
600 Ga0495636_0040629 3300047318 Bacteria 1928
601 Ga0495672_0002375 3300047320 Bacteria 17376
602 Ga0495685_032435 3300047447 Unclassified 1795
603 Ga0495673_0000597 3300047469 Bacteria 36148
604 Ga0495673_0005592 3300047469 Bacteria 7568
605 Ga0495686_0001938 3300047472 Bacteria 20595
606 Ga0495686_0003054 3300047472 Bacteria 14838
607 Ga0495686_0177379 3300047472 Bacteria 1236
608 Ga0496100_0249157 3300048903 Bacteria 1313
609 Ga0496100_0853191 3300048903 Bacteria 714
610 Ga0496101_0065888 3300048904 Bacteria 2641
611 Ga0496101_0072488 3300048904 Bacteria 2528
612 Ga0496101_0118819 3300048904 Bacteria 1997
613 Ga0496102_0622109 3300048905 Bacteria 1003
614 Ga0496106_0096639 3300048909 Bacteria 2286
615 Ga0496107_0000072 3300048910 Bacteria 48700
616 Ga0496107_0021772 3300048910 Bacteria 4530
617 Ga0496107_0067447 3300048910 Bacteria 2596
618 Ga0496108_0010651 3300048911 Bacteria 7459
619 Ga0496108_0278259 3300048911 Bacteria 1457
620 Ga0496109_0150348 3300048912 Bacteria 2180
621 Ga0496109_0170229 3300048912 Bacteria 2043
622 Ga0496110_0051866 3300048913 Bacteria 3605
623 Ga0496110_0722706 3300048913 Bacteria 898
624 Ga0496111_0028532 3300048914 Bacteria 3955
625 Ga0496111_0489035 3300048914 Bacteria 906
626 Ga0496112_0013201 3300048915 Bacteria 7620
627 Ga0496112_0063780 3300048915 Bacteria 3634
628 Ga0496113_0009123 3300048916 Bacteria 6499
629 Ga0496113_0529771 3300048916 Bacteria 945
630 Ga0496114_0061753 3300048917 Bacteria 3135
631 Ga0496115_0000488 3300048918 Bacteria 31339
632 Ga0496117_0067494 3300048920 Bacteria 2420
633 Ga0496118_0003515 3300048921 Bacteria 19633
634 Ga0496121_0002753 3300048924 Bacteria 26136
635 Ga0496121_0307995 3300048924 Bacteria 1072
636 Ga0496125_0111724 3300048928 Bacteria 1976
637 Ga0496126_0001950 3300048929 Bacteria 29310
638 Ga0496126_0309947 3300048929 Bacteria 1300
639 Ga0501043_0038647 3300049579 Bacteria 3752
640 Ga0501046_0122514 3300049580 Bacteria 1977
641 Ga0501067_0149612 3300049583 Bacteria 1301
642 Ga0501074_0180267 3300049590 Unclassified 1507
643 Ga0501223_040798 3300049663 Bacteria 901
644 Ga0501257_011848 3300049686 Bacteria 1993
645 Ga0501257_070402 3300049686 Bacteria 893
646 Ga0501221_026311 3300049704 Bacteria 1182
647 Ga0501273_036973 3300049770 Bacteria 712
648 Ga0501279_019839 3300049775 Bacteria 953
649 nmdc:mga09592_23810_c1 3300050508 Bacteria 5059
650 nmdc:mga0qj67_118338_c1 3300050509 Bacteria 2142
651 nmdc:mga0qj67_326364_c1 3300050509 Bacteria 1242
652 nmdc:mga0qj67_513599_c1 3300050509 Bacteria 963
653 nmdc:mga06r32_602170_c1 3300050510 Bacteria 1070
654 nmdc:mga06r32_7607_c1 3300050510 Bacteria 9742
655 nmdc:mga08y16_188500_c1 3300050511 Bacteria 2140
656 Ga0500644_0000043 3300053088 Bacteria 76139
657 Ga0500566_0260410 3300053094 Bacteria 838
658 Ga0500556_0000466 3300053104 Bacteria 28540
659 Ga0500614_002794 3300053123 Bacteria 3845
660 Ga0500559_0064128 3300053136 Bacteria 1643
661 Ga0500564_000015 3300053138 Bacteria 52672
662 Ga0500604_0000478 3300053151 Bacteria 11043
663 Ga0500619_035578 3300053154 Unclassified 1546
664 Ga0500622_0003266 3300053156 Bacteria 10998
665 Ga0500645_000289 3300053730 Bacteria 36194
666 Ga0500645_021925 3300053730 Bacteria 1968

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100172409 Ga0070680_1001724092 176
2 3300005530 Ga0070679_100061978 Ga0070679_1000619781 176
3 3300025921 Ga0207652_10072744 Ga0207652_100727443 176
4 3300037471 Ga0395905_0204831 Ga0395905_0204831_11_568 181
5 3300010375 Ga0105239_10877812 Ga0105239_108778122 183
6 3300044693 Ga0466961_0485283 Ga0466961_0485283_149_703 183
7 3300009177 Ga0105248_10041900 Ga0105248_100419006 184
8 3300037471 Ga0395905_0317540 Ga0395905_0317540_288_842 184
9 3300048903 Ga0496100_0853191 Ga0496100_0853191_110_664 184
10 3300048904 Ga0496101_0065888 Ga0496101_0065888_2027_2581 184
11 3300048910 Ga0496107_0021772 Ga0496107_0021772_260_814 184
12 3300048911 Ga0496108_0010651 Ga0496108_0010651_6102_6656 184
13 3300048913 Ga0496110_0051866 Ga0496110_0051866_1206_1760 184
14 3300048913 Ga0496110_0722706 Ga0496110_0722706_318_872 184
15 3300048914 Ga0496111_0028532 Ga0496111_0028532_3384_3938 184
16 3300048914 Ga0496111_0489035 Ga0496111_0489035_324_878 184
17 3300048915 Ga0496112_0013201 Ga0496112_0013201_7049_7603 184
18 3300048916 Ga0496113_0009123 Ga0496113_0009123_1690_2244 184
19 3300005530 Ga0070679_100309920 Ga0070679_1003099202 185
20 3300046525 Ga0495663_0034764 Ga0495663_0034764_937_1497 186
21 3300005293 Ga0065715_10117808 Ga0065715_101178083 188
22 3300031711 Ga0265314_10004913 Ga0265314_100049135 189
23 3300047472 Ga0495686_0003054 Ga0495686_0003054_5877_6446 189
24 3300048920 Ga0496117_0067494 Ga0496117_0067494_448_1017 189
25 3300048921 Ga0496118_0003515 Ga0496118_0003515_10655_11224 189
26 3300048929 Ga0496126_0309947 Ga0496126_0309947_559_1140 189
27 3300005436 Ga0070713_100693070 Ga0070713_1006930702 191
28 3300025928 Ga0207700_10715139 Ga0207700_107151391 191
29 3300005616 Ga0068852_100015237 Ga0068852_1000152374 192
30 3300009093 Ga0105240_10031565 Ga0105240_100315655 192
31 3300009174 Ga0105241_10021669 Ga0105241_100216694 192
32 3300009177 Ga0105248_10000001 Ga0105248_100000011441 192
33 3300025913 Ga0207695_10070818 Ga0207695_100708183 192
34 3300025941 Ga0207711_10000001 Ga0207711_10000001433 192
35 3300026142 Ga0207698_10068870 Ga0207698_100688703 192
36 3300037471 Ga0395905_0020203 Ga0395905_0020203_5116_5709 192
37 3300053154 Ga0500619_035578 Ga0500619_035578_317_895 192
38 3300005331 Ga0070670_100149741 Ga0070670_1001497411 193
39 3300005331 Ga0070670_100334446 Ga0070670_1003344462 193
40 3300005344 Ga0070661_100848087 Ga0070661_1008480871 193
41 3300005356 Ga0070674_100170102 Ga0070674_1001701022 193
42 3300005719 Ga0068861_100376400 Ga0068861_1003764002 193
43 3300009176 Ga0105242_10279981 Ga0105242_102799812 193
44 3300025925 Ga0207650_10710764 Ga0207650_107107641 193
45 3300025931 Ga0207644_10282663 Ga0207644_102826632 193
46 3300025933 Ga0207706_10630625 Ga0207706_106306251 193
47 3300025934 Ga0207686_10503411 Ga0207686_105034112 193
48 3300025935 Ga0207709_10145224 Ga0207709_101452242 193
49 3300025940 Ga0207691_10002976 Ga0207691_1000297614 193
50 3300031824 Ga0307413_10920467 Ga0307413_109204672 193
51 3300041507 Ga0451851_0473752 Ga0451851_0473752_99_683 193
52 3300046664 Ga0495659_0133207 Ga0495659_0133207_221_802 193
53 3300005366 Ga0070659_100411285 Ga0070659_1004112852 194
54 3300053156 Ga0500622_0003266 Ga0500622_0003266_6168_6761 194
55 3300005458 Ga0070681_10691809 Ga0070681_106918092 195
56 3300006844 Ga0075428_100028540 Ga0075428_1000285403 195
57 3300006844 Ga0075428_100284426 Ga0075428_1002844262 195
58 3300006847 Ga0075431_100157480 Ga0075431_1001574802 195
59 3300006880 Ga0075429_100064132 Ga0075429_1000641322 195
60 3300042001 Ga0439441_051689 Ga0439441_051689_23_649 195
61 3300042461 Ga0439460_0004452 Ga0439460_0004452_619_1245 195
62 3300042993 Ga0439440_0055322 Ga0439440_0055322_171_797 195
63 3300046537 Ga0495598_0009011 Ga0495598_0009011_1103_1690 195
64 3300050508 nmdc:mga09592_23810_c1 nmdc:mga09592_23810_c1_230_820 195
65 3300050509 nmdc:mga0qj67_118338_c1 nmdc:mga0qj67_118338_c1_813_1403 195
66 3300050509 nmdc:mga0qj67_326364_c1 nmdc:mga0qj67_326364_c1_412_1041 195
67 3300050510 nmdc:mga06r32_602170_c1 nmdc:mga06r32_602170_c1_207_833 195
68 3300050510 nmdc:mga06r32_7607_c1 nmdc:mga06r32_7607_c1_7377_7967 195
69 3300031911 Ga0307412_10125587 Ga0307412_101255872 196
70 3300032002 Ga0307416_100341072 Ga0307416_1003410721 196
71 3300013296 Ga0157374_10046999 Ga0157374_100469993 197
72 3300031911 Ga0307412_10007004 Ga0307412_100070042 197
73 3300037471 Ga0395905_0069625 Ga0395905_0069625_2338_2931 197
74 3300041452 Ga0451793_1352091 Ga0451793_1352091_263_856 197
75 3300041460 Ga0451802_0622788 Ga0451802_0622788_126_719 197
76 3300041462 Ga0451806_810621 Ga0451806_810621_1278_1871 197
77 3300041486 Ga0451807_1133111 Ga0451807_1133111_2735_3328 197
78 3300041512 Ga0451853_0563708 Ga0451853_0563708_147_740 197
79 3300005353 Ga0070669_100494997 Ga0070669_1004949972 198
80 3300025923 Ga0207681_10452786 Ga0207681_104527862 198
81 3300025933 Ga0207706_10518769 Ga0207706_105187692 198
82 3300025972 Ga0207668_10669307 Ga0207668_106693072 198
83 3300030745 Ga0316182_1184530 Ga0316182_11845303 198
84 3300031548 Ga0307408_100315572 Ga0307408_1003155722 198
85 3300031824 Ga0307413_10116011 Ga0307413_101160112 198
86 3300032004 Ga0307414_10226017 Ga0307414_102260172 198
87 3300032004 Ga0307414_10527122 Ga0307414_105271221 198
88 3300037471 Ga0395905_0272106 Ga0395905_0272106_805_1401 198
89 3300048903 Ga0496100_0249157 Ga0496100_0249157_211_807 198
90 3300048904 Ga0496101_0072488 Ga0496101_0072488_1659_2255 198
91 3300048911 Ga0496108_0278259 Ga0496108_0278259_212_808 198
92 iso_pu_bacteria 2643221573 2643881917 198
93 iso_pu_bacteria 2643221720 2644661576 198
94 iso_pu_bacteria 2643221728 2644701275 198
95 3300005334 Ga0068869_100018311 Ga0068869_1000183116 199
96 3300005334 Ga0068869_101054087 Ga0068869_1010540871 199
97 3300005347 Ga0070668_100376224 Ga0070668_1003762242 199
98 3300005353 Ga0070669_100210320 Ga0070669_1002103202 199
99 3300005367 Ga0070667_100639329 Ga0070667_1006393292 199
100 3300005457 Ga0070662_100014311 Ga0070662_1000143116 199
101 3300005458 Ga0070681_10076341 Ga0070681_100763414 199
102 3300005459 Ga0068867_100223897 Ga0068867_1002238972 199
103 3300005467 Ga0070706_100165529 Ga0070706_1001655292 199
104 3300005530 Ga0070679_100084097 Ga0070679_1000840972 199
105 3300005530 Ga0070679_100283444 Ga0070679_1002834442 199
106 3300005539 Ga0068853_100579055 Ga0068853_1005790552 199
107 3300005545 Ga0070695_100033084 Ga0070695_1000330846 199
108 3300005546 Ga0070696_100022566 Ga0070696_1000225665 199
109 3300005548 Ga0070665_100034682 Ga0070665_1000346826 199
110 3300005549 Ga0070704_100108118 Ga0070704_1001081184 199
111 3300005578 Ga0068854_100269087 Ga0068854_1002690872 199
112 3300005842 Ga0068858_101116584 Ga0068858_1011165841 199
113 3300005844 Ga0068862_100021398 Ga0068862_1000213984 199
114 3300009094 Ga0111539_10209784 Ga0111539_102097842 199
115 3300025304 Ga0209257_1031756 Ga0209257_10317563 199
116 3300025893 Ga0207682_10053215 Ga0207682_100532152 199
117 3300025901 Ga0207688_10042413 Ga0207688_100424133 199
118 3300025912 Ga0207707_10162887 Ga0207707_101628872 199
119 3300025919 Ga0207657_10083306 Ga0207657_100833062 199
120 3300025921 Ga0207652_10218738 Ga0207652_102187382 199
121 3300025932 Ga0207690_10300264 Ga0207690_103002642 199
122 3300025932 Ga0207690_10515515 Ga0207690_105155152 199
123 3300025933 Ga0207706_10019015 Ga0207706_100190155 199
124 3300025972 Ga0207668_10189620 Ga0207668_101896202 199
125 3300026041 Ga0207639_10330202 Ga0207639_103302022 199
126 3300027876 Ga0209974_10079573 Ga0209974_100795732 199
127 3300028379 Ga0268266_10022686 Ga0268266_100226866 199
128 3300028380 Ga0268265_10010369 Ga0268265_100103694 199
129 3300030745 Ga0316182_1278238 Ga0316182_12782382 199
130 3300031548 Ga0307408_100379744 Ga0307408_1003797441 199
131 3300031548 Ga0307408_100547643 Ga0307408_1005476432 199
132 3300031731 Ga0307405_10032415 Ga0307405_100324152 199
133 3300031852 Ga0307410_10164828 Ga0307410_101648283 199
134 3300031903 Ga0307407_10073810 Ga0307407_100738101 199
135 3300031911 Ga0307412_10520437 Ga0307412_105204371 199
136 3300031995 Ga0307409_100495898 Ga0307409_1004958982 199
137 3300032002 Ga0307416_100228950 Ga0307416_1002289503 199
138 3300032004 Ga0307414_10065996 Ga0307414_100659964 199
139 3300032004 Ga0307414_10108139 Ga0307414_101081393 199
140 3300032005 Ga0307411_10013366 Ga0307411_100133665 199
141 3300032005 Ga0307411_10609363 Ga0307411_106093632 199
142 3300032005 Ga0307411_11272591 Ga0307411_112725911 199
143 3300032126 Ga0307415_100172209 Ga0307415_1001722093 199
144 3300032126 Ga0307415_100645149 Ga0307415_1006451492 199
145 3300042006 Ga0439432_010691 Ga0439432_010691_2079_2696 199
146 3300042012 Ga0439455_0063386 Ga0439455_0063386_136_738 199
147 3300042015 Ga0439462_0001989 Ga0439462_0001989_2429_3046 199
148 3300042120 Ga0450917_000904 Ga0450917_000904_271_873 199
149 3300042142 Ga0450905_002655 Ga0450905_002655_327_929 199
150 3300042144 Ga0450889_005177 Ga0450889_005177_115_717 199
151 3300042439 Ga0439464_0001880 Ga0439464_0001880_3127_3729 199
152 3300044684 Ga0466966_0012063 Ga0466966_0012063_2227_2829 199
153 3300045049 Ga0466959_0100096 Ga0466959_0100096_1078_1680 199
154 3300046615 Ga0495656_0081099 Ga0495656_0081099_30_650 199
155 3300047318 Ga0495636_0000118 Ga0495636_0000118_11271_11888 199
156 3300047318 Ga0495636_0040629 Ga0495636_0040629_658_1275 199
157 3300048928 Ga0496125_0111724 Ga0496125_0111724_186_800 199
158 3300048929 Ga0496126_0001950 Ga0496126_0001950_12288_12902 199
159 3300049686 Ga0501257_011848 Ga0501257_011848_172_789 199
160 3300049775 Ga0501279_019839 Ga0501279_019839_99_716 199
161 3300050511 nmdc:mga08y16_188500_c1 nmdc:mga08y16_188500_c1_515_1117 199
162 3300002067 JGI24735J21928_10025709 JGI24735J21928_100257092 200
163 3300003323 rootH1_10017335 rootH1_100173354 200
164 3300005293 Ga0065715_10175878 Ga0065715_101758783 200
165 3300005327 Ga0070658_10100047 Ga0070658_101000473 200
166 3300005335 Ga0070666_10002844 Ga0070666_100028449 200
167 3300005338 Ga0068868_100005000 Ga0068868_10000500011 200
168 3300005339 Ga0070660_100004844 Ga0070660_1000048446 200
169 3300005339 Ga0070660_100041116 Ga0070660_1000411164 200
170 3300005339 Ga0070660_100163807 Ga0070660_1001638071 200
171 3300005344 Ga0070661_100059002 Ga0070661_1000590022 200
172 3300005345 Ga0070692_10020838 Ga0070692_100208383 200
173 3300005347 Ga0070668_100006224 Ga0070668_1000062246 200
174 3300005347 Ga0070668_100063822 Ga0070668_1000638222 200
175 3300005353 Ga0070669_100090988 Ga0070669_1000909883 200
176 3300005353 Ga0070669_100300199 Ga0070669_1003001992 200
177 3300005355 Ga0070671_100000356 Ga0070671_10000035618 200
178 3300005355 Ga0070671_100004676 Ga0070671_10000467614 200
179 3300005355 Ga0070671_100068598 Ga0070671_1000685983 200
180 3300005356 Ga0070674_100017030 Ga0070674_1000170305 200
181 3300005356 Ga0070674_100052279 Ga0070674_1000522795 200
182 3300005364 Ga0070673_100025388 Ga0070673_1000253887 200
183 3300005366 Ga0070659_100007979 Ga0070659_1000079798 200
184 3300005366 Ga0070659_100045598 Ga0070659_1000455984 200
185 3300005367 Ga0070667_100001265 Ga0070667_10000126523 200
186 3300005367 Ga0070667_100008606 Ga0070667_1000086064 200
187 3300005435 Ga0070714_100043979 Ga0070714_1000439795 200
188 3300005444 Ga0070694_100007483 Ga0070694_1000074838 200
189 3300005455 Ga0070663_100256763 Ga0070663_1002567632 200
190 3300005456 Ga0070678_100011915 Ga0070678_1000119158 200
191 3300005457 Ga0070662_100003335 Ga0070662_1000033356 200
192 3300005459 Ga0068867_100010679 Ga0068867_1000106794 200
193 3300005459 Ga0068867_100934711 Ga0068867_1009347111 200
194 3300005543 Ga0070672_100103270 Ga0070672_1001032703 200
195 3300005543 Ga0070672_100270766 Ga0070672_1002707661 200
196 3300005563 Ga0068855_100038250 Ga0068855_1000382503 200
197 3300005564 Ga0070664_100006472 Ga0070664_10000647210 200
198 3300005564 Ga0070664_100034748 Ga0070664_1000347485 200
199 3300005577 Ga0068857_100079147 Ga0068857_1000791473 200
200 3300005577 Ga0068857_100386753 Ga0068857_1003867533 200
201 3300005578 Ga0068854_100052088 Ga0068854_1000520882 200
202 3300005578 Ga0068854_100292429 Ga0068854_1002924293 200
203 3300005616 Ga0068852_100112161 Ga0068852_1001121614 200
204 3300005616 Ga0068852_100526411 Ga0068852_1005264112 200
205 3300005617 Ga0068859_100102752 Ga0068859_1001027523 200
206 3300005618 Ga0068864_100069433 Ga0068864_1000694332 200
207 3300005719 Ga0068861_100118555 Ga0068861_1001185552 200
208 3300005834 Ga0068851_10046854 Ga0068851_100468542 200
209 3300005841 Ga0068863_100711167 Ga0068863_1007111672 200
210 3300005842 Ga0068858_100005575 Ga0068858_10000557511 200
211 3300005842 Ga0068858_100546919 Ga0068858_1005469192 200
212 3300005843 Ga0068860_100013628 Ga0068860_1000136289 200
213 3300005843 Ga0068860_100107091 Ga0068860_1001070915 200
214 3300005843 Ga0068860_100193083 Ga0068860_1001930834 200
215 3300005844 Ga0068862_100276550 Ga0068862_1002765503 200
216 3300005983 Ga0081540_1093870 Ga0081540_10938702 200
217 3300006237 Ga0097621_100538086 Ga0097621_1005380861 200
218 3300006931 Ga0097620_100102753 Ga0097620_1001027533 200
219 3300009093 Ga0105240_10547186 Ga0105240_105471862 200
220 3300009148 Ga0105243_10100127 Ga0105243_101001273 200
221 3300009177 Ga0105248_10001002 Ga0105248_100010028 200
222 3300009177 Ga0105248_10091476 Ga0105248_100914762 200
223 3300009545 Ga0105237_10003164 Ga0105237_100031647 200
224 3300009551 Ga0105238_10185367 Ga0105238_101853672 200
225 3300009553 Ga0105249_10053856 Ga0105249_100538565 200
226 3300013100 Ga0157373_10043878 Ga0157373_100438783 200
227 3300013104 Ga0157370_10006047 Ga0157370_1000604715 200
228 3300013297 Ga0157378_10246727 Ga0157378_102467273 200
229 3300013306 Ga0163162_10168603 Ga0163162_101686033 200
230 3300013308 Ga0157375_10646789 Ga0157375_106467892 200
231 3300013308 Ga0157375_11315540 Ga0157375_113155402 200
232 3300014326 Ga0157380_10009958 Ga0157380_100099588 200
233 3300014326 Ga0157380_10825366 Ga0157380_108253661 200
234 3300014968 Ga0157379_10121365 Ga0157379_101213652 200
235 3300025315 Ga0207697_10128414 Ga0207697_101284142 200
236 3300025321 Ga0207656_10031573 Ga0207656_100315732 200
237 3300025901 Ga0207688_10211327 Ga0207688_102113272 200
238 3300025903 Ga0207680_10000271 Ga0207680_1000027122 200
239 3300025904 Ga0207647_10001771 Ga0207647_1000177110 200
240 3300025904 Ga0207647_10013159 Ga0207647_100131593 200
241 3300025907 Ga0207645_10000896 Ga0207645_100008965 200
242 3300025909 Ga0207705_10001965 Ga0207705_1000196519 200
243 3300025914 Ga0207671_10006191 Ga0207671_100061917 200
244 3300025919 Ga0207657_10008696 Ga0207657_100086969 200
245 3300025919 Ga0207657_10026236 Ga0207657_100262364 200
246 3300025919 Ga0207657_10127354 Ga0207657_101273542 200
247 3300025920 Ga0207649_10104872 Ga0207649_101048723 200
248 3300025923 Ga0207681_10025491 Ga0207681_100254913 200
249 3300025924 Ga0207694_10182980 Ga0207694_101829802 200
250 3300025931 Ga0207644_10000794 Ga0207644_100007947 200
251 3300025931 Ga0207644_10013382 Ga0207644_100133824 200
252 3300025932 Ga0207690_10001735 Ga0207690_1000173510 200
253 3300025932 Ga0207690_10058154 Ga0207690_100581543 200
254 3300025933 Ga0207706_10011384 Ga0207706_100113846 200
255 3300025933 Ga0207706_10048438 Ga0207706_100484385 200
256 3300025935 Ga0207709_10228144 Ga0207709_102281442 200
257 3300025937 Ga0207669_10003616 Ga0207669_100036168 200
258 3300025940 Ga0207691_10016716 Ga0207691_100167169 200
259 3300025940 Ga0207691_10176782 Ga0207691_101767823 200
260 3300025941 Ga0207711_10000823 Ga0207711_1000082323 200
261 3300025941 Ga0207711_10077818 Ga0207711_100778184 200
262 3300025945 Ga0207679_10089834 Ga0207679_100898342 200
263 3300025945 Ga0207679_10351965 Ga0207679_103519652 200
264 3300025949 Ga0207667_10031806 Ga0207667_100318063 200
265 3300025960 Ga0207651_10198928 Ga0207651_101989283 200
266 3300025961 Ga0207712_10000146 Ga0207712_1000014648 200
267 3300025972 Ga0207668_10000070 Ga0207668_1000007052 200
268 3300025972 Ga0207668_10223882 Ga0207668_102238821 200
269 3300025986 Ga0207658_10006101 Ga0207658_100061014 200
270 3300025986 Ga0207658_10014061 Ga0207658_100140615 200
271 3300026023 Ga0207677_10004539 Ga0207677_1000453910 200
272 3300026023 Ga0207677_10913905 Ga0207677_109139051 200
273 3300026035 Ga0207703_10004651 Ga0207703_100046519 200
274 3300026041 Ga0207639_10018488 Ga0207639_100184886 200
275 3300026041 Ga0207639_10162971 Ga0207639_101629713 200
276 3300026067 Ga0207678_10106477 Ga0207678_101064773 200
277 3300026078 Ga0207702_10020794 Ga0207702_100207943 200
278 3300026088 Ga0207641_10089142 Ga0207641_100891424 200
279 3300026089 Ga0207648_10001147 Ga0207648_1000114711 200
280 3300026095 Ga0207676_10102195 Ga0207676_101021953 200
281 3300026116 Ga0207674_10078059 Ga0207674_100780594 200
282 3300026118 Ga0207675_100143220 Ga0207675_1001432203 200
283 3300026121 Ga0207683_10048333 Ga0207683_100483336 200
284 3300026142 Ga0207698_10322858 Ga0207698_103228582 200
285 3300027876 Ga0209974_10008000 Ga0209974_100080002 200
286 3300028380 Ga0268265_10016177 Ga0268265_100161773 200
287 3300028381 Ga0268264_10000594 Ga0268264_1000059435 200
288 3300028381 Ga0268264_10054786 Ga0268264_100547864 200
289 3300031548 Ga0307408_100142030 Ga0307408_1001420303 200
290 3300031731 Ga0307405_10331418 Ga0307405_103314182 200
291 3300031824 Ga0307413_10129647 Ga0307413_101296472 200
292 3300031852 Ga0307410_10169745 Ga0307410_101697452 200
293 3300031852 Ga0307410_10407287 Ga0307410_104072872 200
294 3300031901 Ga0307406_10030245 Ga0307406_100302452 200
295 3300031901 Ga0307406_10194182 Ga0307406_101941822 200
296 3300031903 Ga0307407_10058005 Ga0307407_100580051 200
297 3300031903 Ga0307407_10321665 Ga0307407_103216652 200
298 3300031911 Ga0307412_10169349 Ga0307412_101693492 200
299 3300032002 Ga0307416_100208283 Ga0307416_1002082833 200
300 3300032004 Ga0307414_10136988 Ga0307414_101369883 200
301 3300032005 Ga0307411_10069189 Ga0307411_100691892 200
302 3300032005 Ga0307411_10187882 Ga0307411_101878822 200
303 3300032126 Ga0307415_100169313 Ga0307415_1001693132 200
304 3300032126 Ga0307415_100533370 Ga0307415_1005333702 200
305 3300037312 Ga0395899_0395559 Ga0395899_0395559_153_755 200
306 3300037418 Ga0395900_0041349 Ga0395900_0041349_55_657 200
307 3300037466 Ga0395898_0093912 Ga0395898_0093912_53_655 200
308 3300037466 Ga0395898_0919627 Ga0395898_0919627_158_760 200
309 3300037471 Ga0395905_0026307 Ga0395905_0026307_3546_4169 200
310 3300037471 Ga0395905_0045919 Ga0395905_0045919_944_1555 200
311 3300037471 Ga0395905_0298713 Ga0395905_0298713_574_1176 200
312 3300037471 Ga0395905_0817775 Ga0395905_0817775_213_815 200
313 3300038443 Ga0395901_1009510 Ga0395901_1009510_166_768 200
314 3300038443 Ga0395901_1154210 Ga0395901_1154210_107_709 200
315 3300044684 Ga0466966_0106303 Ga0466966_0106303_923_1525 200
316 3300044693 Ga0466961_0466573 Ga0466961_0466573_79_681 200
317 3300044694 Ga0466963_0532399 Ga0466963_0532399_55_657 200
318 3300045049 Ga0466959_0075353 Ga0466959_0075353_462_1064 200
319 3300045836 Ga0466958_0143927 Ga0466958_0143927_562_1164 200
320 3300046471 Ga0495650_0000744 Ga0495650_0000744_11354_11968 200
321 3300046471 Ga0495650_0044906 Ga0495650_0044906_743_1363 200
322 3300046524 Ga0495648_0000029 Ga0495648_0000029_55283_55903 200
323 3300046616 Ga0495668_0000014 Ga0495668_0000014_103291_103911 200
324 3300047469 Ga0495673_0000597 Ga0495673_0000597_13814_14434 200
325 3300047472 Ga0495686_0001938 Ga0495686_0001938_13813_14430 200
326 3300047472 Ga0495686_0177379 Ga0495686_0177379_178_795 200
327 3300048909 Ga0496106_0096639 Ga0496106_0096639_939_1559 200
328 3300048910 Ga0496107_0000072 Ga0496107_0000072_35567_36187 200
329 3300048910 Ga0496107_0067447 Ga0496107_0067447_755_1366 200
330 3300048917 Ga0496114_0061753 Ga0496114_0061753_1876_2511 200
331 3300048918 Ga0496115_0000488 Ga0496115_0000488_28321_28956 200
332 3300048924 Ga0496121_0002753 Ga0496121_0002753_7164_7784 200
333 3300048924 Ga0496121_0307995 Ga0496121_0307995_177_794 200
334 3300049663 Ga0501223_040798 Ga0501223_040798_202_819 200
335 3300049686 Ga0501257_070402 Ga0501257_070402_31_651 200
336 3300049704 Ga0501221_026311 Ga0501221_026311_247_864 200
337 3300049770 Ga0501273_036973 Ga0501273_036973_65_682 200
338 3300050509 nmdc:mga0qj67_513599_c1 nmdc:mga0qj67_513599_c1_44_658 200
339 3300053088 Ga0500644_0000043 Ga0500644_0000043_26606_27226 200
340 3300053094 Ga0500566_0260410 Ga0500566_0260410_53_673 200
341 3300053123 Ga0500614_002794 Ga0500614_002794_433_1053 200
342 3300053136 Ga0500559_0064128 Ga0500559_0064128_75_692 200
343 3300053138 Ga0500564_000015 Ga0500564_000015_25456_26076 200
344 3300003187 JGI25151J46595_10031913 JGI25151J46595_100319133 201
345 3300003771 Ga0055526_1033652 Ga0055526_10336522 201
346 3300003775 Ga0055524_1028215 Ga0055524_10282152 201
347 3300003775 Ga0055524_1030132 Ga0055524_10301322 201
348 3300003775 Ga0055524_1043564 Ga0055524_10435641 201
349 3300003781 Ga0055536_1010416 Ga0055536_10104163 201
350 3300003781 Ga0055536_1010650 Ga0055536_10106505 201
351 3300003781 Ga0055536_1033813 Ga0055536_10338133 201
352 3300003781 Ga0055536_1035068 Ga0055536_10350683 201
353 3300003781 Ga0055536_1061546 Ga0055536_10615461 201
354 3300003791 Ga0055530_10001236 Ga0055530_1000123610 201
355 3300003794 Ga0055531_10003252 Ga0055531_100032528 201
356 3300003794 Ga0055531_10005027 Ga0055531_100050277 201
357 3300003794 Ga0055531_10006427 Ga0055531_100064273 201
358 3300003794 Ga0055531_10010682 Ga0055531_100106823 201
359 3300003794 Ga0055531_10060621 Ga0055531_100606212 201
360 3300005355 Ga0070671_100036498 Ga0070671_1000364985 201
361 3300005548 Ga0070665_100120974 Ga0070665_1001209742 201
362 3300006931 Ga0097620_100696124 Ga0097620_1006961242 201
363 3300025245 Ga0207425_1017920 Ga0207425_10179201 201
364 3300025284 Ga0209130_1004853 Ga0209130_10048534 201
365 3300025291 Ga0209675_1010132 Ga0209675_10101323 201
366 3300025291 Ga0209675_1015047 Ga0209675_10150473 201
367 3300025292 Ga0209676_1000853 Ga0209676_100085330 201
368 3300025292 Ga0209676_1001374 Ga0209676_100137412 201
369 3300025292 Ga0209676_1004286 Ga0209676_10042868 201
370 3300025292 Ga0209676_1004361 Ga0209676_10043613 201
371 3300025292 Ga0209676_1009285 Ga0209676_10092853 201
372 3300025292 Ga0209676_1032853 Ga0209676_10328533 201
373 3300025292 Ga0209676_1038842 Ga0209676_10388422 201
374 3300025294 Ga0209025_1001514 Ga0209025_10015149 201
375 3300025294 Ga0209025_1045192 Ga0209025_10451923 201
376 3300025298 Ga0209050_1000652 Ga0209050_100065229 201
377 3300025298 Ga0209050_1010093 Ga0209050_10100933 201
378 3300025299 Ga0209256_1004674 Ga0209256_10046744 201
379 3300025299 Ga0209256_1005718 Ga0209256_10057187 201
380 3300025299 Ga0209256_1007836 Ga0209256_10078363 201
381 3300025303 Ga0209051_1018108 Ga0209051_10181083 201
382 3300025304 Ga0209257_1000378 Ga0209257_100037844 201
383 3300025304 Ga0209257_1001186 Ga0209257_100118610 201
384 3300025304 Ga0209257_1001359 Ga0209257_100135910 201
385 3300025304 Ga0209257_1001512 Ga0209257_100151212 201
386 3300025304 Ga0209257_1001632 Ga0209257_100163212 201
387 3300025304 Ga0209257_1065175 Ga0209257_10651752 201
388 3300028379 Ga0268266_10394512 Ga0268266_103945122 201
389 3300037418 Ga0395900_0317473 Ga0395900_0317473_295_900 201
390 3300037471 Ga0395905_0046043 Ga0395905_0046043_2719_3324 201
391 3300037471 Ga0395905_0065556 Ga0395905_0065556_324_929 201
392 3300038443 Ga0395901_0302129 Ga0395901_0302129_287_892 201
393 3300041413 Ga0439465_0004297 Ga0439465_0004297_2433_3065 201
394 3300042007 Ga0439449_0007223 Ga0439449_0007223_2012_2644 201
395 3300042015 Ga0439462_0113252 Ga0439462_0113252_68_700 201
396 3300046507 Ga0495606_0087714 Ga0495606_0087714_673_1290 201
397 3300046525 Ga0495663_0071238 Ga0495663_0071238_54_671 201
398 3300046616 Ga0495668_0017889 Ga0495668_0017889_1472_2080 201
399 3300046660 Ga0495625_0337356 Ga0495625_0337356_333_941 201
400 3300046684 Ga0495669_0000046 Ga0495669_0000046_65549_66160 201
401 3300046684 Ga0495669_0081276 Ga0495669_0081276_814_1431 201
402 3300046684 Ga0495669_0307110 Ga0495669_0307110_60_671 201
403 3300047447 Ga0495685_032435 Ga0495685_032435_504_1121 201
404 3300048904 Ga0496101_0118819 Ga0496101_0118819_1187_1792 201
405 3300048912 Ga0496109_0150348 Ga0496109_0150348_47_652 201
406 3300048915 Ga0496112_0063780 Ga0496112_0063780_2684_3289 201
407 3300048916 Ga0496113_0529771 Ga0496113_0529771_158_763 201
408 3300049579 Ga0501043_0038647 Ga0501043_0038647_2040_2669 201
409 iso_pu_bacteria 8003014200 8003016797 201
410 3300001979 JGI24740J21852_10000857 JGI24740J21852_100008577 202
411 3300001989 JGI24739J22299_10003054 JGI24739J22299_100030543 202
412 3300001990 JGI24737J22298_10000013 JGI24737J22298_1000001353 202
413 3300001991 JGI24743J22301_10049743 JGI24743J22301_100497432 202
414 3300002075 JGI24738J21930_10000935 JGI24738J21930_100009358 202
415 3300002075 JGI24738J21930_10001252 JGI24738J21930_100012523 202
416 3300002239 JGI24034J26672_10003481 JGI24034J26672_100034813 202
417 3300005293 Ga0065715_10132066 Ga0065715_101320662 202
418 3300005328 Ga0070676_10005926 Ga0070676_100059265 202
419 3300005331 Ga0070670_100015868 Ga0070670_1000158686 202
420 3300005334 Ga0068869_100000651 Ga0068869_10000065121 202
421 3300005335 Ga0070666_10007885 Ga0070666_100078859 202
422 3300005338 Ga0068868_100005456 Ga0068868_1000054568 202
423 3300005339 Ga0070660_100015525 Ga0070660_1000155254 202
424 3300005340 Ga0070689_100035338 Ga0070689_1000353385 202
425 3300005343 Ga0070687_100019629 Ga0070687_1000196295 202
426 3300005344 Ga0070661_100134669 Ga0070661_1001346692 202
427 3300005353 Ga0070669_100000319 Ga0070669_10000031915 202
428 3300005354 Ga0070675_100008839 Ga0070675_1000088399 202
429 3300005355 Ga0070671_100001617 Ga0070671_1000016178 202
430 3300005356 Ga0070674_100010722 Ga0070674_1000107222 202
431 3300005364 Ga0070673_100000675 Ga0070673_10000067517 202
432 3300005366 Ga0070659_100001722 Ga0070659_10000172217 202
433 3300005367 Ga0070667_100044671 Ga0070667_1000446713 202
434 3300005457 Ga0070662_100001355 Ga0070662_10000135516 202
435 3300005459 Ga0068867_100003550 Ga0068867_1000035508 202
436 3300005539 Ga0068853_100008649 Ga0068853_1000086498 202
437 3300005543 Ga0070672_100000668 Ga0070672_1000006683 202
438 3300005548 Ga0070665_100363178 Ga0070665_1003631782 202
439 3300005563 Ga0068855_100003914 Ga0068855_10000391411 202
440 3300005564 Ga0070664_100065545 Ga0070664_1000655454 202
441 3300005577 Ga0068857_100000246 Ga0068857_10000024637 202
442 3300005578 Ga0068854_100000337 Ga0068854_10000033735 202
443 3300005616 Ga0068852_100004492 Ga0068852_1000044928 202
444 3300005617 Ga0068859_100020576 Ga0068859_1000205767 202
445 3300005618 Ga0068864_100000810 Ga0068864_10000081037 202
446 3300005719 Ga0068861_100002114 Ga0068861_1000021145 202
447 3300005840 Ga0068870_10029673 Ga0068870_100296732 202
448 3300005841 Ga0068863_100006391 Ga0068863_10000639116 202
449 3300005842 Ga0068858_100001398 Ga0068858_10000139816 202
450 3300006237 Ga0097621_100105496 Ga0097621_1001054962 202
451 3300006358 Ga0068871_100235563 Ga0068871_1002355631 202
452 3300006881 Ga0068865_100000374 Ga0068865_10000037421 202
453 3300006931 Ga0097620_100020575 Ga0097620_1000205757 202
454 3300009098 Ga0105245_10000275 Ga0105245_1000027538 202
455 3300009174 Ga0105241_10201404 Ga0105241_102014041 202
456 3300009177 Ga0105248_10008541 Ga0105248_100085413 202
457 3300009551 Ga0105238_10067722 Ga0105238_100677223 202
458 3300010375 Ga0105239_10024971 Ga0105239_100249715 202
459 3300011119 Ga0105246_10012920 Ga0105246_100129203 202
460 3300013100 Ga0157373_10025963 Ga0157373_100259632 202
461 3300013102 Ga0157371_10000637 Ga0157371_1000063710 202
462 3300013297 Ga0157378_10002341 Ga0157378_100023416 202
463 3300013306 Ga0163162_10058474 Ga0163162_100584743 202
464 3300013307 Ga0157372_10164726 Ga0157372_101647263 202
465 3300025315 Ga0207697_10000112 Ga0207697_100001128 202
466 3300025901 Ga0207688_10003553 Ga0207688_100035537 202
467 3300025903 Ga0207680_10005882 Ga0207680_100058829 202
468 3300025904 Ga0207647_10000101 Ga0207647_1000010150 202
469 3300025907 Ga0207645_10009043 Ga0207645_100090436 202
470 3300025908 Ga0207643_10181846 Ga0207643_101818463 202
471 3300025919 Ga0207657_10020154 Ga0207657_100201546 202
472 3300025920 Ga0207649_10062811 Ga0207649_100628113 202
473 3300025923 Ga0207681_10001255 Ga0207681_1000125516 202
474 3300025926 Ga0207659_10002669 Ga0207659_100026697 202
475 3300025927 Ga0207687_10001375 Ga0207687_1000137518 202
476 3300025931 Ga0207644_10015555 Ga0207644_100155553 202
477 3300025932 Ga0207690_10000830 Ga0207690_100008308 202
478 3300025933 Ga0207706_10000318 Ga0207706_1000031821 202
479 3300025936 Ga0207670_10024552 Ga0207670_100245523 202
480 3300025937 Ga0207669_10020878 Ga0207669_100208782 202
481 3300025938 Ga0207704_10003539 Ga0207704_100035397 202
482 3300025940 Ga0207691_10000593 Ga0207691_1000059310 202
483 3300025941 Ga0207711_10003620 Ga0207711_1000362011 202
484 3300025942 Ga0207689_10000016 Ga0207689_1000001639 202
485 3300025945 Ga0207679_10031679 Ga0207679_100316795 202
486 3300025949 Ga0207667_10015822 Ga0207667_100158226 202
487 3300025981 Ga0207640_10007415 Ga0207640_100074156 202
488 3300025981 Ga0207640_10129552 Ga0207640_101295523 202
489 3300025986 Ga0207658_10012129 Ga0207658_100121296 202
490 3300026023 Ga0207677_10001192 Ga0207677_100011925 202
491 3300026035 Ga0207703_10070440 Ga0207703_100704401 202
492 3300026067 Ga0207678_10262728 Ga0207678_102627281 202
493 3300026088 Ga0207641_10024405 Ga0207641_100244055 202
494 3300026089 Ga0207648_10007206 Ga0207648_100072067 202
495 3300026095 Ga0207676_10001961 Ga0207676_1000196115 202
496 3300026116 Ga0207674_10000114 Ga0207674_10000114101 202
497 3300026142 Ga0207698_10002635 Ga0207698_100026353 202
498 3300028800 Ga0265338_10082676 Ga0265338_100826762 202
499 3300031548 Ga0307408_100105786 Ga0307408_1001057864 202
500 3300031731 Ga0307405_10020352 Ga0307405_100203523 202
501 3300031824 Ga0307413_10140456 Ga0307413_101404562 202
502 3300031852 Ga0307410_10036610 Ga0307410_100366102 202
503 3300031901 Ga0307406_10080479 Ga0307406_100804792 202
504 3300031903 Ga0307407_10024481 Ga0307407_100244813 202
505 3300031911 Ga0307412_10061212 Ga0307412_100612124 202
506 3300031995 Ga0307409_100049266 Ga0307409_1000492662 202
507 3300032002 Ga0307416_100016481 Ga0307416_1000164812 202
508 3300032004 Ga0307414_10017919 Ga0307414_100179196 202
509 3300032126 Ga0307415_100007851 Ga0307415_1000078514 202
510 3300042007 Ga0439449_0108666 Ga0439449_0108666_375_1001 202
511 3300046520 Ga0495637_0006928 Ga0495637_0006928_3685_4314 202
512 3300046660 Ga0495625_0000777 Ga0495625_0000777_25880_26509 202
513 3300047320 Ga0495672_0002375 Ga0495672_0002375_926_1555 202
514 3300047469 Ga0495673_0005592 Ga0495673_0005592_1458_2087 202
515 3300049580 Ga0501046_0122514 Ga0501046_0122514_819_1445 202
516 3300053104 Ga0500556_0000466 Ga0500556_0000466_13903_14532 202
517 3300053730 Ga0500645_000289 Ga0500645_000289_5852_6481 202
518 3300053730 Ga0500645_021925 Ga0500645_021925_617_1246 202
519 iso_pu_bacteria 2643221695 2644529669 202
520 3300003322 rootL2_10285272 rootL2_102852722 203
521 3300005295 Ga0065707_10355873 Ga0065707_103558732 203
522 3300005327 Ga0070658_10399850 Ga0070658_103998502 203
523 3300005328 Ga0070676_10160367 Ga0070676_101603673 203
524 3300005331 Ga0070670_100092998 Ga0070670_1000929983 203
525 3300005344 Ga0070661_100014003 Ga0070661_1000140036 203
526 3300005347 Ga0070668_100111974 Ga0070668_1001119743 203
527 3300005347 Ga0070668_100124506 Ga0070668_1001245062 203
528 3300005347 Ga0070668_100488934 Ga0070668_1004889341 203
529 3300005353 Ga0070669_100437139 Ga0070669_1004371392 203
530 3300005354 Ga0070675_100354169 Ga0070675_1003541692 203
531 3300005355 Ga0070671_100003440 Ga0070671_1000034407 203
532 3300005355 Ga0070671_100238383 Ga0070671_1002383832 203
533 3300005356 Ga0070674_100085184 Ga0070674_1000851842 203
534 3300005356 Ga0070674_100286761 Ga0070674_1002867612 203
535 3300005356 Ga0070674_100432097 Ga0070674_1004320971 203
536 3300005356 Ga0070674_100525659 Ga0070674_1005256591 203
537 3300005364 Ga0070673_100561239 Ga0070673_1005612392 203
538 3300005366 Ga0070659_100129051 Ga0070659_1001290514 203
539 3300005366 Ga0070659_100174895 Ga0070659_1001748953 203
540 3300005456 Ga0070678_100012540 Ga0070678_1000125404 203
541 3300005457 Ga0070662_100002363 Ga0070662_1000023637 203
542 3300005457 Ga0070662_100073125 Ga0070662_1000731252 203
543 3300005458 Ga0070681_10319216 Ga0070681_103192161 203
544 3300005530 Ga0070679_100599459 Ga0070679_1005994592 203
545 3300005539 Ga0068853_100146353 Ga0068853_1001463533 203
546 3300005543 Ga0070672_100024701 Ga0070672_1000247013 203
547 3300005543 Ga0070672_100060167 Ga0070672_1000601673 203
548 3300005564 Ga0070664_100005277 Ga0070664_1000052776 203
549 3300005564 Ga0070664_100679635 Ga0070664_1006796352 203
550 3300005614 Ga0068856_100310228 Ga0068856_1003102281 203
551 3300005618 Ga0068864_100078348 Ga0068864_1000783483 203
552 3300005844 Ga0068862_100071902 Ga0068862_1000719023 203
553 3300006237 Ga0097621_100820258 Ga0097621_1008202582 203
554 3300009553 Ga0105249_10095314 Ga0105249_100953143 203
555 3300013100 Ga0157373_10031370 Ga0157373_100313705 203
556 3300013100 Ga0157373_10071003 Ga0157373_100710032 203
557 3300013102 Ga0157371_10060928 Ga0157371_100609282 203
558 3300013102 Ga0157371_10137533 Ga0157371_101375333 203
559 3300013102 Ga0157371_10216097 Ga0157371_102160972 203
560 3300025903 Ga0207680_10077597 Ga0207680_100775973 203
561 3300025907 Ga0207645_10265398 Ga0207645_102653982 203
562 3300025909 Ga0207705_10004972 Ga0207705_100049724 203
563 3300025925 Ga0207650_10030898 Ga0207650_100308984 203
564 3300025926 Ga0207659_10173203 Ga0207659_101732033 203
565 3300025931 Ga0207644_10006565 Ga0207644_100065657 203
566 3300025931 Ga0207644_10083017 Ga0207644_100830172 203
567 3300025932 Ga0207690_10284017 Ga0207690_102840172 203
568 3300025933 Ga0207706_10002476 Ga0207706_1000247612 203
569 3300025933 Ga0207706_10034041 Ga0207706_100340415 203
570 3300025933 Ga0207706_10037251 Ga0207706_100372514 203
571 3300025937 Ga0207669_10013957 Ga0207669_100139575 203
572 3300025937 Ga0207669_10473846 Ga0207669_104738462 203
573 3300025937 Ga0207669_10582272 Ga0207669_105822721 203
574 3300025940 Ga0207691_10134588 Ga0207691_101345883 203
575 3300025940 Ga0207691_10157034 Ga0207691_101570343 203
576 3300025960 Ga0207651_10915413 Ga0207651_109154132 203
577 3300025972 Ga0207668_10058010 Ga0207668_100580102 203
578 3300026078 Ga0207702_10272806 Ga0207702_102728063 203
579 3300026095 Ga0207676_10094261 Ga0207676_100942613 203
580 3300026121 Ga0207683_10131758 Ga0207683_101317583 203
581 3300026121 Ga0207683_10779031 Ga0207683_107790311 203
582 3300028380 Ga0268265_10151545 Ga0268265_101515452 203
583 3300028381 Ga0268264_10321431 Ga0268264_103214312 203
584 3300031824 Ga0307413_10262954 Ga0307413_102629542 203
585 3300031852 Ga0307410_10005694 Ga0307410_100056949 203
586 3300032005 Ga0307411_10003991 Ga0307411_100039915 203
587 3300032005 Ga0307411_10120820 Ga0307411_101208202 203
588 3300037418 Ga0395900_0049368 Ga0395900_0049368_1781_2434 203
589 3300037418 Ga0395900_0086592 Ga0395900_0086592_1240_1851 203
590 3300037466 Ga0395898_0027957 Ga0395898_0027957_3703_4356 203
591 3300037466 Ga0395898_0157863 Ga0395898_0157863_868_1479 203
592 3300037471 Ga0395905_0174002 Ga0395905_0174002_27_638 203
593 3300037471 Ga0395905_0537686 Ga0395905_0537686_350_1003 203
594 3300037471 Ga0395905_0660135 Ga0395905_0660135_193_816 203
595 3300038443 Ga0395901_0042655 Ga0395901_0042655_1289_1942 203
596 3300038443 Ga0395901_0979877 Ga0395901_0979877_27_638 203
597 3300044658 Ga0466972_0257898 Ga0466972_0257898_171_794 203
598 3300046525 Ga0495663_0000865 Ga0495663_0000865_9056_9679 203
599 3300046537 Ga0495598_0092411 Ga0495598_0092411_271_894 203
600 3300046539 Ga0495621_0061372 Ga0495621_0061372_335_958 203
601 3300048905 Ga0496102_0622109 Ga0496102_0622109_93_704 203
602 3300049583 Ga0501067_0149612 Ga0501067_0149612_249_863 203
603 3300049590 Ga0501074_0180267 Ga0501074_0180267_817_1443 203
604 3300001915 JGI24741J21665_1003534 JGI24741J21665_10035343 204
605 3300001979 JGI24740J21852_10001632 JGI24740J21852_100016323 204
606 3300001989 JGI24739J22299_10042028 JGI24739J22299_100420281 204
607 3300001990 JGI24737J22298_10012867 JGI24737J22298_100128673 204
608 3300002067 JGI24735J21928_10009048 JGI24735J21928_100090483 204
609 3300003322 rootL2_10004035 rootL2_100040354 204
610 3300005327 Ga0070658_10018232 Ga0070658_100182325 204
611 3300005331 Ga0070670_100329365 Ga0070670_1003293652 204
612 3300005336 Ga0070680_100244956 Ga0070680_1002449563 204
613 3300005337 Ga0070682_100009836 Ga0070682_1000098365 204
614 3300005344 Ga0070661_100029851 Ga0070661_1000298515 204
615 3300005345 Ga0070692_10008464 Ga0070692_100084644 204
616 3300005354 Ga0070675_100010756 Ga0070675_1000107563 204
617 3300005364 Ga0070673_100440349 Ga0070673_1004403492 204
618 3300005455 Ga0070663_100004495 Ga0070663_1000044952 204
619 3300005457 Ga0070662_100030837 Ga0070662_1000308372 204
620 3300005535 Ga0070684_100146234 Ga0070684_1001462341 204
621 3300005543 Ga0070672_100027847 Ga0070672_1000278472 204
622 3300005547 Ga0070693_100007166 Ga0070693_1000071664 204
623 3300005563 Ga0068855_100090451 Ga0068855_1000904513 204
624 3300005564 Ga0070664_100055635 Ga0070664_1000556353 204
625 3300005564 Ga0070664_100261231 Ga0070664_1002612313 204
626 3300005577 Ga0068857_100066598 Ga0068857_1000665985 204
627 3300005578 Ga0068854_100008850 Ga0068854_1000088504 204
628 3300005618 Ga0068864_100034527 Ga0068864_1000345274 204
629 3300006881 Ga0068865_100470784 Ga0068865_1004707842 204
630 3300013307 Ga0157372_10146066 Ga0157372_101460662 204
631 3300013308 Ga0157375_10088799 Ga0157375_100887996 204
632 3300025909 Ga0207705_10051806 Ga0207705_100518063 204
633 3300025919 Ga0207657_10002057 Ga0207657_100020575 204
634 3300025920 Ga0207649_10009357 Ga0207649_100093574 204
635 3300025921 Ga0207652_10215798 Ga0207652_102157983 204
636 3300025923 Ga0207681_10402425 Ga0207681_104024252 204
637 3300025926 Ga0207659_10060116 Ga0207659_100601163 204
638 3300025932 Ga0207690_10012431 Ga0207690_100124315 204
639 3300025933 Ga0207706_10004182 Ga0207706_1000418210 204
640 3300025938 Ga0207704_10147272 Ga0207704_101472723 204
641 3300025940 Ga0207691_10040559 Ga0207691_100405596 204
642 3300025944 Ga0207661_10014686 Ga0207661_100146865 204
643 3300025945 Ga0207679_10196631 Ga0207679_101966313 204
644 3300025945 Ga0207679_10262005 Ga0207679_102620052 204
645 3300025949 Ga0207667_10256584 Ga0207667_102565842 204
646 3300025960 Ga0207651_10074504 Ga0207651_100745043 204
647 3300025981 Ga0207640_10263868 Ga0207640_102638682 204
648 3300026067 Ga0207678_10003724 Ga0207678_1000372410 204
649 3300026095 Ga0207676_10081042 Ga0207676_100810423 204
650 3300026116 Ga0207674_10006404 Ga0207674_100064045 204
651 3300026121 Ga0207683_10484568 Ga0207683_104845682 204
652 3300031731 Ga0307405_10061804 Ga0307405_100618042 204
653 3300031824 Ga0307413_10060648 Ga0307413_100606482 204
654 3300031852 Ga0307410_10040475 Ga0307410_100404751 204
655 3300031903 Ga0307407_10300111 Ga0307407_103001112 204
656 3300031911 Ga0307412_10749215 Ga0307412_107492151 204
657 3300031995 Ga0307409_100224737 Ga0307409_1002247373 204
658 3300032002 Ga0307416_100069871 Ga0307416_1000698713 204
659 3300037418 Ga0395900_0820216 Ga0395900_0820216_75_689 204
660 3300037471 Ga0395905_0000257 Ga0395905_0000257_32571_33197 204
661 3300037471 Ga0395905_0305460 Ga0395905_0305460_280_894 204
662 3300038443 Ga0395901_0393420 Ga0395901_0393420_71_694 204
663 3300044694 Ga0466963_0299563 Ga0466963_0299563_388_1002 204
664 3300044842 Ga0466957_0232497 Ga0466957_0232497_455_1102 204
665 3300045836 Ga0466958_0134895 Ga0466958_0134895_707_1354 204
666 3300045976 Ga0466967_0047290 Ga0466967_0047290_1890_2537 204
667 3300045976 Ga0466967_0666590 Ga0466967_0666590_67_681 204
668 3300046691 Ga0495670_0077858 Ga0495670_0077858_751_1410 204
669 3300047318 Ga0495636_0014871 Ga0495636_0014871_2071_2730 204
670 3300048912 Ga0496109_0170229 Ga0496109_0170229_492_1109 204
671 3300053151 Ga0500604_0000478 Ga0500604_0000478_6034_6678 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05118

Asp_Arg_Hydrox

Aspartyl/Asparaginyl beta-hydroxylase

90

197

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.8461 105 184
6b8w-assembly1.cif.gz_B 1.9 angstrom resolution crystal structure of cupin_2 domain (pfam 07883) of xre family transcriptional regulator from enterobacter cloacae. 0.8446 105 186
7zvy-assembly4.cif.gz_H thermococcus kadokarensis phosphomannose isomerase 0.8437 105 184
5wse-assembly2.cif.gz_C crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.8332 54 185
5wsf-assembly2.cif.gz_C crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.8316 54 185
ID Description Score Start End Superfamily
af_P0A9U6_79_184_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8421 105 185 2.60.120.10
af_P76555_101_233_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8363 105 185 2.60.120.10
af_O86372_11_115_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.825 105 191 2.60.120.10
4i4aA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8241 105 189 2.60.120.10
af_Q2G2A6_62_177_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8239 105 184 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A522Y629-F1-model_v4 Aspartyl beta-hydroxylase 1.001 7 199
AF-A0A7W3Y531-F1-model_v4 Aspartyl/asparaginyl beta-hydroxylase domain-containing protein 0.9973 3 201
AF-A0A841MAX3-F1-model_v4 deleted 0.9939 3 198
AF-A0A552F449-F1-model_v4 Aspartyl beta-hydroxylase 0.9913 7 187
AF-A0A6N9NNQ7-F1-model_v4 Aspartyl beta-hydroxylase 0.9877 6 188

Feature Viewer

pLDDT pTM Quality
92.95 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map