F474193
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 671 | 277 | 666 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300050509|nmdc:mga0qj67_326364_c1|nmdc:mga0qj67_326364_c1_412_1041 |
| Length | 209 |
| Sequence | MQANPRKTSSLRHLGKVDIAQLREAVLTIPESVWDAEDQNKPNRRYQQVVGGAWVPVPGRVFATTRHIIFRFIASQQDWRESADWPLWXXXRERLLPVMEQATRPYGYVHAAYPRVMLARMASGAEILPHMDNKPAAQWPHKIHVPLLTNPQVGFRIGDTIHHLPEGEAVEVNNLGIHAVRNDGTTDRIHLIFEYYDLDQPDPDWMLAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 2 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 3 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 4 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 193 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 198 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 199 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 200 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 201 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 202 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 203 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 204 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 205 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 206 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 207 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 208 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 209 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 210 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 211 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 212 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 216 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 239 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 240 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 241 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 244 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 247 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 250 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 251 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 252 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 253 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 254 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 259 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 260 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 261 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 262 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 263 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 268 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 269 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 270 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 271 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 272 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 273 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 274 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 275 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 276 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 277 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.25 |
| Metatranscriptomes | 0 |
| Isolates | 0.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.9 |
| Nodule | 0 |
| Rhizoplane | 4.17 |
| Rhizosphere | 85.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1003534 | 3300001915 | Bacteria | 3699 |
| 2 | JGI24740J21852_10000857 | 3300001979 | Bacteria | 13446 |
| 3 | JGI24740J21852_10001632 | 3300001979 | Bacteria | 10338 |
| 4 | JGI24739J22299_10003054 | 3300001989 | Bacteria | 6393 |
| 5 | JGI24739J22299_10042028 | 3300001989 | Bacteria | 1517 |
| 6 | JGI24737J22298_10000013 | 3300001990 | Bacteria | 50248 |
| 7 | JGI24737J22298_10012867 | 3300001990 | Bacteria | 2728 |
| 8 | JGI24743J22301_10049743 | 3300001991 | Bacteria | 852 |
| 9 | JGI24735J21928_10009048 | 3300002067 | Bacteria | 3207 |
| 10 | JGI24735J21928_10025709 | 3300002067 | Bacteria | 1775 |
| 11 | JGI24738J21930_10000935 | 3300002075 | Bacteria | 8390 |
| 12 | JGI24738J21930_10001252 | 3300002075 | Bacteria | 7139 |
| 13 | JGI24034J26672_10003481 | 3300002239 | Bacteria | 2198 |
| 14 | JGI25151J46595_10031913 | 3300003187 | Bacteria | 2050 |
| 15 | rootL2_10004035 | 3300003322 | Bacteria | 4936 |
| 16 | rootL2_10285272 | 3300003322 | Bacteria | 1196 |
| 17 | rootH1_10017335 | 3300003323 | Bacteria | 2589 |
| 18 | Ga0055526_1033652 | 3300003771 | Bacteria | 1418 |
| 19 | Ga0055524_1028215 | 3300003775 | Bacteria | 1686 |
| 20 | Ga0055524_1030132 | 3300003775 | Bacteria | 1587 |
| 21 | Ga0055524_1043564 | 3300003775 | Bacteria | 1102 |
| 22 | Ga0055536_1010416 | 3300003781 | Bacteria | 3692 |
| 23 | Ga0055536_1010650 | 3300003781 | Bacteria | 3618 |
| 24 | Ga0055536_1033813 | 3300003781 | Bacteria | 1300 |
| 25 | Ga0055536_1035068 | 3300003781 | Bacteria | 1259 |
| 26 | Ga0055536_1061546 | 3300003781 | Bacteria | 775 |
| 27 | Ga0055530_10001236 | 3300003791 | Bacteria | 19505 |
| 28 | Ga0055531_10003252 | 3300003794 | Bacteria | 10433 |
| 29 | Ga0055531_10005027 | 3300003794 | Bacteria | 7838 |
| 30 | Ga0055531_10006427 | 3300003794 | Bacteria | 6675 |
| 31 | Ga0055531_10010682 | 3300003794 | Bacteria | 4530 |
| 32 | Ga0055531_10060621 | 3300003794 | Bacteria | 927 |
| 33 | Ga0065715_10117808 | 3300005293 | Bacteria | 2333 |
| 34 | Ga0065715_10132066 | 3300005293 | Bacteria | 1996 |
| 35 | Ga0065715_10175878 | 3300005293 | Unclassified | 1512 |
| 36 | Ga0065707_10355873 | 3300005295 | Bacteria | 911 |
| 37 | Ga0070658_10018232 | 3300005327 | Bacteria | 5617 |
| 38 | Ga0070658_10100047 | 3300005327 | Bacteria | 2396 |
| 39 | Ga0070658_10399850 | 3300005327 | Bacteria | 1180 |
| 40 | Ga0070676_10005926 | 3300005328 | Bacteria | 6524 |
| 41 | Ga0070676_10160367 | 3300005328 | Bacteria | 1447 |
| 42 | Ga0070670_100015868 | 3300005331 | Bacteria | 6463 |
| 43 | Ga0070670_100092998 | 3300005331 | Bacteria | 2593 |
| 44 | Ga0070670_100149741 | 3300005331 | Bacteria | 2020 |
| 45 | Ga0070670_100329365 | 3300005331 | Bacteria | 1339 |
| 46 | Ga0070670_100334446 | 3300005331 | Bacteria | 1329 |
| 47 | Ga0068869_100000651 | 3300005334 | Bacteria | 19629 |
| 48 | Ga0068869_100018311 | 3300005334 | Bacteria | 4766 |
| 49 | Ga0068869_101054087 | 3300005334 | Bacteria | 710 |
| 50 | Ga0070666_10002844 | 3300005335 | Bacteria | 10459 |
| 51 | Ga0070666_10007885 | 3300005335 | Bacteria | 6579 |
| 52 | Ga0070680_100172409 | 3300005336 | Unclassified | 1821 |
| 53 | Ga0070680_100244956 | 3300005336 | Bacteria | 1515 |
| 54 | Ga0070682_100009836 | 3300005337 | Bacteria | 5416 |
| 55 | Ga0068868_100005000 | 3300005338 | Bacteria | 9316 |
| 56 | Ga0068868_100005456 | 3300005338 | Bacteria | 8939 |
| 57 | Ga0070660_100004844 | 3300005339 | Bacteria | 9298 |
| 58 | Ga0070660_100015525 | 3300005339 | Bacteria | 5503 |
| 59 | Ga0070660_100041116 | 3300005339 | Bacteria | 3522 |
| 60 | Ga0070660_100163807 | 3300005339 | Bacteria | 1793 |
| 61 | Ga0070689_100035338 | 3300005340 | Bacteria | 3819 |
| 62 | Ga0070687_100019629 | 3300005343 | Bacteria | 3148 |
| 63 | Ga0070661_100014003 | 3300005344 | Bacteria | 5640 |
| 64 | Ga0070661_100029851 | 3300005344 | Bacteria | 3937 |
| 65 | Ga0070661_100059002 | 3300005344 | Bacteria | 2813 |
| 66 | Ga0070661_100134669 | 3300005344 | Bacteria | 1858 |
| 67 | Ga0070661_100848087 | 3300005344 | Bacteria | 752 |
| 68 | Ga0070692_10008464 | 3300005345 | Bacteria | 4591 |
| 69 | Ga0070692_10020838 | 3300005345 | Bacteria | 3183 |
| 70 | Ga0070668_100006224 | 3300005347 | Bacteria | 8841 |
| 71 | Ga0070668_100063822 | 3300005347 | Bacteria | 2855 |
| 72 | Ga0070668_100111974 | 3300005347 | Bacteria | 2173 |
| 73 | Ga0070668_100124506 | 3300005347 | Bacteria | 2064 |
| 74 | Ga0070668_100376224 | 3300005347 | Bacteria | 1208 |
| 75 | Ga0070668_100488934 | 3300005347 | Bacteria | 1064 |
| 76 | Ga0070669_100000319 | 3300005353 | Bacteria | 37553 |
| 77 | Ga0070669_100090988 | 3300005353 | Bacteria | 2287 |
| 78 | Ga0070669_100210320 | 3300005353 | Bacteria | 1534 |
| 79 | Ga0070669_100300199 | 3300005353 | Unclassified | 1291 |
| 80 | Ga0070669_100437139 | 3300005353 | Bacteria | 1076 |
| 81 | Ga0070669_100494997 | 3300005353 | Bacteria | 1013 |
| 82 | Ga0070675_100008839 | 3300005354 | Bacteria | 7830 |
| 83 | Ga0070675_100010756 | 3300005354 | Bacteria | 7158 |
| 84 | Ga0070675_100354169 | 3300005354 | Bacteria | 1302 |
| 85 | Ga0070671_100000356 | 3300005355 | Bacteria | 31426 |
| 86 | Ga0070671_100001617 | 3300005355 | Bacteria | 16971 |
| 87 | Ga0070671_100003440 | 3300005355 | Bacteria | 12355 |
| 88 | Ga0070671_100004676 | 3300005355 | Bacteria | 10862 |
| 89 | Ga0070671_100036498 | 3300005355 | Bacteria | 4076 |
| 90 | Ga0070671_100068598 | 3300005355 | Bacteria | 2958 |
| 91 | Ga0070671_100238383 | 3300005355 | Bacteria | 1544 |
| 92 | Ga0070674_100010722 | 3300005356 | Bacteria | 5554 |
| 93 | Ga0070674_100017030 | 3300005356 | Bacteria | 4563 |
| 94 | Ga0070674_100052279 | 3300005356 | Bacteria | 2818 |
| 95 | Ga0070674_100085184 | 3300005356 | Bacteria | 2267 |
| 96 | Ga0070674_100170102 | 3300005356 | Bacteria | 1660 |
| 97 | Ga0070674_100286761 | 3300005356 | Bacteria | 1307 |
| 98 | Ga0070674_100432097 | 3300005356 | Bacteria | 1083 |
| 99 | Ga0070674_100525659 | 3300005356 | Bacteria | 989 |
| 100 | Ga0070673_100000675 | 3300005364 | Bacteria | 18818 |
| 101 | Ga0070673_100025388 | 3300005364 | Bacteria | 4360 |
| 102 | Ga0070673_100440349 | 3300005364 | Bacteria | 1171 |
| 103 | Ga0070673_100561239 | 3300005364 | Bacteria | 1038 |
| 104 | Ga0070659_100001722 | 3300005366 | Bacteria | 15711 |
| 105 | Ga0070659_100007979 | 3300005366 | Bacteria | 7715 |
| 106 | Ga0070659_100045598 | 3300005366 | Bacteria | 3434 |
| 107 | Ga0070659_100129051 | 3300005366 | Bacteria | 2052 |
| 108 | Ga0070659_100174895 | 3300005366 | Bacteria | 1760 |
| 109 | Ga0070659_100411285 | 3300005366 | Bacteria | 1143 |
| 110 | Ga0070667_100001265 | 3300005367 | Bacteria | 22928 |
| 111 | Ga0070667_100008606 | 3300005367 | Bacteria | 8459 |
| 112 | Ga0070667_100044671 | 3300005367 | Bacteria | 3722 |
| 113 | Ga0070667_100639329 | 3300005367 | Unclassified | 982 |
| 114 | Ga0070714_100043979 | 3300005435 | Bacteria | 3780 |
| 115 | Ga0070713_100693070 | 3300005436 | Unclassified | 972 |
| 116 | Ga0070694_100007483 | 3300005444 | Bacteria | 6660 |
| 117 | Ga0070663_100004495 | 3300005455 | Bacteria | 8213 |
| 118 | Ga0070663_100256763 | 3300005455 | Bacteria | 1385 |
| 119 | Ga0070678_100011915 | 3300005456 | Bacteria | 5382 |
| 120 | Ga0070678_100012540 | 3300005456 | Bacteria | 5275 |
| 121 | Ga0070662_100001355 | 3300005457 | Bacteria | 15049 |
| 122 | Ga0070662_100002363 | 3300005457 | Bacteria | 11597 |
| 123 | Ga0070662_100003335 | 3300005457 | Bacteria | 10015 |
| 124 | Ga0070662_100014311 | 3300005457 | Bacteria | 5298 |
| 125 | Ga0070662_100030837 | 3300005457 | Bacteria | 3756 |
| 126 | Ga0070662_100073125 | 3300005457 | Bacteria | 2533 |
| 127 | Ga0070681_10076341 | 3300005458 | Bacteria | 3309 |
| 128 | Ga0070681_10319216 | 3300005458 | Bacteria | 1463 |
| 129 | Ga0070681_10691809 | 3300005458 | Bacteria | 935 |
| 130 | Ga0068867_100003550 | 3300005459 | Bacteria | 10965 |
| 131 | Ga0068867_100010679 | 3300005459 | Bacteria | 6477 |
| 132 | Ga0068867_100223897 | 3300005459 | Bacteria | 1517 |
| 133 | Ga0068867_100934711 | 3300005459 | Bacteria | 782 |
| 134 | Ga0070706_100165529 | 3300005467 | Bacteria | 2065 |
| 135 | Ga0070679_100061978 | 3300005530 | Unclassified | 3727 |
| 136 | Ga0070679_100084097 | 3300005530 | Bacteria | 3170 |
| 137 | Ga0070679_100283444 | 3300005530 | Bacteria | 1609 |
| 138 | Ga0070679_100309920 | 3300005530 | Bacteria | 1528 |
| 139 | Ga0070679_100599459 | 3300005530 | Bacteria | 1045 |
| 140 | Ga0070684_100146234 | 3300005535 | Bacteria | 2139 |
| 141 | Ga0068853_100008649 | 3300005539 | Bacteria | 8184 |
| 142 | Ga0068853_100146353 | 3300005539 | Bacteria | 2123 |
| 143 | Ga0068853_100579055 | 3300005539 | Bacteria | 1065 |
| 144 | Ga0070672_100000668 | 3300005543 | Bacteria | 20156 |
| 145 | Ga0070672_100024701 | 3300005543 | Bacteria | 4446 |
| 146 | Ga0070672_100027847 | 3300005543 | Bacteria | 4220 |
| 147 | Ga0070672_100060167 | 3300005543 | Bacteria | 2990 |
| 148 | Ga0070672_100103270 | 3300005543 | Bacteria | 2315 |
| 149 | Ga0070672_100270766 | 3300005543 | Unclassified | 1434 |
| 150 | Ga0070695_100033084 | 3300005545 | Bacteria | 3234 |
| 151 | Ga0070696_100022566 | 3300005546 | Bacteria | 4277 |
| 152 | Ga0070693_100007166 | 3300005547 | Bacteria | 5439 |
| 153 | Ga0070665_100034682 | 3300005548 | Bacteria | 5076 |
| 154 | Ga0070665_100120974 | 3300005548 | Bacteria | 2619 |
| 155 | Ga0070665_100363178 | 3300005548 | Bacteria | 1454 |
| 156 | Ga0070704_100108118 | 3300005549 | Bacteria | 2111 |
| 157 | Ga0068855_100003914 | 3300005563 | Bacteria | 18177 |
| 158 | Ga0068855_100038250 | 3300005563 | Bacteria | 5701 |
| 159 | Ga0068855_100090451 | 3300005563 | Bacteria | 3532 |
| 160 | Ga0070664_100005277 | 3300005564 | Bacteria | 10368 |
| 161 | Ga0070664_100006472 | 3300005564 | Bacteria | 9442 |
| 162 | Ga0070664_100034748 | 3300005564 | Bacteria | 4229 |
| 163 | Ga0070664_100055635 | 3300005564 | Bacteria | 3360 |
| 164 | Ga0070664_100065545 | 3300005564 | Bacteria | 3099 |
| 165 | Ga0070664_100261231 | 3300005564 | Bacteria | 1558 |
| 166 | Ga0070664_100679635 | 3300005564 | Bacteria | 958 |
| 167 | Ga0068857_100000246 | 3300005577 | Bacteria | 36409 |
| 168 | Ga0068857_100066598 | 3300005577 | Bacteria | 3205 |
| 169 | Ga0068857_100079147 | 3300005577 | Bacteria | 2934 |
| 170 | Ga0068857_100386753 | 3300005577 | Bacteria | 1300 |
| 171 | Ga0068854_100000337 | 3300005578 | Bacteria | 30470 |
| 172 | Ga0068854_100008850 | 3300005578 | Bacteria | 6479 |
| 173 | Ga0068854_100052088 | 3300005578 | Bacteria | 2934 |
| 174 | Ga0068854_100269087 | 3300005578 | Unclassified | 1367 |
| 175 | Ga0068854_100292429 | 3300005578 | Bacteria | 1315 |
| 176 | Ga0068856_100310228 | 3300005614 | Bacteria | 1595 |
| 177 | Ga0068852_100004492 | 3300005616 | Bacteria | 9861 |
| 178 | Ga0068852_100015237 | 3300005616 | Bacteria | 5953 |
| 179 | Ga0068852_100112161 | 3300005616 | Bacteria | 2481 |
| 180 | Ga0068852_100526411 | 3300005616 | Bacteria | 1180 |
| 181 | Ga0068859_100020576 | 3300005617 | Bacteria | 6621 |
| 182 | Ga0068859_100102752 | 3300005617 | Bacteria | 2916 |
| 183 | Ga0068864_100000810 | 3300005618 | Bacteria | 26293 |
| 184 | Ga0068864_100034527 | 3300005618 | Bacteria | 4302 |
| 185 | Ga0068864_100069433 | 3300005618 | Bacteria | 3064 |
| 186 | Ga0068864_100078348 | 3300005618 | Bacteria | 2892 |
| 187 | Ga0068861_100002114 | 3300005719 | Bacteria | 12859 |
| 188 | Ga0068861_100118555 | 3300005719 | Bacteria | 2132 |
| 189 | Ga0068861_100376400 | 3300005719 | Bacteria | 1253 |
| 190 | Ga0068851_10046854 | 3300005834 | Bacteria | 2188 |
| 191 | Ga0068870_10029673 | 3300005840 | Bacteria | 2757 |
| 192 | Ga0068863_100006391 | 3300005841 | Bacteria | 11555 |
| 193 | Ga0068863_100711167 | 3300005841 | Bacteria | 999 |
| 194 | Ga0068858_100001398 | 3300005842 | Bacteria | 24841 |
| 195 | Ga0068858_100005575 | 3300005842 | Bacteria | 12316 |
| 196 | Ga0068858_100546919 | 3300005842 | Bacteria | 1121 |
| 197 | Ga0068858_101116584 | 3300005842 | Bacteria | 774 |
| 198 | Ga0068860_100013628 | 3300005843 | Bacteria | 7969 |
| 199 | Ga0068860_100107091 | 3300005843 | Bacteria | 2671 |
| 200 | Ga0068860_100193083 | 3300005843 | Bacteria | 1971 |
| 201 | Ga0068862_100021398 | 3300005844 | Bacteria | 5404 |
| 202 | Ga0068862_100071902 | 3300005844 | Bacteria | 2987 |
| 203 | Ga0068862_100276550 | 3300005844 | Bacteria | 1537 |
| 204 | Ga0081540_1093870 | 3300005983 | Bacteria | 1312 |
| 205 | Ga0097621_100105496 | 3300006237 | Bacteria | 2376 |
| 206 | Ga0097621_100538086 | 3300006237 | Bacteria | 1062 |
| 207 | Ga0097621_100820258 | 3300006237 | Bacteria | 863 |
| 208 | Ga0068871_100235563 | 3300006358 | Unclassified | 1590 |
| 209 | Ga0075428_100028540 | 3300006844 | Bacteria | 6173 |
| 210 | Ga0075428_100284426 | 3300006844 | Bacteria | 1779 |
| 211 | Ga0075431_100157480 | 3300006847 | Bacteria | 2336 |
| 212 | Ga0075429_100064132 | 3300006880 | Bacteria | 3200 |
| 213 | Ga0068865_100000374 | 3300006881 | Bacteria | 24788 |
| 214 | Ga0068865_100470784 | 3300006881 | Bacteria | 1042 |
| 215 | Ga0097620_100020575 | 3300006931 | Bacteria | 6621 |
| 216 | Ga0097620_100102753 | 3300006931 | Bacteria | 2916 |
| 217 | Ga0097620_100696124 | 3300006931 | Bacteria | 1107 |
| 218 | Ga0105240_10031565 | 3300009093 | Bacteria | 6868 |
| 219 | Ga0105240_10547186 | 3300009093 | Unclassified | 1281 |
| 220 | Ga0111539_10209784 | 3300009094 | Bacteria | 2270 |
| 221 | Ga0105245_10000275 | 3300009098 | Bacteria | 48749 |
| 222 | Ga0105243_10100127 | 3300009148 | Bacteria | 2404 |
| 223 | Ga0105241_10021669 | 3300009174 | Bacteria | 4754 |
| 224 | Ga0105241_10201404 | 3300009174 | Unclassified | 1663 |
| 225 | Ga0105242_10279981 | 3300009176 | Bacteria | 1515 |
| 226 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 227 | Ga0105248_10001002 | 3300009177 | Bacteria | 31241 |
| 228 | Ga0105248_10008541 | 3300009177 | Bacteria | 11243 |
| 229 | Ga0105248_10041900 | 3300009177 | Bacteria | 5134 |
| 230 | Ga0105248_10091476 | 3300009177 | Bacteria | 3426 |
| 231 | Ga0105237_10003164 | 3300009545 | Bacteria | 19773 |
| 232 | Ga0105238_10067722 | 3300009551 | Bacteria | 3571 |
| 233 | Ga0105238_10185367 | 3300009551 | Bacteria | 2057 |
| 234 | Ga0105249_10053856 | 3300009553 | Bacteria | 3678 |
| 235 | Ga0105249_10095314 | 3300009553 | Bacteria | 2790 |
| 236 | Ga0105239_10024971 | 3300010375 | Bacteria | 6583 |
| 237 | Ga0105239_10877812 | 3300010375 | Bacteria | 1029 |
| 238 | Ga0105246_10012920 | 3300011119 | Bacteria | 5224 |
| 239 | Ga0157373_10025963 | 3300013100 | Bacteria | 4233 |
| 240 | Ga0157373_10031370 | 3300013100 | Bacteria | 3826 |
| 241 | Ga0157373_10043878 | 3300013100 | Bacteria | 3193 |
| 242 | Ga0157373_10071003 | 3300013100 | Bacteria | 2460 |
| 243 | Ga0157371_10000637 | 3300013102 | Bacteria | 41589 |
| 244 | Ga0157371_10060928 | 3300013102 | Bacteria | 2675 |
| 245 | Ga0157371_10137533 | 3300013102 | Bacteria | 1740 |
| 246 | Ga0157371_10216097 | 3300013102 | Unclassified | 1376 |
| 247 | Ga0157370_10006047 | 3300013104 | Bacteria | 13441 |
| 248 | Ga0157374_10046999 | 3300013296 | Bacteria | 3999 |
| 249 | Ga0157378_10002341 | 3300013297 | Bacteria | 16827 |
| 250 | Ga0157378_10246727 | 3300013297 | Bacteria | 1708 |
| 251 | Ga0163162_10058474 | 3300013306 | Bacteria | 3884 |
| 252 | Ga0163162_10168603 | 3300013306 | Bacteria | 2314 |
| 253 | Ga0157372_10146066 | 3300013307 | Bacteria | 2727 |
| 254 | Ga0157372_10164726 | 3300013307 | Bacteria | 2563 |
| 255 | Ga0157375_10088799 | 3300013308 | Bacteria | 3146 |
| 256 | Ga0157375_10646789 | 3300013308 | Bacteria | 1214 |
| 257 | Ga0157375_11315540 | 3300013308 | Bacteria | 850 |
| 258 | Ga0157380_10009958 | 3300014326 | Bacteria | 6822 |
| 259 | Ga0157380_10825366 | 3300014326 | Bacteria | 946 |
| 260 | Ga0157379_10121365 | 3300014968 | Bacteria | 2351 |
| 261 | Ga0207425_1017920 | 3300025245 | Bacteria | 1546 |
| 262 | Ga0209130_1004853 | 3300025284 | Bacteria | 4909 |
| 263 | Ga0209675_1010132 | 3300025291 | Bacteria | 3248 |
| 264 | Ga0209675_1015047 | 3300025291 | Bacteria | 2319 |
| 265 | Ga0209676_1000853 | 3300025292 | Bacteria | 39341 |
| 266 | Ga0209676_1001374 | 3300025292 | Bacteria | 23748 |
| 267 | Ga0209676_1004286 | 3300025292 | Bacteria | 8042 |
| 268 | Ga0209676_1004361 | 3300025292 | Bacteria | 7920 |
| 269 | Ga0209676_1009285 | 3300025292 | Bacteria | 4260 |
| 270 | Ga0209676_1032853 | 3300025292 | Bacteria | 1554 |
| 271 | Ga0209676_1038842 | 3300025292 | Bacteria | 1358 |
| 272 | Ga0209025_1001514 | 3300025294 | Bacteria | 29830 |
| 273 | Ga0209025_1045192 | 3300025294 | Bacteria | 1829 |
| 274 | Ga0209050_1000652 | 3300025298 | Bacteria | 53645 |
| 275 | Ga0209050_1010093 | 3300025298 | Bacteria | 4705 |
| 276 | Ga0209256_1004674 | 3300025299 | Bacteria | 8409 |
| 277 | Ga0209256_1005718 | 3300025299 | Bacteria | 6973 |
| 278 | Ga0209256_1007836 | 3300025299 | Bacteria | 5132 |
| 279 | Ga0209051_1018108 | 3300025303 | Bacteria | 3126 |
| 280 | Ga0209257_1000378 | 3300025304 | Bacteria | 88945 |
| 281 | Ga0209257_1001186 | 3300025304 | Bacteria | 32842 |
| 282 | Ga0209257_1001359 | 3300025304 | Bacteria | 29586 |
| 283 | Ga0209257_1001512 | 3300025304 | Bacteria | 27306 |
| 284 | Ga0209257_1001632 | 3300025304 | Bacteria | 25694 |
| 285 | Ga0209257_1031756 | 3300025304 | Bacteria | 1685 |
| 286 | Ga0209257_1065175 | 3300025304 | Bacteria | 977 |
| 287 | Ga0207697_10000112 | 3300025315 | Bacteria | 37791 |
| 288 | Ga0207697_10128414 | 3300025315 | Bacteria | 1094 |
| 289 | Ga0207656_10031573 | 3300025321 | Bacteria | 2196 |
| 290 | Ga0207682_10053215 | 3300025893 | Bacteria | 1679 |
| 291 | Ga0207688_10003553 | 3300025901 | Bacteria | 8506 |
| 292 | Ga0207688_10042413 | 3300025901 | Bacteria | 2533 |
| 293 | Ga0207688_10211327 | 3300025901 | Bacteria | 1166 |
| 294 | Ga0207680_10000271 | 3300025903 | Bacteria | 24747 |
| 295 | Ga0207680_10005882 | 3300025903 | Bacteria | 5891 |
| 296 | Ga0207680_10077597 | 3300025903 | Bacteria | 2078 |
| 297 | Ga0207647_10000101 | 3300025904 | Bacteria | 66258 |
| 298 | Ga0207647_10001771 | 3300025904 | Bacteria | 16572 |
| 299 | Ga0207647_10013159 | 3300025904 | Bacteria | 5748 |
| 300 | Ga0207645_10000896 | 3300025907 | Bacteria | 24720 |
| 301 | Ga0207645_10009043 | 3300025907 | Bacteria | 6915 |
| 302 | Ga0207645_10265398 | 3300025907 | Bacteria | 1138 |
| 303 | Ga0207643_10181846 | 3300025908 | Bacteria | 1273 |
| 304 | Ga0207705_10001965 | 3300025909 | Bacteria | 16037 |
| 305 | Ga0207705_10004972 | 3300025909 | Bacteria | 9974 |
| 306 | Ga0207705_10051806 | 3300025909 | Bacteria | 2954 |
| 307 | Ga0207707_10162887 | 3300025912 | Bacteria | 1950 |
| 308 | Ga0207695_10070818 | 3300025913 | Bacteria | 3562 |
| 309 | Ga0207671_10006191 | 3300025914 | Bacteria | 10744 |
| 310 | Ga0207657_10002057 | 3300025919 | Bacteria | 21773 |
| 311 | Ga0207657_10008696 | 3300025919 | Bacteria | 10278 |
| 312 | Ga0207657_10020154 | 3300025919 | Bacteria | 6309 |
| 313 | Ga0207657_10026236 | 3300025919 | Bacteria | 5358 |
| 314 | Ga0207657_10083306 | 3300025919 | Bacteria | 2683 |
| 315 | Ga0207657_10127354 | 3300025919 | Bacteria | 2090 |
| 316 | Ga0207649_10009357 | 3300025920 | Bacteria | 5362 |
| 317 | Ga0207649_10062811 | 3300025920 | Bacteria | 2342 |
| 318 | Ga0207649_10104872 | 3300025920 | Bacteria | 1878 |
| 319 | Ga0207652_10072744 | 3300025921 | Unclassified | 2990 |
| 320 | Ga0207652_10215798 | 3300025921 | Bacteria | 1728 |
| 321 | Ga0207652_10218738 | 3300025921 | Bacteria | 1716 |
| 322 | Ga0207681_10001255 | 3300025923 | Bacteria | 16359 |
| 323 | Ga0207681_10025491 | 3300025923 | Bacteria | 3804 |
| 324 | Ga0207681_10402425 | 3300025923 | Bacteria | 1106 |
| 325 | Ga0207681_10452786 | 3300025923 | Bacteria | 1044 |
| 326 | Ga0207694_10182980 | 3300025924 | Bacteria | 1700 |
| 327 | Ga0207650_10030898 | 3300025925 | Bacteria | 3863 |
| 328 | Ga0207650_10710764 | 3300025925 | Bacteria | 849 |
| 329 | Ga0207659_10002669 | 3300025926 | Bacteria | 10632 |
| 330 | Ga0207659_10060116 | 3300025926 | Bacteria | 2734 |
| 331 | Ga0207659_10173203 | 3300025926 | Bacteria | 1704 |
| 332 | Ga0207687_10001375 | 3300025927 | Bacteria | 16604 |
| 333 | Ga0207700_10715139 | 3300025928 | Unclassified | 894 |
| 334 | Ga0207644_10000794 | 3300025931 | Bacteria | 20032 |
| 335 | Ga0207644_10006565 | 3300025931 | Bacteria | 7578 |
| 336 | Ga0207644_10013382 | 3300025931 | Bacteria | 5467 |
| 337 | Ga0207644_10015555 | 3300025931 | Bacteria | 5110 |
| 338 | Ga0207644_10083017 | 3300025931 | Bacteria | 2372 |
| 339 | Ga0207644_10282663 | 3300025931 | Bacteria | 1333 |
| 340 | Ga0207690_10000830 | 3300025932 | Bacteria | 19806 |
| 341 | Ga0207690_10001735 | 3300025932 | Bacteria | 13389 |
| 342 | Ga0207690_10012431 | 3300025932 | Bacteria | 5091 |
| 343 | Ga0207690_10058154 | 3300025932 | Bacteria | 2614 |
| 344 | Ga0207690_10284017 | 3300025932 | Bacteria | 1290 |
| 345 | Ga0207690_10300264 | 3300025932 | Bacteria | 1256 |
| 346 | Ga0207690_10515515 | 3300025932 | Unclassified | 968 |
| 347 | Ga0207706_10000318 | 3300025933 | Bacteria | 52104 |
| 348 | Ga0207706_10002476 | 3300025933 | Bacteria | 17998 |
| 349 | Ga0207706_10004182 | 3300025933 | Bacteria | 13591 |
| 350 | Ga0207706_10011384 | 3300025933 | Bacteria | 8104 |
| 351 | Ga0207706_10019015 | 3300025933 | Bacteria | 6179 |
| 352 | Ga0207706_10034041 | 3300025933 | Bacteria | 4534 |
| 353 | Ga0207706_10037251 | 3300025933 | Bacteria | 4320 |
| 354 | Ga0207706_10048438 | 3300025933 | Bacteria | 3758 |
| 355 | Ga0207706_10518769 | 3300025933 | Bacteria | 1027 |
| 356 | Ga0207706_10630625 | 3300025933 | Bacteria | 919 |
| 357 | Ga0207686_10503411 | 3300025934 | Bacteria | 940 |
| 358 | Ga0207709_10145224 | 3300025935 | Bacteria | 1636 |
| 359 | Ga0207709_10228144 | 3300025935 | Unclassified | 1347 |
| 360 | Ga0207670_10024552 | 3300025936 | Bacteria | 3769 |
| 361 | Ga0207669_10003616 | 3300025937 | Bacteria | 6705 |
| 362 | Ga0207669_10013957 | 3300025937 | Bacteria | 4012 |
| 363 | Ga0207669_10020878 | 3300025937 | Bacteria | 3444 |
| 364 | Ga0207669_10473846 | 3300025937 | Bacteria | 996 |
| 365 | Ga0207669_10582272 | 3300025937 | Bacteria | 907 |
| 366 | Ga0207704_10003539 | 3300025938 | Bacteria | 7103 |
| 367 | Ga0207704_10147272 | 3300025938 | Bacteria | 1656 |
| 368 | Ga0207691_10000593 | 3300025940 | Bacteria | 36106 |
| 369 | Ga0207691_10002976 | 3300025940 | Bacteria | 16541 |
| 370 | Ga0207691_10016716 | 3300025940 | Bacteria | 6967 |
| 371 | Ga0207691_10040559 | 3300025940 | Bacteria | 4300 |
| 372 | Ga0207691_10134588 | 3300025940 | Bacteria | 2181 |
| 373 | Ga0207691_10157034 | 3300025940 | Bacteria | 1997 |
| 374 | Ga0207691_10176782 | 3300025940 | Bacteria | 1867 |
| 375 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 376 | Ga0207711_10000823 | 3300025941 | Bacteria | 30322 |
| 377 | Ga0207711_10003620 | 3300025941 | Bacteria | 13367 |
| 378 | Ga0207711_10077818 | 3300025941 | Bacteria | 2892 |
| 379 | Ga0207689_10000016 | 3300025942 | Bacteria | 118140 |
| 380 | Ga0207661_10014686 | 3300025944 | Bacteria | 5745 |
| 381 | Ga0207679_10031679 | 3300025945 | Bacteria | 3703 |
| 382 | Ga0207679_10089834 | 3300025945 | Bacteria | 2372 |
| 383 | Ga0207679_10196631 | 3300025945 | Bacteria | 1681 |
| 384 | Ga0207679_10262005 | 3300025945 | Bacteria | 1475 |
| 385 | Ga0207679_10351965 | 3300025945 | Bacteria | 1284 |
| 386 | Ga0207667_10015822 | 3300025949 | Bacteria | 8549 |
| 387 | Ga0207667_10031806 | 3300025949 | Bacteria | 5693 |
| 388 | Ga0207667_10256584 | 3300025949 | Bacteria | 1788 |
| 389 | Ga0207651_10074504 | 3300025960 | Bacteria | 2418 |
| 390 | Ga0207651_10198928 | 3300025960 | Bacteria | 1604 |
| 391 | Ga0207651_10915413 | 3300025960 | Bacteria | 781 |
| 392 | Ga0207712_10000146 | 3300025961 | Bacteria | 73378 |
| 393 | Ga0207668_10000070 | 3300025972 | Bacteria | 78666 |
| 394 | Ga0207668_10058010 | 3300025972 | Bacteria | 2704 |
| 395 | Ga0207668_10189620 | 3300025972 | Bacteria | 1628 |
| 396 | Ga0207668_10223882 | 3300025972 | Unclassified | 1512 |
| 397 | Ga0207668_10669307 | 3300025972 | Bacteria | 910 |
| 398 | Ga0207640_10007415 | 3300025981 | Bacteria | 6053 |
| 399 | Ga0207640_10129552 | 3300025981 | Bacteria | 1821 |
| 400 | Ga0207640_10263868 | 3300025981 | Unclassified | 1344 |
| 401 | Ga0207658_10006101 | 3300025986 | Bacteria | 8228 |
| 402 | Ga0207658_10012129 | 3300025986 | Bacteria | 5878 |
| 403 | Ga0207658_10014061 | 3300025986 | Bacteria | 5479 |
| 404 | Ga0207677_10001192 | 3300026023 | Bacteria | 14092 |
| 405 | Ga0207677_10004539 | 3300026023 | Bacteria | 7468 |
| 406 | Ga0207677_10913905 | 3300026023 | Bacteria | 792 |
| 407 | Ga0207703_10004651 | 3300026035 | Bacteria | 11214 |
| 408 | Ga0207703_10070440 | 3300026035 | Bacteria | 2886 |
| 409 | Ga0207639_10018488 | 3300026041 | Bacteria | 4954 |
| 410 | Ga0207639_10162971 | 3300026041 | Bacteria | 1881 |
| 411 | Ga0207639_10330202 | 3300026041 | Bacteria | 1357 |
| 412 | Ga0207678_10003724 | 3300026067 | Bacteria | 13714 |
| 413 | Ga0207678_10106477 | 3300026067 | Bacteria | 2392 |
| 414 | Ga0207678_10262728 | 3300026067 | Bacteria | 1479 |
| 415 | Ga0207702_10020794 | 3300026078 | Bacteria | 5428 |
| 416 | Ga0207702_10272806 | 3300026078 | Bacteria | 1596 |
| 417 | Ga0207641_10024405 | 3300026088 | Bacteria | 4984 |
| 418 | Ga0207641_10089142 | 3300026088 | Bacteria | 2695 |
| 419 | Ga0207648_10001147 | 3300026089 | Bacteria | 29705 |
| 420 | Ga0207648_10007206 | 3300026089 | Bacteria | 10966 |
| 421 | Ga0207676_10001961 | 3300026095 | Bacteria | 14987 |
| 422 | Ga0207676_10081042 | 3300026095 | Bacteria | 2636 |
| 423 | Ga0207676_10094261 | 3300026095 | Bacteria | 2466 |
| 424 | Ga0207676_10102195 | 3300026095 | Bacteria | 2379 |
| 425 | Ga0207674_10000114 | 3300026116 | Bacteria | 93676 |
| 426 | Ga0207674_10006404 | 3300026116 | Bacteria | 13848 |
| 427 | Ga0207674_10078059 | 3300026116 | Bacteria | 3316 |
| 428 | Ga0207675_100143220 | 3300026118 | Bacteria | 2271 |
| 429 | Ga0207683_10048333 | 3300026121 | Bacteria | 3726 |
| 430 | Ga0207683_10131758 | 3300026121 | Bacteria | 2249 |
| 431 | Ga0207683_10484568 | 3300026121 | Unclassified | 1142 |
| 432 | Ga0207683_10779031 | 3300026121 | Bacteria | 888 |
| 433 | Ga0207698_10002635 | 3300026142 | Bacteria | 10659 |
| 434 | Ga0207698_10068870 | 3300026142 | Unclassified | 2796 |
| 435 | Ga0207698_10322858 | 3300026142 | Bacteria | 1447 |
| 436 | Ga0209974_10008000 | 3300027876 | Bacteria | 3623 |
| 437 | Ga0209974_10079573 | 3300027876 | Bacteria | 1126 |
| 438 | Ga0268266_10022686 | 3300028379 | Bacteria | 5344 |
| 439 | Ga0268266_10394512 | 3300028379 | Bacteria | 1307 |
| 440 | Ga0268265_10010369 | 3300028380 | Bacteria | 6294 |
| 441 | Ga0268265_10016177 | 3300028380 | Bacteria | 5121 |
| 442 | Ga0268265_10151545 | 3300028380 | Bacteria | 1956 |
| 443 | Ga0268264_10000594 | 3300028381 | Bacteria | 43886 |
| 444 | Ga0268264_10054786 | 3300028381 | Bacteria | 3331 |
| 445 | Ga0268264_10321431 | 3300028381 | Unclassified | 1463 |
| 446 | Ga0265338_10082676 | 3300028800 | Bacteria | 2688 |
| 447 | Ga0316182_1184530 | 3300030745 | Bacteria | 3386 |
| 448 | Ga0316182_1278238 | 3300030745 | Bacteria | 3352 |
| 449 | Ga0307408_100105786 | 3300031548 | Bacteria | 2152 |
| 450 | Ga0307408_100142030 | 3300031548 | Bacteria | 1885 |
| 451 | Ga0307408_100315572 | 3300031548 | Bacteria | 1315 |
| 452 | Ga0307408_100379744 | 3300031548 | Bacteria | 1208 |
| 453 | Ga0307408_100547643 | 3300031548 | Bacteria | 1020 |
| 454 | Ga0265314_10004913 | 3300031711 | Bacteria | 12211 |
| 455 | Ga0307405_10020352 | 3300031731 | Bacteria | 3706 |
| 456 | Ga0307405_10032415 | 3300031731 | Bacteria | 3089 |
| 457 | Ga0307405_10061804 | 3300031731 | Bacteria | 2369 |
| 458 | Ga0307405_10331418 | 3300031731 | Bacteria | 1166 |
| 459 | Ga0307413_10060648 | 3300031824 | Bacteria | 2330 |
| 460 | Ga0307413_10116011 | 3300031824 | Bacteria | 1803 |
| 461 | Ga0307413_10129647 | 3300031824 | Bacteria | 1723 |
| 462 | Ga0307413_10140456 | 3300031824 | Bacteria | 1668 |
| 463 | Ga0307413_10262954 | 3300031824 | Unclassified | 1287 |
| 464 | Ga0307413_10920467 | 3300031824 | Bacteria | 744 |
| 465 | Ga0307410_10005694 | 3300031852 | Bacteria | 6633 |
| 466 | Ga0307410_10036610 | 3300031852 | Bacteria | 3197 |
| 467 | Ga0307410_10040475 | 3300031852 | Bacteria | 3067 |
| 468 | Ga0307410_10164828 | 3300031852 | Bacteria | 1664 |
| 469 | Ga0307410_10169745 | 3300031852 | Bacteria | 1642 |
| 470 | Ga0307410_10407287 | 3300031852 | Bacteria | 1100 |
| 471 | Ga0307406_10030245 | 3300031901 | Bacteria | 3286 |
| 472 | Ga0307406_10080479 | 3300031901 | Bacteria | 2163 |
| 473 | Ga0307406_10194182 | 3300031901 | Bacteria | 1489 |
| 474 | Ga0307407_10024481 | 3300031903 | Bacteria | 3167 |
| 475 | Ga0307407_10058005 | 3300031903 | Bacteria | 2249 |
| 476 | Ga0307407_10073810 | 3300031903 | Bacteria | 2040 |
| 477 | Ga0307407_10300111 | 3300031903 | Bacteria | 1120 |
| 478 | Ga0307407_10321665 | 3300031903 | Bacteria | 1086 |
| 479 | Ga0307412_10007004 | 3300031911 | Bacteria | 6400 |
| 480 | Ga0307412_10061212 | 3300031911 | Bacteria | 2530 |
| 481 | Ga0307412_10125587 | 3300031911 | Bacteria | 1855 |
| 482 | Ga0307412_10169349 | 3300031911 | Bacteria | 1631 |
| 483 | Ga0307412_10520437 | 3300031911 | Bacteria | 994 |
| 484 | Ga0307412_10749215 | 3300031911 | Bacteria | 843 |
| 485 | Ga0307409_100049266 | 3300031995 | Bacteria | 3211 |
| 486 | Ga0307409_100224737 | 3300031995 | Bacteria | 1697 |
| 487 | Ga0307409_100495898 | 3300031995 | Bacteria | 1188 |
| 488 | Ga0307416_100016481 | 3300032002 | Bacteria | 5139 |
| 489 | Ga0307416_100069871 | 3300032002 | Bacteria | 2909 |
| 490 | Ga0307416_100208283 | 3300032002 | Bacteria | 1862 |
| 491 | Ga0307416_100228950 | 3300032002 | Bacteria | 1790 |
| 492 | Ga0307416_100341072 | 3300032002 | Bacteria | 1511 |
| 493 | Ga0307414_10017919 | 3300032004 | Bacteria | 4345 |
| 494 | Ga0307414_10065996 | 3300032004 | Bacteria | 2585 |
| 495 | Ga0307414_10108139 | 3300032004 | Bacteria | 2109 |
| 496 | Ga0307414_10136988 | 3300032004 | Bacteria | 1910 |
| 497 | Ga0307414_10226017 | 3300032004 | Bacteria | 1540 |
| 498 | Ga0307414_10527122 | 3300032004 | Bacteria | 1049 |
| 499 | Ga0307411_10003991 | 3300032005 | Bacteria | 6971 |
| 500 | Ga0307411_10013366 | 3300032005 | Bacteria | 4528 |
| 501 | Ga0307411_10069189 | 3300032005 | Bacteria | 2383 |
| 502 | Ga0307411_10120820 | 3300032005 | Bacteria | 1895 |
| 503 | Ga0307411_10187882 | 3300032005 | Bacteria | 1574 |
| 504 | Ga0307411_10609363 | 3300032005 | Bacteria | 940 |
| 505 | Ga0307411_11272591 | 3300032005 | Bacteria | 669 |
| 506 | Ga0307415_100007851 | 3300032126 | Bacteria | 5868 |
| 507 | Ga0307415_100169313 | 3300032126 | Bacteria | 1702 |
| 508 | Ga0307415_100172209 | 3300032126 | Bacteria | 1689 |
| 509 | Ga0307415_100533370 | 3300032126 | Bacteria | 1032 |
| 510 | Ga0307415_100645149 | 3300032126 | Bacteria | 948 |
| 511 | Ga0395899_0395559 | 3300037312 | Bacteria | 915 |
| 512 | Ga0395900_0041349 | 3300037418 | Bacteria | 4752 |
| 513 | Ga0395900_0049368 | 3300037418 | Bacteria | 4335 |
| 514 | Ga0395900_0086592 | 3300037418 | Bacteria | 3219 |
| 515 | Ga0395900_0317473 | 3300037418 | Bacteria | 1539 |
| 516 | Ga0395900_0820216 | 3300037418 | Bacteria | 857 |
| 517 | Ga0395898_0027957 | 3300037466 | Bacteria | 5656 |
| 518 | Ga0395898_0093912 | 3300037466 | Bacteria | 2882 |
| 519 | Ga0395898_0157863 | 3300037466 | Bacteria | 2169 |
| 520 | Ga0395898_0919627 | 3300037466 | Bacteria | 812 |
| 521 | Ga0395905_0000257 | 3300037471 | Bacteria | 79555 |
| 522 | Ga0395905_0020203 | 3300037471 | Bacteria | 6309 |
| 523 | Ga0395905_0026307 | 3300037471 | Bacteria | 5487 |
| 524 | Ga0395905_0045919 | 3300037471 | Bacteria | 4097 |
| 525 | Ga0395905_0046043 | 3300037471 | Bacteria | 4091 |
| 526 | Ga0395905_0065556 | 3300037471 | Bacteria | 3400 |
| 527 | Ga0395905_0069625 | 3300037471 | Bacteria | 3296 |
| 528 | Ga0395905_0174002 | 3300037471 | Bacteria | 2021 |
| 529 | Ga0395905_0204831 | 3300037471 | Bacteria | 1849 |
| 530 | Ga0395905_0272106 | 3300037471 | Unclassified | 1580 |
| 531 | Ga0395905_0298713 | 3300037471 | Bacteria | 1497 |
| 532 | Ga0395905_0305460 | 3300037471 | Bacteria | 1479 |
| 533 | Ga0395905_0317540 | 3300037471 | Bacteria | 1447 |
| 534 | Ga0395905_0537686 | 3300037471 | Unclassified | 1069 |
| 535 | Ga0395905_0660135 | 3300037471 | Unclassified | 948 |
| 536 | Ga0395905_0817775 | 3300037471 | Bacteria | 835 |
| 537 | Ga0395901_0042655 | 3300038443 | Bacteria | 4704 |
| 538 | Ga0395901_0302129 | 3300038443 | Bacteria | 1659 |
| 539 | Ga0395901_0393420 | 3300038443 | Bacteria | 1425 |
| 540 | Ga0395901_0979877 | 3300038443 | Bacteria | 822 |
| 541 | Ga0395901_1009510 | 3300038443 | Bacteria | 807 |
| 542 | Ga0395901_1154210 | 3300038443 | Bacteria | 742 |
| 543 | Ga0439465_0004297 | 3300041413 | Bacteria | 4625 |
| 544 | Ga0451793_1352091 | 3300041452 | Bacteria | 925 |
| 545 | Ga0451802_0622788 | 3300041460 | Unclassified | 1220 |
| 546 | Ga0451806_810621 | 3300041462 | Unclassified | 2009 |
| 547 | Ga0451807_1133111 | 3300041486 | Bacteria | 3618 |
| 548 | Ga0451851_0473752 | 3300041507 | Bacteria | 1095 |
| 549 | Ga0451853_0563708 | 3300041512 | Unclassified | 751 |
| 550 | Ga0439441_051689 | 3300042001 | Bacteria | 848 |
| 551 | Ga0439432_010691 | 3300042006 | Bacteria | 3174 |
| 552 | Ga0439449_0007223 | 3300042007 | Bacteria | 4226 |
| 553 | Ga0439449_0108666 | 3300042007 | Bacteria | 1027 |
| 554 | Ga0439455_0063386 | 3300042012 | Bacteria | 983 |
| 555 | Ga0439462_0001989 | 3300042015 | Bacteria | 4675 |
| 556 | Ga0439462_0113252 | 3300042015 | Bacteria | 752 |
| 557 | Ga0450917_000904 | 3300042120 | Bacteria | 2179 |
| 558 | Ga0450905_002655 | 3300042142 | Bacteria | 2309 |
| 559 | Ga0450889_005177 | 3300042144 | Bacteria | 1295 |
| 560 | Ga0439464_0001880 | 3300042439 | Bacteria | 5076 |
| 561 | Ga0439460_0004452 | 3300042461 | Bacteria | 3417 |
| 562 | Ga0439440_0055322 | 3300042993 | Bacteria | 1001 |
| 563 | Ga0466972_0257898 | 3300044658 | Bacteria | 815 |
| 564 | Ga0466966_0012063 | 3300044684 | Bacteria | 5726 |
| 565 | Ga0466966_0106303 | 3300044684 | Bacteria | 1732 |
| 566 | Ga0466961_0466573 | 3300044693 | Bacteria | 764 |
| 567 | Ga0466961_0485283 | 3300044693 | Bacteria | 747 |
| 568 | Ga0466963_0299563 | 3300044694 | Bacteria | 1131 |
| 569 | Ga0466963_0532399 | 3300044694 | Bacteria | 830 |
| 570 | Ga0466957_0232497 | 3300044842 | Bacteria | 1221 |
| 571 | Ga0466959_0075353 | 3300045049 | Bacteria | 2438 |
| 572 | Ga0466959_0100096 | 3300045049 | Bacteria | 2075 |
| 573 | Ga0466958_0134895 | 3300045836 | Bacteria | 1552 |
| 574 | Ga0466958_0143927 | 3300045836 | Bacteria | 1502 |
| 575 | Ga0466967_0047290 | 3300045976 | Bacteria | 3750 |
| 576 | Ga0466967_0666590 | 3300045976 | Bacteria | 1029 |
| 577 | Ga0495650_0000744 | 3300046471 | Bacteria | 40840 |
| 578 | Ga0495650_0044906 | 3300046471 | Bacteria | 1864 |
| 579 | Ga0495606_0087714 | 3300046507 | Bacteria | 1920 |
| 580 | Ga0495637_0006928 | 3300046520 | Bacteria | 5655 |
| 581 | Ga0495648_0000029 | 3300046524 | Bacteria | 223499 |
| 582 | Ga0495663_0000865 | 3300046525 | Bacteria | 10240 |
| 583 | Ga0495663_0034764 | 3300046525 | Bacteria | 1511 |
| 584 | Ga0495663_0071238 | 3300046525 | Bacteria | 1107 |
| 585 | Ga0495598_0009011 | 3300046537 | Bacteria | 2343 |
| 586 | Ga0495598_0092411 | 3300046537 | Bacteria | 989 |
| 587 | Ga0495621_0061372 | 3300046539 | Bacteria | 1365 |
| 588 | Ga0495656_0081099 | 3300046615 | Bacteria | 1464 |
| 589 | Ga0495668_0000014 | 3300046616 | Bacteria | 442055 |
| 590 | Ga0495668_0017889 | 3300046616 | Bacteria | 4106 |
| 591 | Ga0495625_0000777 | 3300046660 | Bacteria | 44363 |
| 592 | Ga0495625_0337356 | 3300046660 | Bacteria | 956 |
| 593 | Ga0495659_0133207 | 3300046664 | Bacteria | 987 |
| 594 | Ga0495669_0000046 | 3300046684 | Bacteria | 83405 |
| 595 | Ga0495669_0081276 | 3300046684 | Bacteria | 1487 |
| 596 | Ga0495669_0307110 | 3300046684 | Bacteria | 765 |
| 597 | Ga0495670_0077858 | 3300046691 | Bacteria | 1686 |
| 598 | Ga0495636_0000118 | 3300047318 | Bacteria | 32623 |
| 599 | Ga0495636_0014871 | 3300047318 | Bacteria | 3097 |
| 600 | Ga0495636_0040629 | 3300047318 | Bacteria | 1928 |
| 601 | Ga0495672_0002375 | 3300047320 | Bacteria | 17376 |
| 602 | Ga0495685_032435 | 3300047447 | Unclassified | 1795 |
| 603 | Ga0495673_0000597 | 3300047469 | Bacteria | 36148 |
| 604 | Ga0495673_0005592 | 3300047469 | Bacteria | 7568 |
| 605 | Ga0495686_0001938 | 3300047472 | Bacteria | 20595 |
| 606 | Ga0495686_0003054 | 3300047472 | Bacteria | 14838 |
| 607 | Ga0495686_0177379 | 3300047472 | Bacteria | 1236 |
| 608 | Ga0496100_0249157 | 3300048903 | Bacteria | 1313 |
| 609 | Ga0496100_0853191 | 3300048903 | Bacteria | 714 |
| 610 | Ga0496101_0065888 | 3300048904 | Bacteria | 2641 |
| 611 | Ga0496101_0072488 | 3300048904 | Bacteria | 2528 |
| 612 | Ga0496101_0118819 | 3300048904 | Bacteria | 1997 |
| 613 | Ga0496102_0622109 | 3300048905 | Bacteria | 1003 |
| 614 | Ga0496106_0096639 | 3300048909 | Bacteria | 2286 |
| 615 | Ga0496107_0000072 | 3300048910 | Bacteria | 48700 |
| 616 | Ga0496107_0021772 | 3300048910 | Bacteria | 4530 |
| 617 | Ga0496107_0067447 | 3300048910 | Bacteria | 2596 |
| 618 | Ga0496108_0010651 | 3300048911 | Bacteria | 7459 |
| 619 | Ga0496108_0278259 | 3300048911 | Bacteria | 1457 |
| 620 | Ga0496109_0150348 | 3300048912 | Bacteria | 2180 |
| 621 | Ga0496109_0170229 | 3300048912 | Bacteria | 2043 |
| 622 | Ga0496110_0051866 | 3300048913 | Bacteria | 3605 |
| 623 | Ga0496110_0722706 | 3300048913 | Bacteria | 898 |
| 624 | Ga0496111_0028532 | 3300048914 | Bacteria | 3955 |
| 625 | Ga0496111_0489035 | 3300048914 | Bacteria | 906 |
| 626 | Ga0496112_0013201 | 3300048915 | Bacteria | 7620 |
| 627 | Ga0496112_0063780 | 3300048915 | Bacteria | 3634 |
| 628 | Ga0496113_0009123 | 3300048916 | Bacteria | 6499 |
| 629 | Ga0496113_0529771 | 3300048916 | Bacteria | 945 |
| 630 | Ga0496114_0061753 | 3300048917 | Bacteria | 3135 |
| 631 | Ga0496115_0000488 | 3300048918 | Bacteria | 31339 |
| 632 | Ga0496117_0067494 | 3300048920 | Bacteria | 2420 |
| 633 | Ga0496118_0003515 | 3300048921 | Bacteria | 19633 |
| 634 | Ga0496121_0002753 | 3300048924 | Bacteria | 26136 |
| 635 | Ga0496121_0307995 | 3300048924 | Bacteria | 1072 |
| 636 | Ga0496125_0111724 | 3300048928 | Bacteria | 1976 |
| 637 | Ga0496126_0001950 | 3300048929 | Bacteria | 29310 |
| 638 | Ga0496126_0309947 | 3300048929 | Bacteria | 1300 |
| 639 | Ga0501043_0038647 | 3300049579 | Bacteria | 3752 |
| 640 | Ga0501046_0122514 | 3300049580 | Bacteria | 1977 |
| 641 | Ga0501067_0149612 | 3300049583 | Bacteria | 1301 |
| 642 | Ga0501074_0180267 | 3300049590 | Unclassified | 1507 |
| 643 | Ga0501223_040798 | 3300049663 | Bacteria | 901 |
| 644 | Ga0501257_011848 | 3300049686 | Bacteria | 1993 |
| 645 | Ga0501257_070402 | 3300049686 | Bacteria | 893 |
| 646 | Ga0501221_026311 | 3300049704 | Bacteria | 1182 |
| 647 | Ga0501273_036973 | 3300049770 | Bacteria | 712 |
| 648 | Ga0501279_019839 | 3300049775 | Bacteria | 953 |
| 649 | nmdc:mga09592_23810_c1 | 3300050508 | Bacteria | 5059 |
| 650 | nmdc:mga0qj67_118338_c1 | 3300050509 | Bacteria | 2142 |
| 651 | nmdc:mga0qj67_326364_c1 | 3300050509 | Bacteria | 1242 |
| 652 | nmdc:mga0qj67_513599_c1 | 3300050509 | Bacteria | 963 |
| 653 | nmdc:mga06r32_602170_c1 | 3300050510 | Bacteria | 1070 |
| 654 | nmdc:mga06r32_7607_c1 | 3300050510 | Bacteria | 9742 |
| 655 | nmdc:mga08y16_188500_c1 | 3300050511 | Bacteria | 2140 |
| 656 | Ga0500644_0000043 | 3300053088 | Bacteria | 76139 |
| 657 | Ga0500566_0260410 | 3300053094 | Bacteria | 838 |
| 658 | Ga0500556_0000466 | 3300053104 | Bacteria | 28540 |
| 659 | Ga0500614_002794 | 3300053123 | Bacteria | 3845 |
| 660 | Ga0500559_0064128 | 3300053136 | Bacteria | 1643 |
| 661 | Ga0500564_000015 | 3300053138 | Bacteria | 52672 |
| 662 | Ga0500604_0000478 | 3300053151 | Bacteria | 11043 |
| 663 | Ga0500619_035578 | 3300053154 | Unclassified | 1546 |
| 664 | Ga0500622_0003266 | 3300053156 | Bacteria | 10998 |
| 665 | Ga0500645_000289 | 3300053730 | Bacteria | 36194 |
| 666 | Ga0500645_021925 | 3300053730 | Bacteria | 1968 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005336 | Ga0070680_100172409 | Ga0070680_1001724092 | 176 |
| 2 | 3300005530 | Ga0070679_100061978 | Ga0070679_1000619781 | 176 |
| 3 | 3300025921 | Ga0207652_10072744 | Ga0207652_100727443 | 176 |
| 4 | 3300037471 | Ga0395905_0204831 | Ga0395905_0204831_11_568 | 181 |
| 5 | 3300010375 | Ga0105239_10877812 | Ga0105239_108778122 | 183 |
| 6 | 3300044693 | Ga0466961_0485283 | Ga0466961_0485283_149_703 | 183 |
| 7 | 3300009177 | Ga0105248_10041900 | Ga0105248_100419006 | 184 |
| 8 | 3300037471 | Ga0395905_0317540 | Ga0395905_0317540_288_842 | 184 |
| 9 | 3300048903 | Ga0496100_0853191 | Ga0496100_0853191_110_664 | 184 |
| 10 | 3300048904 | Ga0496101_0065888 | Ga0496101_0065888_2027_2581 | 184 |
| 11 | 3300048910 | Ga0496107_0021772 | Ga0496107_0021772_260_814 | 184 |
| 12 | 3300048911 | Ga0496108_0010651 | Ga0496108_0010651_6102_6656 | 184 |
| 13 | 3300048913 | Ga0496110_0051866 | Ga0496110_0051866_1206_1760 | 184 |
| 14 | 3300048913 | Ga0496110_0722706 | Ga0496110_0722706_318_872 | 184 |
| 15 | 3300048914 | Ga0496111_0028532 | Ga0496111_0028532_3384_3938 | 184 |
| 16 | 3300048914 | Ga0496111_0489035 | Ga0496111_0489035_324_878 | 184 |
| 17 | 3300048915 | Ga0496112_0013201 | Ga0496112_0013201_7049_7603 | 184 |
| 18 | 3300048916 | Ga0496113_0009123 | Ga0496113_0009123_1690_2244 | 184 |
| 19 | 3300005530 | Ga0070679_100309920 | Ga0070679_1003099202 | 185 |
| 20 | 3300046525 | Ga0495663_0034764 | Ga0495663_0034764_937_1497 | 186 |
| 21 | 3300005293 | Ga0065715_10117808 | Ga0065715_101178083 | 188 |
| 22 | 3300031711 | Ga0265314_10004913 | Ga0265314_100049135 | 189 |
| 23 | 3300047472 | Ga0495686_0003054 | Ga0495686_0003054_5877_6446 | 189 |
| 24 | 3300048920 | Ga0496117_0067494 | Ga0496117_0067494_448_1017 | 189 |
| 25 | 3300048921 | Ga0496118_0003515 | Ga0496118_0003515_10655_11224 | 189 |
| 26 | 3300048929 | Ga0496126_0309947 | Ga0496126_0309947_559_1140 | 189 |
| 27 | 3300005436 | Ga0070713_100693070 | Ga0070713_1006930702 | 191 |
| 28 | 3300025928 | Ga0207700_10715139 | Ga0207700_107151391 | 191 |
| 29 | 3300005616 | Ga0068852_100015237 | Ga0068852_1000152374 | 192 |
| 30 | 3300009093 | Ga0105240_10031565 | Ga0105240_100315655 | 192 |
| 31 | 3300009174 | Ga0105241_10021669 | Ga0105241_100216694 | 192 |
| 32 | 3300009177 | Ga0105248_10000001 | Ga0105248_100000011441 | 192 |
| 33 | 3300025913 | Ga0207695_10070818 | Ga0207695_100708183 | 192 |
| 34 | 3300025941 | Ga0207711_10000001 | Ga0207711_10000001433 | 192 |
| 35 | 3300026142 | Ga0207698_10068870 | Ga0207698_100688703 | 192 |
| 36 | 3300037471 | Ga0395905_0020203 | Ga0395905_0020203_5116_5709 | 192 |
| 37 | 3300053154 | Ga0500619_035578 | Ga0500619_035578_317_895 | 192 |
| 38 | 3300005331 | Ga0070670_100149741 | Ga0070670_1001497411 | 193 |
| 39 | 3300005331 | Ga0070670_100334446 | Ga0070670_1003344462 | 193 |
| 40 | 3300005344 | Ga0070661_100848087 | Ga0070661_1008480871 | 193 |
| 41 | 3300005356 | Ga0070674_100170102 | Ga0070674_1001701022 | 193 |
| 42 | 3300005719 | Ga0068861_100376400 | Ga0068861_1003764002 | 193 |
| 43 | 3300009176 | Ga0105242_10279981 | Ga0105242_102799812 | 193 |
| 44 | 3300025925 | Ga0207650_10710764 | Ga0207650_107107641 | 193 |
| 45 | 3300025931 | Ga0207644_10282663 | Ga0207644_102826632 | 193 |
| 46 | 3300025933 | Ga0207706_10630625 | Ga0207706_106306251 | 193 |
| 47 | 3300025934 | Ga0207686_10503411 | Ga0207686_105034112 | 193 |
| 48 | 3300025935 | Ga0207709_10145224 | Ga0207709_101452242 | 193 |
| 49 | 3300025940 | Ga0207691_10002976 | Ga0207691_1000297614 | 193 |
| 50 | 3300031824 | Ga0307413_10920467 | Ga0307413_109204672 | 193 |
| 51 | 3300041507 | Ga0451851_0473752 | Ga0451851_0473752_99_683 | 193 |
| 52 | 3300046664 | Ga0495659_0133207 | Ga0495659_0133207_221_802 | 193 |
| 53 | 3300005366 | Ga0070659_100411285 | Ga0070659_1004112852 | 194 |
| 54 | 3300053156 | Ga0500622_0003266 | Ga0500622_0003266_6168_6761 | 194 |
| 55 | 3300005458 | Ga0070681_10691809 | Ga0070681_106918092 | 195 |
| 56 | 3300006844 | Ga0075428_100028540 | Ga0075428_1000285403 | 195 |
| 57 | 3300006844 | Ga0075428_100284426 | Ga0075428_1002844262 | 195 |
| 58 | 3300006847 | Ga0075431_100157480 | Ga0075431_1001574802 | 195 |
| 59 | 3300006880 | Ga0075429_100064132 | Ga0075429_1000641322 | 195 |
| 60 | 3300042001 | Ga0439441_051689 | Ga0439441_051689_23_649 | 195 |
| 61 | 3300042461 | Ga0439460_0004452 | Ga0439460_0004452_619_1245 | 195 |
| 62 | 3300042993 | Ga0439440_0055322 | Ga0439440_0055322_171_797 | 195 |
| 63 | 3300046537 | Ga0495598_0009011 | Ga0495598_0009011_1103_1690 | 195 |
| 64 | 3300050508 | nmdc:mga09592_23810_c1 | nmdc:mga09592_23810_c1_230_820 | 195 |
| 65 | 3300050509 | nmdc:mga0qj67_118338_c1 | nmdc:mga0qj67_118338_c1_813_1403 | 195 |
| 66 | 3300050509 | nmdc:mga0qj67_326364_c1 | nmdc:mga0qj67_326364_c1_412_1041 | 195 |
| 67 | 3300050510 | nmdc:mga06r32_602170_c1 | nmdc:mga06r32_602170_c1_207_833 | 195 |
| 68 | 3300050510 | nmdc:mga06r32_7607_c1 | nmdc:mga06r32_7607_c1_7377_7967 | 195 |
| 69 | 3300031911 | Ga0307412_10125587 | Ga0307412_101255872 | 196 |
| 70 | 3300032002 | Ga0307416_100341072 | Ga0307416_1003410721 | 196 |
| 71 | 3300013296 | Ga0157374_10046999 | Ga0157374_100469993 | 197 |
| 72 | 3300031911 | Ga0307412_10007004 | Ga0307412_100070042 | 197 |
| 73 | 3300037471 | Ga0395905_0069625 | Ga0395905_0069625_2338_2931 | 197 |
| 74 | 3300041452 | Ga0451793_1352091 | Ga0451793_1352091_263_856 | 197 |
| 75 | 3300041460 | Ga0451802_0622788 | Ga0451802_0622788_126_719 | 197 |
| 76 | 3300041462 | Ga0451806_810621 | Ga0451806_810621_1278_1871 | 197 |
| 77 | 3300041486 | Ga0451807_1133111 | Ga0451807_1133111_2735_3328 | 197 |
| 78 | 3300041512 | Ga0451853_0563708 | Ga0451853_0563708_147_740 | 197 |
| 79 | 3300005353 | Ga0070669_100494997 | Ga0070669_1004949972 | 198 |
| 80 | 3300025923 | Ga0207681_10452786 | Ga0207681_104527862 | 198 |
| 81 | 3300025933 | Ga0207706_10518769 | Ga0207706_105187692 | 198 |
| 82 | 3300025972 | Ga0207668_10669307 | Ga0207668_106693072 | 198 |
| 83 | 3300030745 | Ga0316182_1184530 | Ga0316182_11845303 | 198 |
| 84 | 3300031548 | Ga0307408_100315572 | Ga0307408_1003155722 | 198 |
| 85 | 3300031824 | Ga0307413_10116011 | Ga0307413_101160112 | 198 |
| 86 | 3300032004 | Ga0307414_10226017 | Ga0307414_102260172 | 198 |
| 87 | 3300032004 | Ga0307414_10527122 | Ga0307414_105271221 | 198 |
| 88 | 3300037471 | Ga0395905_0272106 | Ga0395905_0272106_805_1401 | 198 |
| 89 | 3300048903 | Ga0496100_0249157 | Ga0496100_0249157_211_807 | 198 |
| 90 | 3300048904 | Ga0496101_0072488 | Ga0496101_0072488_1659_2255 | 198 |
| 91 | 3300048911 | Ga0496108_0278259 | Ga0496108_0278259_212_808 | 198 |
| 92 | iso_pu_bacteria | 2643221573 | 2643881917 | 198 |
| 93 | iso_pu_bacteria | 2643221720 | 2644661576 | 198 |
| 94 | iso_pu_bacteria | 2643221728 | 2644701275 | 198 |
| 95 | 3300005334 | Ga0068869_100018311 | Ga0068869_1000183116 | 199 |
| 96 | 3300005334 | Ga0068869_101054087 | Ga0068869_1010540871 | 199 |
| 97 | 3300005347 | Ga0070668_100376224 | Ga0070668_1003762242 | 199 |
| 98 | 3300005353 | Ga0070669_100210320 | Ga0070669_1002103202 | 199 |
| 99 | 3300005367 | Ga0070667_100639329 | Ga0070667_1006393292 | 199 |
| 100 | 3300005457 | Ga0070662_100014311 | Ga0070662_1000143116 | 199 |
| 101 | 3300005458 | Ga0070681_10076341 | Ga0070681_100763414 | 199 |
| 102 | 3300005459 | Ga0068867_100223897 | Ga0068867_1002238972 | 199 |
| 103 | 3300005467 | Ga0070706_100165529 | Ga0070706_1001655292 | 199 |
| 104 | 3300005530 | Ga0070679_100084097 | Ga0070679_1000840972 | 199 |
| 105 | 3300005530 | Ga0070679_100283444 | Ga0070679_1002834442 | 199 |
| 106 | 3300005539 | Ga0068853_100579055 | Ga0068853_1005790552 | 199 |
| 107 | 3300005545 | Ga0070695_100033084 | Ga0070695_1000330846 | 199 |
| 108 | 3300005546 | Ga0070696_100022566 | Ga0070696_1000225665 | 199 |
| 109 | 3300005548 | Ga0070665_100034682 | Ga0070665_1000346826 | 199 |
| 110 | 3300005549 | Ga0070704_100108118 | Ga0070704_1001081184 | 199 |
| 111 | 3300005578 | Ga0068854_100269087 | Ga0068854_1002690872 | 199 |
| 112 | 3300005842 | Ga0068858_101116584 | Ga0068858_1011165841 | 199 |
| 113 | 3300005844 | Ga0068862_100021398 | Ga0068862_1000213984 | 199 |
| 114 | 3300009094 | Ga0111539_10209784 | Ga0111539_102097842 | 199 |
| 115 | 3300025304 | Ga0209257_1031756 | Ga0209257_10317563 | 199 |
| 116 | 3300025893 | Ga0207682_10053215 | Ga0207682_100532152 | 199 |
| 117 | 3300025901 | Ga0207688_10042413 | Ga0207688_100424133 | 199 |
| 118 | 3300025912 | Ga0207707_10162887 | Ga0207707_101628872 | 199 |
| 119 | 3300025919 | Ga0207657_10083306 | Ga0207657_100833062 | 199 |
| 120 | 3300025921 | Ga0207652_10218738 | Ga0207652_102187382 | 199 |
| 121 | 3300025932 | Ga0207690_10300264 | Ga0207690_103002642 | 199 |
| 122 | 3300025932 | Ga0207690_10515515 | Ga0207690_105155152 | 199 |
| 123 | 3300025933 | Ga0207706_10019015 | Ga0207706_100190155 | 199 |
| 124 | 3300025972 | Ga0207668_10189620 | Ga0207668_101896202 | 199 |
| 125 | 3300026041 | Ga0207639_10330202 | Ga0207639_103302022 | 199 |
| 126 | 3300027876 | Ga0209974_10079573 | Ga0209974_100795732 | 199 |
| 127 | 3300028379 | Ga0268266_10022686 | Ga0268266_100226866 | 199 |
| 128 | 3300028380 | Ga0268265_10010369 | Ga0268265_100103694 | 199 |
| 129 | 3300030745 | Ga0316182_1278238 | Ga0316182_12782382 | 199 |
| 130 | 3300031548 | Ga0307408_100379744 | Ga0307408_1003797441 | 199 |
| 131 | 3300031548 | Ga0307408_100547643 | Ga0307408_1005476432 | 199 |
| 132 | 3300031731 | Ga0307405_10032415 | Ga0307405_100324152 | 199 |
| 133 | 3300031852 | Ga0307410_10164828 | Ga0307410_101648283 | 199 |
| 134 | 3300031903 | Ga0307407_10073810 | Ga0307407_100738101 | 199 |
| 135 | 3300031911 | Ga0307412_10520437 | Ga0307412_105204371 | 199 |
| 136 | 3300031995 | Ga0307409_100495898 | Ga0307409_1004958982 | 199 |
| 137 | 3300032002 | Ga0307416_100228950 | Ga0307416_1002289503 | 199 |
| 138 | 3300032004 | Ga0307414_10065996 | Ga0307414_100659964 | 199 |
| 139 | 3300032004 | Ga0307414_10108139 | Ga0307414_101081393 | 199 |
| 140 | 3300032005 | Ga0307411_10013366 | Ga0307411_100133665 | 199 |
| 141 | 3300032005 | Ga0307411_10609363 | Ga0307411_106093632 | 199 |
| 142 | 3300032005 | Ga0307411_11272591 | Ga0307411_112725911 | 199 |
| 143 | 3300032126 | Ga0307415_100172209 | Ga0307415_1001722093 | 199 |
| 144 | 3300032126 | Ga0307415_100645149 | Ga0307415_1006451492 | 199 |
| 145 | 3300042006 | Ga0439432_010691 | Ga0439432_010691_2079_2696 | 199 |
| 146 | 3300042012 | Ga0439455_0063386 | Ga0439455_0063386_136_738 | 199 |
| 147 | 3300042015 | Ga0439462_0001989 | Ga0439462_0001989_2429_3046 | 199 |
| 148 | 3300042120 | Ga0450917_000904 | Ga0450917_000904_271_873 | 199 |
| 149 | 3300042142 | Ga0450905_002655 | Ga0450905_002655_327_929 | 199 |
| 150 | 3300042144 | Ga0450889_005177 | Ga0450889_005177_115_717 | 199 |
| 151 | 3300042439 | Ga0439464_0001880 | Ga0439464_0001880_3127_3729 | 199 |
| 152 | 3300044684 | Ga0466966_0012063 | Ga0466966_0012063_2227_2829 | 199 |
| 153 | 3300045049 | Ga0466959_0100096 | Ga0466959_0100096_1078_1680 | 199 |
| 154 | 3300046615 | Ga0495656_0081099 | Ga0495656_0081099_30_650 | 199 |
| 155 | 3300047318 | Ga0495636_0000118 | Ga0495636_0000118_11271_11888 | 199 |
| 156 | 3300047318 | Ga0495636_0040629 | Ga0495636_0040629_658_1275 | 199 |
| 157 | 3300048928 | Ga0496125_0111724 | Ga0496125_0111724_186_800 | 199 |
| 158 | 3300048929 | Ga0496126_0001950 | Ga0496126_0001950_12288_12902 | 199 |
| 159 | 3300049686 | Ga0501257_011848 | Ga0501257_011848_172_789 | 199 |
| 160 | 3300049775 | Ga0501279_019839 | Ga0501279_019839_99_716 | 199 |
| 161 | 3300050511 | nmdc:mga08y16_188500_c1 | nmdc:mga08y16_188500_c1_515_1117 | 199 |
| 162 | 3300002067 | JGI24735J21928_10025709 | JGI24735J21928_100257092 | 200 |
| 163 | 3300003323 | rootH1_10017335 | rootH1_100173354 | 200 |
| 164 | 3300005293 | Ga0065715_10175878 | Ga0065715_101758783 | 200 |
| 165 | 3300005327 | Ga0070658_10100047 | Ga0070658_101000473 | 200 |
| 166 | 3300005335 | Ga0070666_10002844 | Ga0070666_100028449 | 200 |
| 167 | 3300005338 | Ga0068868_100005000 | Ga0068868_10000500011 | 200 |
| 168 | 3300005339 | Ga0070660_100004844 | Ga0070660_1000048446 | 200 |
| 169 | 3300005339 | Ga0070660_100041116 | Ga0070660_1000411164 | 200 |
| 170 | 3300005339 | Ga0070660_100163807 | Ga0070660_1001638071 | 200 |
| 171 | 3300005344 | Ga0070661_100059002 | Ga0070661_1000590022 | 200 |
| 172 | 3300005345 | Ga0070692_10020838 | Ga0070692_100208383 | 200 |
| 173 | 3300005347 | Ga0070668_100006224 | Ga0070668_1000062246 | 200 |
| 174 | 3300005347 | Ga0070668_100063822 | Ga0070668_1000638222 | 200 |
| 175 | 3300005353 | Ga0070669_100090988 | Ga0070669_1000909883 | 200 |
| 176 | 3300005353 | Ga0070669_100300199 | Ga0070669_1003001992 | 200 |
| 177 | 3300005355 | Ga0070671_100000356 | Ga0070671_10000035618 | 200 |
| 178 | 3300005355 | Ga0070671_100004676 | Ga0070671_10000467614 | 200 |
| 179 | 3300005355 | Ga0070671_100068598 | Ga0070671_1000685983 | 200 |
| 180 | 3300005356 | Ga0070674_100017030 | Ga0070674_1000170305 | 200 |
| 181 | 3300005356 | Ga0070674_100052279 | Ga0070674_1000522795 | 200 |
| 182 | 3300005364 | Ga0070673_100025388 | Ga0070673_1000253887 | 200 |
| 183 | 3300005366 | Ga0070659_100007979 | Ga0070659_1000079798 | 200 |
| 184 | 3300005366 | Ga0070659_100045598 | Ga0070659_1000455984 | 200 |
| 185 | 3300005367 | Ga0070667_100001265 | Ga0070667_10000126523 | 200 |
| 186 | 3300005367 | Ga0070667_100008606 | Ga0070667_1000086064 | 200 |
| 187 | 3300005435 | Ga0070714_100043979 | Ga0070714_1000439795 | 200 |
| 188 | 3300005444 | Ga0070694_100007483 | Ga0070694_1000074838 | 200 |
| 189 | 3300005455 | Ga0070663_100256763 | Ga0070663_1002567632 | 200 |
| 190 | 3300005456 | Ga0070678_100011915 | Ga0070678_1000119158 | 200 |
| 191 | 3300005457 | Ga0070662_100003335 | Ga0070662_1000033356 | 200 |
| 192 | 3300005459 | Ga0068867_100010679 | Ga0068867_1000106794 | 200 |
| 193 | 3300005459 | Ga0068867_100934711 | Ga0068867_1009347111 | 200 |
| 194 | 3300005543 | Ga0070672_100103270 | Ga0070672_1001032703 | 200 |
| 195 | 3300005543 | Ga0070672_100270766 | Ga0070672_1002707661 | 200 |
| 196 | 3300005563 | Ga0068855_100038250 | Ga0068855_1000382503 | 200 |
| 197 | 3300005564 | Ga0070664_100006472 | Ga0070664_10000647210 | 200 |
| 198 | 3300005564 | Ga0070664_100034748 | Ga0070664_1000347485 | 200 |
| 199 | 3300005577 | Ga0068857_100079147 | Ga0068857_1000791473 | 200 |
| 200 | 3300005577 | Ga0068857_100386753 | Ga0068857_1003867533 | 200 |
| 201 | 3300005578 | Ga0068854_100052088 | Ga0068854_1000520882 | 200 |
| 202 | 3300005578 | Ga0068854_100292429 | Ga0068854_1002924293 | 200 |
| 203 | 3300005616 | Ga0068852_100112161 | Ga0068852_1001121614 | 200 |
| 204 | 3300005616 | Ga0068852_100526411 | Ga0068852_1005264112 | 200 |
| 205 | 3300005617 | Ga0068859_100102752 | Ga0068859_1001027523 | 200 |
| 206 | 3300005618 | Ga0068864_100069433 | Ga0068864_1000694332 | 200 |
| 207 | 3300005719 | Ga0068861_100118555 | Ga0068861_1001185552 | 200 |
| 208 | 3300005834 | Ga0068851_10046854 | Ga0068851_100468542 | 200 |
| 209 | 3300005841 | Ga0068863_100711167 | Ga0068863_1007111672 | 200 |
| 210 | 3300005842 | Ga0068858_100005575 | Ga0068858_10000557511 | 200 |
| 211 | 3300005842 | Ga0068858_100546919 | Ga0068858_1005469192 | 200 |
| 212 | 3300005843 | Ga0068860_100013628 | Ga0068860_1000136289 | 200 |
| 213 | 3300005843 | Ga0068860_100107091 | Ga0068860_1001070915 | 200 |
| 214 | 3300005843 | Ga0068860_100193083 | Ga0068860_1001930834 | 200 |
| 215 | 3300005844 | Ga0068862_100276550 | Ga0068862_1002765503 | 200 |
| 216 | 3300005983 | Ga0081540_1093870 | Ga0081540_10938702 | 200 |
| 217 | 3300006237 | Ga0097621_100538086 | Ga0097621_1005380861 | 200 |
| 218 | 3300006931 | Ga0097620_100102753 | Ga0097620_1001027533 | 200 |
| 219 | 3300009093 | Ga0105240_10547186 | Ga0105240_105471862 | 200 |
| 220 | 3300009148 | Ga0105243_10100127 | Ga0105243_101001273 | 200 |
| 221 | 3300009177 | Ga0105248_10001002 | Ga0105248_100010028 | 200 |
| 222 | 3300009177 | Ga0105248_10091476 | Ga0105248_100914762 | 200 |
| 223 | 3300009545 | Ga0105237_10003164 | Ga0105237_100031647 | 200 |
| 224 | 3300009551 | Ga0105238_10185367 | Ga0105238_101853672 | 200 |
| 225 | 3300009553 | Ga0105249_10053856 | Ga0105249_100538565 | 200 |
| 226 | 3300013100 | Ga0157373_10043878 | Ga0157373_100438783 | 200 |
| 227 | 3300013104 | Ga0157370_10006047 | Ga0157370_1000604715 | 200 |
| 228 | 3300013297 | Ga0157378_10246727 | Ga0157378_102467273 | 200 |
| 229 | 3300013306 | Ga0163162_10168603 | Ga0163162_101686033 | 200 |
| 230 | 3300013308 | Ga0157375_10646789 | Ga0157375_106467892 | 200 |
| 231 | 3300013308 | Ga0157375_11315540 | Ga0157375_113155402 | 200 |
| 232 | 3300014326 | Ga0157380_10009958 | Ga0157380_100099588 | 200 |
| 233 | 3300014326 | Ga0157380_10825366 | Ga0157380_108253661 | 200 |
| 234 | 3300014968 | Ga0157379_10121365 | Ga0157379_101213652 | 200 |
| 235 | 3300025315 | Ga0207697_10128414 | Ga0207697_101284142 | 200 |
| 236 | 3300025321 | Ga0207656_10031573 | Ga0207656_100315732 | 200 |
| 237 | 3300025901 | Ga0207688_10211327 | Ga0207688_102113272 | 200 |
| 238 | 3300025903 | Ga0207680_10000271 | Ga0207680_1000027122 | 200 |
| 239 | 3300025904 | Ga0207647_10001771 | Ga0207647_1000177110 | 200 |
| 240 | 3300025904 | Ga0207647_10013159 | Ga0207647_100131593 | 200 |
| 241 | 3300025907 | Ga0207645_10000896 | Ga0207645_100008965 | 200 |
| 242 | 3300025909 | Ga0207705_10001965 | Ga0207705_1000196519 | 200 |
| 243 | 3300025914 | Ga0207671_10006191 | Ga0207671_100061917 | 200 |
| 244 | 3300025919 | Ga0207657_10008696 | Ga0207657_100086969 | 200 |
| 245 | 3300025919 | Ga0207657_10026236 | Ga0207657_100262364 | 200 |
| 246 | 3300025919 | Ga0207657_10127354 | Ga0207657_101273542 | 200 |
| 247 | 3300025920 | Ga0207649_10104872 | Ga0207649_101048723 | 200 |
| 248 | 3300025923 | Ga0207681_10025491 | Ga0207681_100254913 | 200 |
| 249 | 3300025924 | Ga0207694_10182980 | Ga0207694_101829802 | 200 |
| 250 | 3300025931 | Ga0207644_10000794 | Ga0207644_100007947 | 200 |
| 251 | 3300025931 | Ga0207644_10013382 | Ga0207644_100133824 | 200 |
| 252 | 3300025932 | Ga0207690_10001735 | Ga0207690_1000173510 | 200 |
| 253 | 3300025932 | Ga0207690_10058154 | Ga0207690_100581543 | 200 |
| 254 | 3300025933 | Ga0207706_10011384 | Ga0207706_100113846 | 200 |
| 255 | 3300025933 | Ga0207706_10048438 | Ga0207706_100484385 | 200 |
| 256 | 3300025935 | Ga0207709_10228144 | Ga0207709_102281442 | 200 |
| 257 | 3300025937 | Ga0207669_10003616 | Ga0207669_100036168 | 200 |
| 258 | 3300025940 | Ga0207691_10016716 | Ga0207691_100167169 | 200 |
| 259 | 3300025940 | Ga0207691_10176782 | Ga0207691_101767823 | 200 |
| 260 | 3300025941 | Ga0207711_10000823 | Ga0207711_1000082323 | 200 |
| 261 | 3300025941 | Ga0207711_10077818 | Ga0207711_100778184 | 200 |
| 262 | 3300025945 | Ga0207679_10089834 | Ga0207679_100898342 | 200 |
| 263 | 3300025945 | Ga0207679_10351965 | Ga0207679_103519652 | 200 |
| 264 | 3300025949 | Ga0207667_10031806 | Ga0207667_100318063 | 200 |
| 265 | 3300025960 | Ga0207651_10198928 | Ga0207651_101989283 | 200 |
| 266 | 3300025961 | Ga0207712_10000146 | Ga0207712_1000014648 | 200 |
| 267 | 3300025972 | Ga0207668_10000070 | Ga0207668_1000007052 | 200 |
| 268 | 3300025972 | Ga0207668_10223882 | Ga0207668_102238821 | 200 |
| 269 | 3300025986 | Ga0207658_10006101 | Ga0207658_100061014 | 200 |
| 270 | 3300025986 | Ga0207658_10014061 | Ga0207658_100140615 | 200 |
| 271 | 3300026023 | Ga0207677_10004539 | Ga0207677_1000453910 | 200 |
| 272 | 3300026023 | Ga0207677_10913905 | Ga0207677_109139051 | 200 |
| 273 | 3300026035 | Ga0207703_10004651 | Ga0207703_100046519 | 200 |
| 274 | 3300026041 | Ga0207639_10018488 | Ga0207639_100184886 | 200 |
| 275 | 3300026041 | Ga0207639_10162971 | Ga0207639_101629713 | 200 |
| 276 | 3300026067 | Ga0207678_10106477 | Ga0207678_101064773 | 200 |
| 277 | 3300026078 | Ga0207702_10020794 | Ga0207702_100207943 | 200 |
| 278 | 3300026088 | Ga0207641_10089142 | Ga0207641_100891424 | 200 |
| 279 | 3300026089 | Ga0207648_10001147 | Ga0207648_1000114711 | 200 |
| 280 | 3300026095 | Ga0207676_10102195 | Ga0207676_101021953 | 200 |
| 281 | 3300026116 | Ga0207674_10078059 | Ga0207674_100780594 | 200 |
| 282 | 3300026118 | Ga0207675_100143220 | Ga0207675_1001432203 | 200 |
| 283 | 3300026121 | Ga0207683_10048333 | Ga0207683_100483336 | 200 |
| 284 | 3300026142 | Ga0207698_10322858 | Ga0207698_103228582 | 200 |
| 285 | 3300027876 | Ga0209974_10008000 | Ga0209974_100080002 | 200 |
| 286 | 3300028380 | Ga0268265_10016177 | Ga0268265_100161773 | 200 |
| 287 | 3300028381 | Ga0268264_10000594 | Ga0268264_1000059435 | 200 |
| 288 | 3300028381 | Ga0268264_10054786 | Ga0268264_100547864 | 200 |
| 289 | 3300031548 | Ga0307408_100142030 | Ga0307408_1001420303 | 200 |
| 290 | 3300031731 | Ga0307405_10331418 | Ga0307405_103314182 | 200 |
| 291 | 3300031824 | Ga0307413_10129647 | Ga0307413_101296472 | 200 |
| 292 | 3300031852 | Ga0307410_10169745 | Ga0307410_101697452 | 200 |
| 293 | 3300031852 | Ga0307410_10407287 | Ga0307410_104072872 | 200 |
| 294 | 3300031901 | Ga0307406_10030245 | Ga0307406_100302452 | 200 |
| 295 | 3300031901 | Ga0307406_10194182 | Ga0307406_101941822 | 200 |
| 296 | 3300031903 | Ga0307407_10058005 | Ga0307407_100580051 | 200 |
| 297 | 3300031903 | Ga0307407_10321665 | Ga0307407_103216652 | 200 |
| 298 | 3300031911 | Ga0307412_10169349 | Ga0307412_101693492 | 200 |
| 299 | 3300032002 | Ga0307416_100208283 | Ga0307416_1002082833 | 200 |
| 300 | 3300032004 | Ga0307414_10136988 | Ga0307414_101369883 | 200 |
| 301 | 3300032005 | Ga0307411_10069189 | Ga0307411_100691892 | 200 |
| 302 | 3300032005 | Ga0307411_10187882 | Ga0307411_101878822 | 200 |
| 303 | 3300032126 | Ga0307415_100169313 | Ga0307415_1001693132 | 200 |
| 304 | 3300032126 | Ga0307415_100533370 | Ga0307415_1005333702 | 200 |
| 305 | 3300037312 | Ga0395899_0395559 | Ga0395899_0395559_153_755 | 200 |
| 306 | 3300037418 | Ga0395900_0041349 | Ga0395900_0041349_55_657 | 200 |
| 307 | 3300037466 | Ga0395898_0093912 | Ga0395898_0093912_53_655 | 200 |
| 308 | 3300037466 | Ga0395898_0919627 | Ga0395898_0919627_158_760 | 200 |
| 309 | 3300037471 | Ga0395905_0026307 | Ga0395905_0026307_3546_4169 | 200 |
| 310 | 3300037471 | Ga0395905_0045919 | Ga0395905_0045919_944_1555 | 200 |
| 311 | 3300037471 | Ga0395905_0298713 | Ga0395905_0298713_574_1176 | 200 |
| 312 | 3300037471 | Ga0395905_0817775 | Ga0395905_0817775_213_815 | 200 |
| 313 | 3300038443 | Ga0395901_1009510 | Ga0395901_1009510_166_768 | 200 |
| 314 | 3300038443 | Ga0395901_1154210 | Ga0395901_1154210_107_709 | 200 |
| 315 | 3300044684 | Ga0466966_0106303 | Ga0466966_0106303_923_1525 | 200 |
| 316 | 3300044693 | Ga0466961_0466573 | Ga0466961_0466573_79_681 | 200 |
| 317 | 3300044694 | Ga0466963_0532399 | Ga0466963_0532399_55_657 | 200 |
| 318 | 3300045049 | Ga0466959_0075353 | Ga0466959_0075353_462_1064 | 200 |
| 319 | 3300045836 | Ga0466958_0143927 | Ga0466958_0143927_562_1164 | 200 |
| 320 | 3300046471 | Ga0495650_0000744 | Ga0495650_0000744_11354_11968 | 200 |
| 321 | 3300046471 | Ga0495650_0044906 | Ga0495650_0044906_743_1363 | 200 |
| 322 | 3300046524 | Ga0495648_0000029 | Ga0495648_0000029_55283_55903 | 200 |
| 323 | 3300046616 | Ga0495668_0000014 | Ga0495668_0000014_103291_103911 | 200 |
| 324 | 3300047469 | Ga0495673_0000597 | Ga0495673_0000597_13814_14434 | 200 |
| 325 | 3300047472 | Ga0495686_0001938 | Ga0495686_0001938_13813_14430 | 200 |
| 326 | 3300047472 | Ga0495686_0177379 | Ga0495686_0177379_178_795 | 200 |
| 327 | 3300048909 | Ga0496106_0096639 | Ga0496106_0096639_939_1559 | 200 |
| 328 | 3300048910 | Ga0496107_0000072 | Ga0496107_0000072_35567_36187 | 200 |
| 329 | 3300048910 | Ga0496107_0067447 | Ga0496107_0067447_755_1366 | 200 |
| 330 | 3300048917 | Ga0496114_0061753 | Ga0496114_0061753_1876_2511 | 200 |
| 331 | 3300048918 | Ga0496115_0000488 | Ga0496115_0000488_28321_28956 | 200 |
| 332 | 3300048924 | Ga0496121_0002753 | Ga0496121_0002753_7164_7784 | 200 |
| 333 | 3300048924 | Ga0496121_0307995 | Ga0496121_0307995_177_794 | 200 |
| 334 | 3300049663 | Ga0501223_040798 | Ga0501223_040798_202_819 | 200 |
| 335 | 3300049686 | Ga0501257_070402 | Ga0501257_070402_31_651 | 200 |
| 336 | 3300049704 | Ga0501221_026311 | Ga0501221_026311_247_864 | 200 |
| 337 | 3300049770 | Ga0501273_036973 | Ga0501273_036973_65_682 | 200 |
| 338 | 3300050509 | nmdc:mga0qj67_513599_c1 | nmdc:mga0qj67_513599_c1_44_658 | 200 |
| 339 | 3300053088 | Ga0500644_0000043 | Ga0500644_0000043_26606_27226 | 200 |
| 340 | 3300053094 | Ga0500566_0260410 | Ga0500566_0260410_53_673 | 200 |
| 341 | 3300053123 | Ga0500614_002794 | Ga0500614_002794_433_1053 | 200 |
| 342 | 3300053136 | Ga0500559_0064128 | Ga0500559_0064128_75_692 | 200 |
| 343 | 3300053138 | Ga0500564_000015 | Ga0500564_000015_25456_26076 | 200 |
| 344 | 3300003187 | JGI25151J46595_10031913 | JGI25151J46595_100319133 | 201 |
| 345 | 3300003771 | Ga0055526_1033652 | Ga0055526_10336522 | 201 |
| 346 | 3300003775 | Ga0055524_1028215 | Ga0055524_10282152 | 201 |
| 347 | 3300003775 | Ga0055524_1030132 | Ga0055524_10301322 | 201 |
| 348 | 3300003775 | Ga0055524_1043564 | Ga0055524_10435641 | 201 |
| 349 | 3300003781 | Ga0055536_1010416 | Ga0055536_10104163 | 201 |
| 350 | 3300003781 | Ga0055536_1010650 | Ga0055536_10106505 | 201 |
| 351 | 3300003781 | Ga0055536_1033813 | Ga0055536_10338133 | 201 |
| 352 | 3300003781 | Ga0055536_1035068 | Ga0055536_10350683 | 201 |
| 353 | 3300003781 | Ga0055536_1061546 | Ga0055536_10615461 | 201 |
| 354 | 3300003791 | Ga0055530_10001236 | Ga0055530_1000123610 | 201 |
| 355 | 3300003794 | Ga0055531_10003252 | Ga0055531_100032528 | 201 |
| 356 | 3300003794 | Ga0055531_10005027 | Ga0055531_100050277 | 201 |
| 357 | 3300003794 | Ga0055531_10006427 | Ga0055531_100064273 | 201 |
| 358 | 3300003794 | Ga0055531_10010682 | Ga0055531_100106823 | 201 |
| 359 | 3300003794 | Ga0055531_10060621 | Ga0055531_100606212 | 201 |
| 360 | 3300005355 | Ga0070671_100036498 | Ga0070671_1000364985 | 201 |
| 361 | 3300005548 | Ga0070665_100120974 | Ga0070665_1001209742 | 201 |
| 362 | 3300006931 | Ga0097620_100696124 | Ga0097620_1006961242 | 201 |
| 363 | 3300025245 | Ga0207425_1017920 | Ga0207425_10179201 | 201 |
| 364 | 3300025284 | Ga0209130_1004853 | Ga0209130_10048534 | 201 |
| 365 | 3300025291 | Ga0209675_1010132 | Ga0209675_10101323 | 201 |
| 366 | 3300025291 | Ga0209675_1015047 | Ga0209675_10150473 | 201 |
| 367 | 3300025292 | Ga0209676_1000853 | Ga0209676_100085330 | 201 |
| 368 | 3300025292 | Ga0209676_1001374 | Ga0209676_100137412 | 201 |
| 369 | 3300025292 | Ga0209676_1004286 | Ga0209676_10042868 | 201 |
| 370 | 3300025292 | Ga0209676_1004361 | Ga0209676_10043613 | 201 |
| 371 | 3300025292 | Ga0209676_1009285 | Ga0209676_10092853 | 201 |
| 372 | 3300025292 | Ga0209676_1032853 | Ga0209676_10328533 | 201 |
| 373 | 3300025292 | Ga0209676_1038842 | Ga0209676_10388422 | 201 |
| 374 | 3300025294 | Ga0209025_1001514 | Ga0209025_10015149 | 201 |
| 375 | 3300025294 | Ga0209025_1045192 | Ga0209025_10451923 | 201 |
| 376 | 3300025298 | Ga0209050_1000652 | Ga0209050_100065229 | 201 |
| 377 | 3300025298 | Ga0209050_1010093 | Ga0209050_10100933 | 201 |
| 378 | 3300025299 | Ga0209256_1004674 | Ga0209256_10046744 | 201 |
| 379 | 3300025299 | Ga0209256_1005718 | Ga0209256_10057187 | 201 |
| 380 | 3300025299 | Ga0209256_1007836 | Ga0209256_10078363 | 201 |
| 381 | 3300025303 | Ga0209051_1018108 | Ga0209051_10181083 | 201 |
| 382 | 3300025304 | Ga0209257_1000378 | Ga0209257_100037844 | 201 |
| 383 | 3300025304 | Ga0209257_1001186 | Ga0209257_100118610 | 201 |
| 384 | 3300025304 | Ga0209257_1001359 | Ga0209257_100135910 | 201 |
| 385 | 3300025304 | Ga0209257_1001512 | Ga0209257_100151212 | 201 |
| 386 | 3300025304 | Ga0209257_1001632 | Ga0209257_100163212 | 201 |
| 387 | 3300025304 | Ga0209257_1065175 | Ga0209257_10651752 | 201 |
| 388 | 3300028379 | Ga0268266_10394512 | Ga0268266_103945122 | 201 |
| 389 | 3300037418 | Ga0395900_0317473 | Ga0395900_0317473_295_900 | 201 |
| 390 | 3300037471 | Ga0395905_0046043 | Ga0395905_0046043_2719_3324 | 201 |
| 391 | 3300037471 | Ga0395905_0065556 | Ga0395905_0065556_324_929 | 201 |
| 392 | 3300038443 | Ga0395901_0302129 | Ga0395901_0302129_287_892 | 201 |
| 393 | 3300041413 | Ga0439465_0004297 | Ga0439465_0004297_2433_3065 | 201 |
| 394 | 3300042007 | Ga0439449_0007223 | Ga0439449_0007223_2012_2644 | 201 |
| 395 | 3300042015 | Ga0439462_0113252 | Ga0439462_0113252_68_700 | 201 |
| 396 | 3300046507 | Ga0495606_0087714 | Ga0495606_0087714_673_1290 | 201 |
| 397 | 3300046525 | Ga0495663_0071238 | Ga0495663_0071238_54_671 | 201 |
| 398 | 3300046616 | Ga0495668_0017889 | Ga0495668_0017889_1472_2080 | 201 |
| 399 | 3300046660 | Ga0495625_0337356 | Ga0495625_0337356_333_941 | 201 |
| 400 | 3300046684 | Ga0495669_0000046 | Ga0495669_0000046_65549_66160 | 201 |
| 401 | 3300046684 | Ga0495669_0081276 | Ga0495669_0081276_814_1431 | 201 |
| 402 | 3300046684 | Ga0495669_0307110 | Ga0495669_0307110_60_671 | 201 |
| 403 | 3300047447 | Ga0495685_032435 | Ga0495685_032435_504_1121 | 201 |
| 404 | 3300048904 | Ga0496101_0118819 | Ga0496101_0118819_1187_1792 | 201 |
| 405 | 3300048912 | Ga0496109_0150348 | Ga0496109_0150348_47_652 | 201 |
| 406 | 3300048915 | Ga0496112_0063780 | Ga0496112_0063780_2684_3289 | 201 |
| 407 | 3300048916 | Ga0496113_0529771 | Ga0496113_0529771_158_763 | 201 |
| 408 | 3300049579 | Ga0501043_0038647 | Ga0501043_0038647_2040_2669 | 201 |
| 409 | iso_pu_bacteria | 8003014200 | 8003016797 | 201 |
| 410 | 3300001979 | JGI24740J21852_10000857 | JGI24740J21852_100008577 | 202 |
| 411 | 3300001989 | JGI24739J22299_10003054 | JGI24739J22299_100030543 | 202 |
| 412 | 3300001990 | JGI24737J22298_10000013 | JGI24737J22298_1000001353 | 202 |
| 413 | 3300001991 | JGI24743J22301_10049743 | JGI24743J22301_100497432 | 202 |
| 414 | 3300002075 | JGI24738J21930_10000935 | JGI24738J21930_100009358 | 202 |
| 415 | 3300002075 | JGI24738J21930_10001252 | JGI24738J21930_100012523 | 202 |
| 416 | 3300002239 | JGI24034J26672_10003481 | JGI24034J26672_100034813 | 202 |
| 417 | 3300005293 | Ga0065715_10132066 | Ga0065715_101320662 | 202 |
| 418 | 3300005328 | Ga0070676_10005926 | Ga0070676_100059265 | 202 |
| 419 | 3300005331 | Ga0070670_100015868 | Ga0070670_1000158686 | 202 |
| 420 | 3300005334 | Ga0068869_100000651 | Ga0068869_10000065121 | 202 |
| 421 | 3300005335 | Ga0070666_10007885 | Ga0070666_100078859 | 202 |
| 422 | 3300005338 | Ga0068868_100005456 | Ga0068868_1000054568 | 202 |
| 423 | 3300005339 | Ga0070660_100015525 | Ga0070660_1000155254 | 202 |
| 424 | 3300005340 | Ga0070689_100035338 | Ga0070689_1000353385 | 202 |
| 425 | 3300005343 | Ga0070687_100019629 | Ga0070687_1000196295 | 202 |
| 426 | 3300005344 | Ga0070661_100134669 | Ga0070661_1001346692 | 202 |
| 427 | 3300005353 | Ga0070669_100000319 | Ga0070669_10000031915 | 202 |
| 428 | 3300005354 | Ga0070675_100008839 | Ga0070675_1000088399 | 202 |
| 429 | 3300005355 | Ga0070671_100001617 | Ga0070671_1000016178 | 202 |
| 430 | 3300005356 | Ga0070674_100010722 | Ga0070674_1000107222 | 202 |
| 431 | 3300005364 | Ga0070673_100000675 | Ga0070673_10000067517 | 202 |
| 432 | 3300005366 | Ga0070659_100001722 | Ga0070659_10000172217 | 202 |
| 433 | 3300005367 | Ga0070667_100044671 | Ga0070667_1000446713 | 202 |
| 434 | 3300005457 | Ga0070662_100001355 | Ga0070662_10000135516 | 202 |
| 435 | 3300005459 | Ga0068867_100003550 | Ga0068867_1000035508 | 202 |
| 436 | 3300005539 | Ga0068853_100008649 | Ga0068853_1000086498 | 202 |
| 437 | 3300005543 | Ga0070672_100000668 | Ga0070672_1000006683 | 202 |
| 438 | 3300005548 | Ga0070665_100363178 | Ga0070665_1003631782 | 202 |
| 439 | 3300005563 | Ga0068855_100003914 | Ga0068855_10000391411 | 202 |
| 440 | 3300005564 | Ga0070664_100065545 | Ga0070664_1000655454 | 202 |
| 441 | 3300005577 | Ga0068857_100000246 | Ga0068857_10000024637 | 202 |
| 442 | 3300005578 | Ga0068854_100000337 | Ga0068854_10000033735 | 202 |
| 443 | 3300005616 | Ga0068852_100004492 | Ga0068852_1000044928 | 202 |
| 444 | 3300005617 | Ga0068859_100020576 | Ga0068859_1000205767 | 202 |
| 445 | 3300005618 | Ga0068864_100000810 | Ga0068864_10000081037 | 202 |
| 446 | 3300005719 | Ga0068861_100002114 | Ga0068861_1000021145 | 202 |
| 447 | 3300005840 | Ga0068870_10029673 | Ga0068870_100296732 | 202 |
| 448 | 3300005841 | Ga0068863_100006391 | Ga0068863_10000639116 | 202 |
| 449 | 3300005842 | Ga0068858_100001398 | Ga0068858_10000139816 | 202 |
| 450 | 3300006237 | Ga0097621_100105496 | Ga0097621_1001054962 | 202 |
| 451 | 3300006358 | Ga0068871_100235563 | Ga0068871_1002355631 | 202 |
| 452 | 3300006881 | Ga0068865_100000374 | Ga0068865_10000037421 | 202 |
| 453 | 3300006931 | Ga0097620_100020575 | Ga0097620_1000205757 | 202 |
| 454 | 3300009098 | Ga0105245_10000275 | Ga0105245_1000027538 | 202 |
| 455 | 3300009174 | Ga0105241_10201404 | Ga0105241_102014041 | 202 |
| 456 | 3300009177 | Ga0105248_10008541 | Ga0105248_100085413 | 202 |
| 457 | 3300009551 | Ga0105238_10067722 | Ga0105238_100677223 | 202 |
| 458 | 3300010375 | Ga0105239_10024971 | Ga0105239_100249715 | 202 |
| 459 | 3300011119 | Ga0105246_10012920 | Ga0105246_100129203 | 202 |
| 460 | 3300013100 | Ga0157373_10025963 | Ga0157373_100259632 | 202 |
| 461 | 3300013102 | Ga0157371_10000637 | Ga0157371_1000063710 | 202 |
| 462 | 3300013297 | Ga0157378_10002341 | Ga0157378_100023416 | 202 |
| 463 | 3300013306 | Ga0163162_10058474 | Ga0163162_100584743 | 202 |
| 464 | 3300013307 | Ga0157372_10164726 | Ga0157372_101647263 | 202 |
| 465 | 3300025315 | Ga0207697_10000112 | Ga0207697_100001128 | 202 |
| 466 | 3300025901 | Ga0207688_10003553 | Ga0207688_100035537 | 202 |
| 467 | 3300025903 | Ga0207680_10005882 | Ga0207680_100058829 | 202 |
| 468 | 3300025904 | Ga0207647_10000101 | Ga0207647_1000010150 | 202 |
| 469 | 3300025907 | Ga0207645_10009043 | Ga0207645_100090436 | 202 |
| 470 | 3300025908 | Ga0207643_10181846 | Ga0207643_101818463 | 202 |
| 471 | 3300025919 | Ga0207657_10020154 | Ga0207657_100201546 | 202 |
| 472 | 3300025920 | Ga0207649_10062811 | Ga0207649_100628113 | 202 |
| 473 | 3300025923 | Ga0207681_10001255 | Ga0207681_1000125516 | 202 |
| 474 | 3300025926 | Ga0207659_10002669 | Ga0207659_100026697 | 202 |
| 475 | 3300025927 | Ga0207687_10001375 | Ga0207687_1000137518 | 202 |
| 476 | 3300025931 | Ga0207644_10015555 | Ga0207644_100155553 | 202 |
| 477 | 3300025932 | Ga0207690_10000830 | Ga0207690_100008308 | 202 |
| 478 | 3300025933 | Ga0207706_10000318 | Ga0207706_1000031821 | 202 |
| 479 | 3300025936 | Ga0207670_10024552 | Ga0207670_100245523 | 202 |
| 480 | 3300025937 | Ga0207669_10020878 | Ga0207669_100208782 | 202 |
| 481 | 3300025938 | Ga0207704_10003539 | Ga0207704_100035397 | 202 |
| 482 | 3300025940 | Ga0207691_10000593 | Ga0207691_1000059310 | 202 |
| 483 | 3300025941 | Ga0207711_10003620 | Ga0207711_1000362011 | 202 |
| 484 | 3300025942 | Ga0207689_10000016 | Ga0207689_1000001639 | 202 |
| 485 | 3300025945 | Ga0207679_10031679 | Ga0207679_100316795 | 202 |
| 486 | 3300025949 | Ga0207667_10015822 | Ga0207667_100158226 | 202 |
| 487 | 3300025981 | Ga0207640_10007415 | Ga0207640_100074156 | 202 |
| 488 | 3300025981 | Ga0207640_10129552 | Ga0207640_101295523 | 202 |
| 489 | 3300025986 | Ga0207658_10012129 | Ga0207658_100121296 | 202 |
| 490 | 3300026023 | Ga0207677_10001192 | Ga0207677_100011925 | 202 |
| 491 | 3300026035 | Ga0207703_10070440 | Ga0207703_100704401 | 202 |
| 492 | 3300026067 | Ga0207678_10262728 | Ga0207678_102627281 | 202 |
| 493 | 3300026088 | Ga0207641_10024405 | Ga0207641_100244055 | 202 |
| 494 | 3300026089 | Ga0207648_10007206 | Ga0207648_100072067 | 202 |
| 495 | 3300026095 | Ga0207676_10001961 | Ga0207676_1000196115 | 202 |
| 496 | 3300026116 | Ga0207674_10000114 | Ga0207674_10000114101 | 202 |
| 497 | 3300026142 | Ga0207698_10002635 | Ga0207698_100026353 | 202 |
| 498 | 3300028800 | Ga0265338_10082676 | Ga0265338_100826762 | 202 |
| 499 | 3300031548 | Ga0307408_100105786 | Ga0307408_1001057864 | 202 |
| 500 | 3300031731 | Ga0307405_10020352 | Ga0307405_100203523 | 202 |
| 501 | 3300031824 | Ga0307413_10140456 | Ga0307413_101404562 | 202 |
| 502 | 3300031852 | Ga0307410_10036610 | Ga0307410_100366102 | 202 |
| 503 | 3300031901 | Ga0307406_10080479 | Ga0307406_100804792 | 202 |
| 504 | 3300031903 | Ga0307407_10024481 | Ga0307407_100244813 | 202 |
| 505 | 3300031911 | Ga0307412_10061212 | Ga0307412_100612124 | 202 |
| 506 | 3300031995 | Ga0307409_100049266 | Ga0307409_1000492662 | 202 |
| 507 | 3300032002 | Ga0307416_100016481 | Ga0307416_1000164812 | 202 |
| 508 | 3300032004 | Ga0307414_10017919 | Ga0307414_100179196 | 202 |
| 509 | 3300032126 | Ga0307415_100007851 | Ga0307415_1000078514 | 202 |
| 510 | 3300042007 | Ga0439449_0108666 | Ga0439449_0108666_375_1001 | 202 |
| 511 | 3300046520 | Ga0495637_0006928 | Ga0495637_0006928_3685_4314 | 202 |
| 512 | 3300046660 | Ga0495625_0000777 | Ga0495625_0000777_25880_26509 | 202 |
| 513 | 3300047320 | Ga0495672_0002375 | Ga0495672_0002375_926_1555 | 202 |
| 514 | 3300047469 | Ga0495673_0005592 | Ga0495673_0005592_1458_2087 | 202 |
| 515 | 3300049580 | Ga0501046_0122514 | Ga0501046_0122514_819_1445 | 202 |
| 516 | 3300053104 | Ga0500556_0000466 | Ga0500556_0000466_13903_14532 | 202 |
| 517 | 3300053730 | Ga0500645_000289 | Ga0500645_000289_5852_6481 | 202 |
| 518 | 3300053730 | Ga0500645_021925 | Ga0500645_021925_617_1246 | 202 |
| 519 | iso_pu_bacteria | 2643221695 | 2644529669 | 202 |
| 520 | 3300003322 | rootL2_10285272 | rootL2_102852722 | 203 |
| 521 | 3300005295 | Ga0065707_10355873 | Ga0065707_103558732 | 203 |
| 522 | 3300005327 | Ga0070658_10399850 | Ga0070658_103998502 | 203 |
| 523 | 3300005328 | Ga0070676_10160367 | Ga0070676_101603673 | 203 |
| 524 | 3300005331 | Ga0070670_100092998 | Ga0070670_1000929983 | 203 |
| 525 | 3300005344 | Ga0070661_100014003 | Ga0070661_1000140036 | 203 |
| 526 | 3300005347 | Ga0070668_100111974 | Ga0070668_1001119743 | 203 |
| 527 | 3300005347 | Ga0070668_100124506 | Ga0070668_1001245062 | 203 |
| 528 | 3300005347 | Ga0070668_100488934 | Ga0070668_1004889341 | 203 |
| 529 | 3300005353 | Ga0070669_100437139 | Ga0070669_1004371392 | 203 |
| 530 | 3300005354 | Ga0070675_100354169 | Ga0070675_1003541692 | 203 |
| 531 | 3300005355 | Ga0070671_100003440 | Ga0070671_1000034407 | 203 |
| 532 | 3300005355 | Ga0070671_100238383 | Ga0070671_1002383832 | 203 |
| 533 | 3300005356 | Ga0070674_100085184 | Ga0070674_1000851842 | 203 |
| 534 | 3300005356 | Ga0070674_100286761 | Ga0070674_1002867612 | 203 |
| 535 | 3300005356 | Ga0070674_100432097 | Ga0070674_1004320971 | 203 |
| 536 | 3300005356 | Ga0070674_100525659 | Ga0070674_1005256591 | 203 |
| 537 | 3300005364 | Ga0070673_100561239 | Ga0070673_1005612392 | 203 |
| 538 | 3300005366 | Ga0070659_100129051 | Ga0070659_1001290514 | 203 |
| 539 | 3300005366 | Ga0070659_100174895 | Ga0070659_1001748953 | 203 |
| 540 | 3300005456 | Ga0070678_100012540 | Ga0070678_1000125404 | 203 |
| 541 | 3300005457 | Ga0070662_100002363 | Ga0070662_1000023637 | 203 |
| 542 | 3300005457 | Ga0070662_100073125 | Ga0070662_1000731252 | 203 |
| 543 | 3300005458 | Ga0070681_10319216 | Ga0070681_103192161 | 203 |
| 544 | 3300005530 | Ga0070679_100599459 | Ga0070679_1005994592 | 203 |
| 545 | 3300005539 | Ga0068853_100146353 | Ga0068853_1001463533 | 203 |
| 546 | 3300005543 | Ga0070672_100024701 | Ga0070672_1000247013 | 203 |
| 547 | 3300005543 | Ga0070672_100060167 | Ga0070672_1000601673 | 203 |
| 548 | 3300005564 | Ga0070664_100005277 | Ga0070664_1000052776 | 203 |
| 549 | 3300005564 | Ga0070664_100679635 | Ga0070664_1006796352 | 203 |
| 550 | 3300005614 | Ga0068856_100310228 | Ga0068856_1003102281 | 203 |
| 551 | 3300005618 | Ga0068864_100078348 | Ga0068864_1000783483 | 203 |
| 552 | 3300005844 | Ga0068862_100071902 | Ga0068862_1000719023 | 203 |
| 553 | 3300006237 | Ga0097621_100820258 | Ga0097621_1008202582 | 203 |
| 554 | 3300009553 | Ga0105249_10095314 | Ga0105249_100953143 | 203 |
| 555 | 3300013100 | Ga0157373_10031370 | Ga0157373_100313705 | 203 |
| 556 | 3300013100 | Ga0157373_10071003 | Ga0157373_100710032 | 203 |
| 557 | 3300013102 | Ga0157371_10060928 | Ga0157371_100609282 | 203 |
| 558 | 3300013102 | Ga0157371_10137533 | Ga0157371_101375333 | 203 |
| 559 | 3300013102 | Ga0157371_10216097 | Ga0157371_102160972 | 203 |
| 560 | 3300025903 | Ga0207680_10077597 | Ga0207680_100775973 | 203 |
| 561 | 3300025907 | Ga0207645_10265398 | Ga0207645_102653982 | 203 |
| 562 | 3300025909 | Ga0207705_10004972 | Ga0207705_100049724 | 203 |
| 563 | 3300025925 | Ga0207650_10030898 | Ga0207650_100308984 | 203 |
| 564 | 3300025926 | Ga0207659_10173203 | Ga0207659_101732033 | 203 |
| 565 | 3300025931 | Ga0207644_10006565 | Ga0207644_100065657 | 203 |
| 566 | 3300025931 | Ga0207644_10083017 | Ga0207644_100830172 | 203 |
| 567 | 3300025932 | Ga0207690_10284017 | Ga0207690_102840172 | 203 |
| 568 | 3300025933 | Ga0207706_10002476 | Ga0207706_1000247612 | 203 |
| 569 | 3300025933 | Ga0207706_10034041 | Ga0207706_100340415 | 203 |
| 570 | 3300025933 | Ga0207706_10037251 | Ga0207706_100372514 | 203 |
| 571 | 3300025937 | Ga0207669_10013957 | Ga0207669_100139575 | 203 |
| 572 | 3300025937 | Ga0207669_10473846 | Ga0207669_104738462 | 203 |
| 573 | 3300025937 | Ga0207669_10582272 | Ga0207669_105822721 | 203 |
| 574 | 3300025940 | Ga0207691_10134588 | Ga0207691_101345883 | 203 |
| 575 | 3300025940 | Ga0207691_10157034 | Ga0207691_101570343 | 203 |
| 576 | 3300025960 | Ga0207651_10915413 | Ga0207651_109154132 | 203 |
| 577 | 3300025972 | Ga0207668_10058010 | Ga0207668_100580102 | 203 |
| 578 | 3300026078 | Ga0207702_10272806 | Ga0207702_102728063 | 203 |
| 579 | 3300026095 | Ga0207676_10094261 | Ga0207676_100942613 | 203 |
| 580 | 3300026121 | Ga0207683_10131758 | Ga0207683_101317583 | 203 |
| 581 | 3300026121 | Ga0207683_10779031 | Ga0207683_107790311 | 203 |
| 582 | 3300028380 | Ga0268265_10151545 | Ga0268265_101515452 | 203 |
| 583 | 3300028381 | Ga0268264_10321431 | Ga0268264_103214312 | 203 |
| 584 | 3300031824 | Ga0307413_10262954 | Ga0307413_102629542 | 203 |
| 585 | 3300031852 | Ga0307410_10005694 | Ga0307410_100056949 | 203 |
| 586 | 3300032005 | Ga0307411_10003991 | Ga0307411_100039915 | 203 |
| 587 | 3300032005 | Ga0307411_10120820 | Ga0307411_101208202 | 203 |
| 588 | 3300037418 | Ga0395900_0049368 | Ga0395900_0049368_1781_2434 | 203 |
| 589 | 3300037418 | Ga0395900_0086592 | Ga0395900_0086592_1240_1851 | 203 |
| 590 | 3300037466 | Ga0395898_0027957 | Ga0395898_0027957_3703_4356 | 203 |
| 591 | 3300037466 | Ga0395898_0157863 | Ga0395898_0157863_868_1479 | 203 |
| 592 | 3300037471 | Ga0395905_0174002 | Ga0395905_0174002_27_638 | 203 |
| 593 | 3300037471 | Ga0395905_0537686 | Ga0395905_0537686_350_1003 | 203 |
| 594 | 3300037471 | Ga0395905_0660135 | Ga0395905_0660135_193_816 | 203 |
| 595 | 3300038443 | Ga0395901_0042655 | Ga0395901_0042655_1289_1942 | 203 |
| 596 | 3300038443 | Ga0395901_0979877 | Ga0395901_0979877_27_638 | 203 |
| 597 | 3300044658 | Ga0466972_0257898 | Ga0466972_0257898_171_794 | 203 |
| 598 | 3300046525 | Ga0495663_0000865 | Ga0495663_0000865_9056_9679 | 203 |
| 599 | 3300046537 | Ga0495598_0092411 | Ga0495598_0092411_271_894 | 203 |
| 600 | 3300046539 | Ga0495621_0061372 | Ga0495621_0061372_335_958 | 203 |
| 601 | 3300048905 | Ga0496102_0622109 | Ga0496102_0622109_93_704 | 203 |
| 602 | 3300049583 | Ga0501067_0149612 | Ga0501067_0149612_249_863 | 203 |
| 603 | 3300049590 | Ga0501074_0180267 | Ga0501074_0180267_817_1443 | 203 |
| 604 | 3300001915 | JGI24741J21665_1003534 | JGI24741J21665_10035343 | 204 |
| 605 | 3300001979 | JGI24740J21852_10001632 | JGI24740J21852_100016323 | 204 |
| 606 | 3300001989 | JGI24739J22299_10042028 | JGI24739J22299_100420281 | 204 |
| 607 | 3300001990 | JGI24737J22298_10012867 | JGI24737J22298_100128673 | 204 |
| 608 | 3300002067 | JGI24735J21928_10009048 | JGI24735J21928_100090483 | 204 |
| 609 | 3300003322 | rootL2_10004035 | rootL2_100040354 | 204 |
| 610 | 3300005327 | Ga0070658_10018232 | Ga0070658_100182325 | 204 |
| 611 | 3300005331 | Ga0070670_100329365 | Ga0070670_1003293652 | 204 |
| 612 | 3300005336 | Ga0070680_100244956 | Ga0070680_1002449563 | 204 |
| 613 | 3300005337 | Ga0070682_100009836 | Ga0070682_1000098365 | 204 |
| 614 | 3300005344 | Ga0070661_100029851 | Ga0070661_1000298515 | 204 |
| 615 | 3300005345 | Ga0070692_10008464 | Ga0070692_100084644 | 204 |
| 616 | 3300005354 | Ga0070675_100010756 | Ga0070675_1000107563 | 204 |
| 617 | 3300005364 | Ga0070673_100440349 | Ga0070673_1004403492 | 204 |
| 618 | 3300005455 | Ga0070663_100004495 | Ga0070663_1000044952 | 204 |
| 619 | 3300005457 | Ga0070662_100030837 | Ga0070662_1000308372 | 204 |
| 620 | 3300005535 | Ga0070684_100146234 | Ga0070684_1001462341 | 204 |
| 621 | 3300005543 | Ga0070672_100027847 | Ga0070672_1000278472 | 204 |
| 622 | 3300005547 | Ga0070693_100007166 | Ga0070693_1000071664 | 204 |
| 623 | 3300005563 | Ga0068855_100090451 | Ga0068855_1000904513 | 204 |
| 624 | 3300005564 | Ga0070664_100055635 | Ga0070664_1000556353 | 204 |
| 625 | 3300005564 | Ga0070664_100261231 | Ga0070664_1002612313 | 204 |
| 626 | 3300005577 | Ga0068857_100066598 | Ga0068857_1000665985 | 204 |
| 627 | 3300005578 | Ga0068854_100008850 | Ga0068854_1000088504 | 204 |
| 628 | 3300005618 | Ga0068864_100034527 | Ga0068864_1000345274 | 204 |
| 629 | 3300006881 | Ga0068865_100470784 | Ga0068865_1004707842 | 204 |
| 630 | 3300013307 | Ga0157372_10146066 | Ga0157372_101460662 | 204 |
| 631 | 3300013308 | Ga0157375_10088799 | Ga0157375_100887996 | 204 |
| 632 | 3300025909 | Ga0207705_10051806 | Ga0207705_100518063 | 204 |
| 633 | 3300025919 | Ga0207657_10002057 | Ga0207657_100020575 | 204 |
| 634 | 3300025920 | Ga0207649_10009357 | Ga0207649_100093574 | 204 |
| 635 | 3300025921 | Ga0207652_10215798 | Ga0207652_102157983 | 204 |
| 636 | 3300025923 | Ga0207681_10402425 | Ga0207681_104024252 | 204 |
| 637 | 3300025926 | Ga0207659_10060116 | Ga0207659_100601163 | 204 |
| 638 | 3300025932 | Ga0207690_10012431 | Ga0207690_100124315 | 204 |
| 639 | 3300025933 | Ga0207706_10004182 | Ga0207706_1000418210 | 204 |
| 640 | 3300025938 | Ga0207704_10147272 | Ga0207704_101472723 | 204 |
| 641 | 3300025940 | Ga0207691_10040559 | Ga0207691_100405596 | 204 |
| 642 | 3300025944 | Ga0207661_10014686 | Ga0207661_100146865 | 204 |
| 643 | 3300025945 | Ga0207679_10196631 | Ga0207679_101966313 | 204 |
| 644 | 3300025945 | Ga0207679_10262005 | Ga0207679_102620052 | 204 |
| 645 | 3300025949 | Ga0207667_10256584 | Ga0207667_102565842 | 204 |
| 646 | 3300025960 | Ga0207651_10074504 | Ga0207651_100745043 | 204 |
| 647 | 3300025981 | Ga0207640_10263868 | Ga0207640_102638682 | 204 |
| 648 | 3300026067 | Ga0207678_10003724 | Ga0207678_1000372410 | 204 |
| 649 | 3300026095 | Ga0207676_10081042 | Ga0207676_100810423 | 204 |
| 650 | 3300026116 | Ga0207674_10006404 | Ga0207674_100064045 | 204 |
| 651 | 3300026121 | Ga0207683_10484568 | Ga0207683_104845682 | 204 |
| 652 | 3300031731 | Ga0307405_10061804 | Ga0307405_100618042 | 204 |
| 653 | 3300031824 | Ga0307413_10060648 | Ga0307413_100606482 | 204 |
| 654 | 3300031852 | Ga0307410_10040475 | Ga0307410_100404751 | 204 |
| 655 | 3300031903 | Ga0307407_10300111 | Ga0307407_103001112 | 204 |
| 656 | 3300031911 | Ga0307412_10749215 | Ga0307412_107492151 | 204 |
| 657 | 3300031995 | Ga0307409_100224737 | Ga0307409_1002247373 | 204 |
| 658 | 3300032002 | Ga0307416_100069871 | Ga0307416_1000698713 | 204 |
| 659 | 3300037418 | Ga0395900_0820216 | Ga0395900_0820216_75_689 | 204 |
| 660 | 3300037471 | Ga0395905_0000257 | Ga0395905_0000257_32571_33197 | 204 |
| 661 | 3300037471 | Ga0395905_0305460 | Ga0395905_0305460_280_894 | 204 |
| 662 | 3300038443 | Ga0395901_0393420 | Ga0395901_0393420_71_694 | 204 |
| 663 | 3300044694 | Ga0466963_0299563 | Ga0466963_0299563_388_1002 | 204 |
| 664 | 3300044842 | Ga0466957_0232497 | Ga0466957_0232497_455_1102 | 204 |
| 665 | 3300045836 | Ga0466958_0134895 | Ga0466958_0134895_707_1354 | 204 |
| 666 | 3300045976 | Ga0466967_0047290 | Ga0466967_0047290_1890_2537 | 204 |
| 667 | 3300045976 | Ga0466967_0666590 | Ga0466967_0666590_67_681 | 204 |
| 668 | 3300046691 | Ga0495670_0077858 | Ga0495670_0077858_751_1410 | 204 |
| 669 | 3300047318 | Ga0495636_0014871 | Ga0495636_0014871_2071_2730 | 204 |
| 670 | 3300048912 | Ga0496109_0170229 | Ga0496109_0170229_492_1109 | 204 |
| 671 | 3300053151 | Ga0500604_0000478 | Ga0500604_0000478_6034_6678 | 204 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ch4-assembly1.cif.gz_C | crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. | 0.8461 | 105 | 184 |
| 6b8w-assembly1.cif.gz_B | 1.9 angstrom resolution crystal structure of cupin_2 domain (pfam 07883) of xre family transcriptional regulator from enterobacter cloacae. | 0.8446 | 105 | 186 |
| 7zvy-assembly4.cif.gz_H | thermococcus kadokarensis phosphomannose isomerase | 0.8437 | 105 | 184 |
| 5wse-assembly2.cif.gz_C | crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i | 0.8332 | 54 | 185 |
| 5wsf-assembly2.cif.gz_C | crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii | 0.8316 | 54 | 185 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A9U6_79_184_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8421 | 105 | 185 | 2.60.120.10 |
| af_P76555_101_233_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8363 | 105 | 185 | 2.60.120.10 |
| af_O86372_11_115_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.825 | 105 | 191 | 2.60.120.10 |
| 4i4aA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8241 | 105 | 189 | 2.60.120.10 |
| af_Q2G2A6_62_177_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8239 | 105 | 184 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522Y629-F1-model_v4 | Aspartyl beta-hydroxylase | 1.001 | 7 | 199 |
|
| AF-A0A7W3Y531-F1-model_v4 | Aspartyl/asparaginyl beta-hydroxylase domain-containing protein | 0.9973 | 3 | 201 |
|
| AF-A0A841MAX3-F1-model_v4 | deleted | 0.9939 | 3 | 198 |
|
| AF-A0A552F449-F1-model_v4 | Aspartyl beta-hydroxylase | 0.9913 | 7 | 187 |
|
| AF-A0A6N9NNQ7-F1-model_v4 | Aspartyl beta-hydroxylase | 0.9877 | 6 | 188 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar