F474151

General Info

Members Datasets Scaffolds Average Seq Length
671 264 1304 409

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10009510|Ga0099795_100095101
Length 442
Sequence MPQAALATPLLRAADRKSSFTNGNKNGDATMRRSDGMLGLVAGAAAALSLAGTAVAQDKTLIIGVQCDRTGATQIVGTVLCPAMHDYFNLINSKGGIEGYKIKHDEIDNGYKVPDAVEAYQRQKQEGAIVMTLYGTPQTVALNQRLEEDHIPTTSPGFGISAAADGTRYPYLFPIAATYWSQGAAAVKYVKDKLGDLHGKKIAYVYYDNPAGKEPIPIIEALQKKEGFELRTFAVPPPGVEMGAQALDVTQRYKPDFIINHLFGRSPSVAIKEYKRLGYPLSKVIGLVWASAEADILAAGGWQVAEGYHTLQFAGAGDDYPIRQEIKAMYKKDGKEPPKEMDDTVIYNRGLLQAAVHVEALKNALKQTGGKPPKGEDVKKGFEGIKELNLGGLVPPLTITPTEHEGGGWVQIFQVKGGKFVKETEWVQAYREVVDDAVKHAE

Samples

Sample ID Description Type Environment
1 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
2 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
3 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
171 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
172 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
195 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
196 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
197 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0
Rhizoplane 2.53
Rhizosphere 93.29
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099795_10009510 3300007788 Bacteria 2825
2 JGI26128J50194_1000188 3300003347 Bacteria 2841
3 JGI26141J51220_1000192 3300003503 Bacteria 3230
4 Ga0058861_11932370 3300004800 Bacteria 1973
5 Ga0058862_12836770 3300004803 Bacteria 2268
6 Ga0065715_10092378 3300005293 Bacteria 5155
7 Ga0065707_10098962 3300005295 Bacteria 3042
8 Ga0065707_10163033 3300005295 Bacteria 1545
9 Ga0070683_100203124 3300005329 Bacteria 1882
10 Ga0070670_100008457 3300005331 Bacteria 8778
11 Ga0068869_100004156 3300005334 Bacteria 8981
12 Ga0070666_10139086 3300005335 Bacteria 1691
13 Ga0070680_100001533 3300005336 Bacteria 16841
14 Ga0070680_100025302 3300005336 Bacteria 4744
15 Ga0070682_100005933 3300005337 Bacteria 6834
16 Ga0070660_100000294 3300005339 Bacteria 33307
17 Ga0070689_100137496 3300005340 Bacteria 1963
18 Ga0070691_10003143 3300005341 Bacteria 7390
19 Ga0070691_10013765 3300005341 Bacteria 3711
20 Ga0070691_10018967 3300005341 Bacteria 3170
21 Ga0070691_10021697 3300005341 Bacteria 2973
22 Ga0070661_100001809 3300005344 Bacteria 14835
23 Ga0070692_10000718 3300005345 Bacteria 10731
24 Ga0070669_100038256 3300005353 Bacteria 3483
25 Ga0070671_100005025 3300005355 Bacteria 10548
26 Ga0070671_100105042 3300005355 Bacteria 2370
27 Ga0070673_100096009 3300005364 Bacteria 2432
28 Ga0070659_100000151 3300005366 Bacteria 53009
29 Ga0070703_10013725 3300005406 Bacteria 2303
30 Ga0070709_10006490 3300005434 Bacteria 6376
31 Ga0070709_10055764 3300005434 Bacteria 2496
32 Ga0070709_10096722 3300005434 Bacteria 1958
33 Ga0070714_100066202 3300005435 Bacteria 3114
34 Ga0070714_100188518 3300005435 Bacteria 1880
35 Ga0070713_100086332 3300005436 Bacteria 2690
36 Ga0070710_10014539 3300005437 Bacteria 3965
37 Ga0070710_10036468 3300005437 Bacteria 2688
38 Ga0070710_10096519 3300005437 Bacteria 1752
39 Ga0070701_10023393 3300005438 Bacteria 2975
40 Ga0070711_100009806 3300005439 Bacteria 5906
41 Ga0070711_100032726 3300005439 Bacteria 3459
42 Ga0070705_100000874 3300005440 Bacteria 16855
43 Ga0070705_100002711 3300005440 Bacteria 8843
44 Ga0070700_100014943 3300005441 Bacteria 4391
45 Ga0070700_100177142 3300005441 Bacteria 1481
46 Ga0070694_100000390 3300005444 Bacteria 23753
47 Ga0070694_100004310 3300005444 Bacteria 8551
48 Ga0070694_100014041 3300005444 Bacteria 5009
49 Ga0070694_100016933 3300005444 Bacteria 4597
50 Ga0070694_100018195 3300005444 Bacteria 4457
51 Ga0070694_100028129 3300005444 Bacteria 3655
52 Ga0070694_100105108 3300005444 Bacteria 2003
53 Ga0070708_100006096 3300005445 Bacteria 9593
54 Ga0070708_100007181 3300005445 Bacteria 8896
55 Ga0070708_100013756 3300005445 Bacteria 6639
56 Ga0070708_100337815 3300005445 Bacteria 1419
57 Ga0070708_100347958 3300005445 Bacteria 1397
58 Ga0070678_100024005 3300005456 Bacteria 4074
59 Ga0070662_100012111 3300005457 Bacteria 5710
60 Ga0070681_10004586 3300005458 Bacteria 13188
61 Ga0070681_10011457 3300005458 Bacteria 8776
62 Ga0070681_10043348 3300005458 Bacteria 4508
63 Ga0068867_100001967 3300005459 Bacteria 14329
64 Ga0070706_100001137 3300005467 Bacteria 28677
65 Ga0070706_100006516 3300005467 Bacteria 11018
66 Ga0070706_100027858 3300005467 Bacteria 5196
67 Ga0070706_100033774 3300005467 Bacteria 4723
68 Ga0070706_100054138 3300005467 Bacteria 3703
69 Ga0070706_100057560 3300005467 Unclassified 3587
70 Ga0070706_100176420 3300005467 Bacteria 1995
71 Ga0070706_100306040 3300005467 Bacteria 1483
72 Ga0070706_100351015 3300005467 Unclassified 1375
73 Ga0070707_100006962 3300005468 Bacteria 10481
74 Ga0070707_100009939 3300005468 Bacteria 8854
75 Ga0070707_100038387 3300005468 Bacteria 4574
76 Ga0070707_100051538 3300005468 Bacteria 3946
77 Ga0070707_100058068 3300005468 Bacteria 3711
78 Ga0070707_100185321 3300005468 Bacteria 2029
79 Ga0070698_100007738 3300005471 Bacteria 11626
80 Ga0070698_100015254 3300005471 Bacteria 8125
81 Ga0070698_100044706 3300005471 Bacteria 4532
82 Ga0070698_100279270 3300005471 Bacteria 1602
83 Ga0070698_100307768 3300005471 Bacteria 1515
84 Ga0070698_100324574 3300005471 Bacteria 1470
85 Ga0070699_100010525 3300005518 Bacteria 8002
86 Ga0070699_100064562 3300005518 Unclassified 3175
87 Ga0070699_100080125 3300005518 Bacteria 2845
88 Ga0070699_100186319 3300005518 Bacteria 1843
89 Ga0070699_100217154 3300005518 Bacteria 1703
90 Ga0070679_100001088 3300005530 Bacteria 23758
91 Ga0070684_100005850 3300005535 Bacteria 9463
92 Ga0070697_100071630 3300005536 Bacteria 2843
93 Ga0070697_100103386 3300005536 Bacteria 2368
94 Ga0070697_100117806 3300005536 Bacteria 2219
95 Ga0070697_100193012 3300005536 Bacteria 1729
96 Ga0070697_100217497 3300005536 Bacteria 1628
97 Ga0070697_100237355 3300005536 Bacteria 1556
98 Ga0070697_100248506 3300005536 Bacteria 1521
99 Ga0070697_100273364 3300005536 Unclassified 1449
100 Ga0068853_100029933 3300005539 Bacteria 4594
101 Ga0070695_100002358 3300005545 Bacteria 10839
102 Ga0070695_100013190 3300005545 Bacteria 4965
103 Ga0070695_100039133 3300005545 Bacteria 2996
104 Ga0070695_100116244 3300005545 Bacteria 1823
105 Ga0070696_100001176 3300005546 Bacteria 16947
106 Ga0070696_100028965 3300005546 Bacteria 3780
107 Ga0070696_100140234 3300005546 Bacteria 1766
108 Ga0070693_100000418 3300005547 Bacteria 19261
109 Ga0070704_100000990 3300005549 Bacteria 14478
110 Ga0070704_100006089 3300005549 Bacteria 7080
111 Ga0070704_100015537 3300005549 Bacteria 4785
112 Ga0070704_100015891 3300005549 Bacteria 4741
113 Ga0070704_100022768 3300005549 Bacteria 4081
114 Ga0070704_100133357 3300005549 Bacteria 1929
115 Ga0068855_100001154 3300005563 Bacteria 32715
116 Ga0068855_100010490 3300005563 Bacteria 11175
117 Ga0070664_100027857 3300005564 Bacteria 4698
118 Ga0068857_100003634 3300005577 Bacteria 12926
119 Ga0068857_100213379 3300005577 Bacteria 1762
120 Ga0068854_100005822 3300005578 Bacteria 7809
121 Ga0068856_100001162 3300005614 Bacteria 27668
122 Ga0068856_100010253 3300005614 Bacteria 9108
123 Ga0068856_100252455 3300005614 Bacteria 1779
124 Ga0068859_100001630 3300005617 Bacteria 22959
125 Ga0068861_100038377 3300005719 Bacteria 3566
126 Ga0068861_100067287 3300005719 Bacteria 2764
127 Ga0068870_10000280 3300005840 Bacteria 18887
128 Ga0068863_100031188 3300005841 Bacteria 5089
129 Ga0068863_100365188 3300005841 Bacteria 1408
130 Ga0068860_100032109 3300005843 Bacteria 5048
131 Ga0068862_100009378 3300005844 Bacteria 8095
132 Ga0068862_100030739 3300005844 Bacteria 4527
133 Ga0081455_10000429 3300005937 Bacteria 55107
134 Ga0081455_10000614 3300005937 Bacteria 46194
135 Ga0081455_10059594 3300005937 Bacteria 3222
136 Ga0081538_10008934 3300005981 Bacteria 8418
137 Ga0081540_1000439 3300005983 Bacteria 41151
138 Ga0081540_1006694 3300005983 Bacteria 8336
139 Ga0081540_1010324 3300005983 Bacteria 6333
140 Ga0081540_1042107 3300005983 Bacteria 2359
141 Ga0081540_1053756 3300005983 Bacteria 1972
142 Ga0081539_10000009 3300005985 Bacteria 509286
143 Ga0081539_10003370 3300005985 Bacteria 19783
144 Ga0070717_10037224 3300006028 Bacteria 3950
145 Ga0070717_10081295 3300006028 Bacteria 2720
146 Ga0070717_10082992 3300006028 Bacteria 2694
147 Ga0070717_10123932 3300006028 Bacteria 2216
148 Ga0070717_10173863 3300006028 Bacteria 1874
149 Ga0075365_10009014 3300006038 Bacteria 5706
150 Ga0075365_10106595 3300006038 Bacteria 1923
151 Ga0075363_100001768 3300006048 Bacteria 8443
152 Ga0075364_10078025 3300006051 Bacteria 2187
153 Ga0070715_10014494 3300006163 Bacteria 2922
154 Ga0070715_10068651 3300006163 Bacteria 1577
155 Ga0070716_100005122 3300006173 Bacteria 6332
156 Ga0070716_100039347 3300006173 Bacteria 2624
157 Ga0070716_100086981 3300006173 Bacteria 1882
158 Ga0070712_100063920 3300006175 Bacteria 2608
159 Ga0070712_100098498 3300006175 Bacteria 2157
160 Ga0070712_100190433 3300006175 Bacteria 1605
161 Ga0070712_100206548 3300006175 Bacteria 1546
162 Ga0070712_100207614 3300006175 Bacteria 1543
163 Ga0075362_10016961 3300006177 Bacteria 2992
164 Ga0075367_10010976 3300006178 Bacteria 4776
165 Ga0075369_10003009 3300006186 Bacteria 6099
166 Ga0075370_10030522 3300006353 Bacteria 3008
167 Ga0075428_100006217 3300006844 Bacteria 13284
168 Ga0075428_100023977 3300006844 Bacteria 6752
169 Ga0075428_100027980 3300006844 Bacteria 6237
170 Ga0075428_100037436 3300006844 Bacteria 5341
171 Ga0075428_100086809 3300006844 Bacteria 3413
172 Ga0075428_100092066 3300006844 Bacteria 3306
173 Ga0075428_100152416 3300006844 Bacteria 2511
174 Ga0075428_100228753 3300006844 Bacteria 2007
175 Ga0075428_100432832 3300006844 Unclassified 1409
176 Ga0075430_100000036 3300006846 Bacteria 68655
177 Ga0075430_100016546 3300006846 Bacteria 6281
178 Ga0075430_100016657 3300006846 Bacteria 6259
179 Ga0075430_100017473 3300006846 Bacteria 6110
180 Ga0075430_100152937 3300006846 Bacteria 1921
181 Ga0075431_100000629 3300006847 Bacteria 29777
182 Ga0075431_100000714 3300006847 Bacteria 28614
183 Ga0075431_100006204 3300006847 Bacteria 11869
184 Ga0075431_100009272 3300006847 Bacteria 9877
185 Ga0075431_100016995 3300006847 Bacteria 7388
186 Ga0075431_100034402 3300006847 Bacteria 5220
187 Ga0075431_100035508 3300006847 Bacteria 5133
188 Ga0075433_10001697 3300006852 Bacteria 16428
189 Ga0075433_10003287 3300006852 Bacteria 12487
190 Ga0075433_10009479 3300006852 Bacteria 7782
191 Ga0075433_10011281 3300006852 Bacteria 7192
192 Ga0075433_10016038 3300006852 Bacteria 6163
193 Ga0075433_10027779 3300006852 Bacteria 4803
194 Ga0075433_10085100 3300006852 Bacteria 2791
195 Ga0075433_10250220 3300006852 Bacteria 1572
196 Ga0075433_10252497 3300006852 Bacteria 1564
197 Ga0075434_100003287 3300006871 Bacteria 14450
198 Ga0075434_100006800 3300006871 Bacteria 10518
199 Ga0075434_100008755 3300006871 Bacteria 9418
200 Ga0075434_100022580 3300006871 Bacteria 6128
201 Ga0075434_100054956 3300006871 Bacteria 3956
202 Ga0075434_100263310 3300006871 Bacteria 1743
203 Ga0075434_100415914 3300006871 Bacteria 1366
204 Ga0075429_100000001 3300006880 Bacteria 139031
205 Ga0075429_100001368 3300006880 Bacteria 19959
206 Ga0075429_100010885 3300006880 Bacteria 7866
207 Ga0075429_100020932 3300006880 Bacteria 5675
208 Ga0075429_100032661 3300006880 Bacteria 4524
209 Ga0075429_100100553 3300006880 Bacteria 2524
210 Ga0075429_100214966 3300006880 Bacteria 1684
211 Ga0075436_100042958 3300006914 Bacteria 3117
212 Ga0075436_100061850 3300006914 Bacteria 2587
213 Ga0075436_100062790 3300006914 Bacteria 2568
214 Ga0075436_100069559 3300006914 Bacteria 2432
215 Ga0097620_100001630 3300006931 Bacteria 22959
216 Ga0075435_100001997 3300007076 Bacteria 13347
217 Ga0075435_100005120 3300007076 Bacteria 9111
218 Ga0075435_100008181 3300007076 Bacteria 7488
219 Ga0075435_100009154 3300007076 Bacteria 7149
220 Ga0075435_100009192 3300007076 Bacteria 7136
221 Ga0075435_100026975 3300007076 Bacteria 4488
222 Ga0075435_100039031 3300007076 Bacteria 3788
223 Ga0075435_100071253 3300007076 Bacteria 2838
224 Ga0075435_100172336 3300007076 Bacteria 1826
225 Ga0099794_10000487 3300007265 Bacteria 13284
226 Ga0099794_10086648 3300007265 Bacteria 1551
227 Ga0099795_10008810 3300007788 Bacteria 2898
228 Ga0099795_10023522 3300007788 Bacteria 2046
229 Ga0099795_10030337 3300007788 Bacteria 1855
230 Ga0105240_10007999 3300009093 Bacteria 15231
231 Ga0111539_10002135 3300009094 Bacteria 26456
232 Ga0111539_10015983 3300009094 Bacteria 9322
233 Ga0111539_10016701 3300009094 Bacteria 9096
234 Ga0111539_10026718 3300009094 Bacteria 7054
235 Ga0111539_10056697 3300009094 Bacteria 4655
236 Ga0111539_10220953 3300009094 Bacteria 2206
237 Ga0111539_10232723 3300009094 Bacteria 2145
238 Ga0111539_10247909 3300009094 Bacteria 2074
239 Ga0114129_10000322 3300009147 Bacteria 56282
240 Ga0114129_10002831 3300009147 Bacteria 24225
241 Ga0114129_10007315 3300009147 Bacteria 15718
242 Ga0114129_10010340 3300009147 Bacteria 13308
243 Ga0114129_10010897 3300009147 Bacteria 12951
244 Ga0114129_10018134 3300009147 Bacteria 10024
245 Ga0114129_10048367 3300009147 Bacteria 5975
246 Ga0114129_10055099 3300009147 Bacteria 5573
247 Ga0114129_10060423 3300009147 Bacteria 5299
248 Ga0114129_10155772 3300009147 Bacteria 3124
249 Ga0114129_10204292 3300009147 Bacteria 2674
250 Ga0114129_10235006 3300009147 Bacteria 2467
251 Ga0114129_10303008 3300009147 Bacteria 2129
252 Ga0114129_10340129 3300009147 Bacteria 1991
253 Ga0114129_10510172 3300009147 Bacteria 1569
254 Ga0114129_10587045 3300009147 Bacteria 1445
255 Ga0105243_10037182 3300009148 Bacteria 3781
256 Ga0105241_10000054 3300009174 Bacteria 93205
257 Ga0105242_10006067 3300009176 Bacteria 9314
258 Ga0105242_10018131 3300009176 Bacteria 5498
259 Ga0105248_10031959 3300009177 Bacteria 5881
260 Ga0105248_10266746 3300009177 Bacteria 1927
261 Ga0105238_10242800 3300009551 Bacteria 1779
262 Ga0105249_10250181 3300009553 Bacteria 1757
263 Ga0099796_10000554 3300010159 Bacteria 6402
264 Ga0099796_10017494 3300010159 Bacteria 2136
265 Ga0105246_10159295 3300011119 Bacteria 1718
266 Ga0105246_10178903 3300011119 Bacteria 1631
267 Ga0157373_10001456 3300013100 Bacteria 18090
268 Ga0157369_10009863 3300013105 Bacteria 10912
269 Ga0157378_10083998 3300013297 Bacteria 2882
270 Ga0157378_10084416 3300013297 Bacteria 2875
271 Ga0157372_10002144 3300013307 Bacteria 21446
272 Ga0157372_10278494 3300013307 Bacteria 1944
273 Ga0157375_10260744 3300013308 Bacteria 1895
274 Ga0182008_10005560 3300014497 Bacteria 7157
275 Ga0157379_10162769 3300014968 Bacteria 2014
276 Ga0206356_11142278 3300020070 Bacteria 2417
277 Ga0213875_10000093 3300021388 Bacteria 102870
278 Ga0213875_10001013 3300021388 Bacteria 19912
279 Ga0207697_10069156 3300025315 Bacteria 1478
280 Ga0207653_10002520 3300025885 Bacteria 5815
281 Ga0207653_10006469 3300025885 Bacteria 3655
282 Ga0207692_10050655 3300025898 Bacteria 2101
283 Ga0207647_10021823 3300025904 Bacteria 4264
284 Ga0207685_10007298 3300025905 Bacteria 3071
285 Ga0207699_10003489 3300025906 Bacteria 7507
286 Ga0207645_10000589 3300025907 Bacteria 30180
287 Ga0207643_10000014 3300025908 Bacteria 128891
288 Ga0207684_10000370 3300025910 Bacteria 60789
289 Ga0207684_10002192 3300025910 Bacteria 19973
290 Ga0207684_10003860 3300025910 Bacteria 14412
291 Ga0207684_10006972 3300025910 Bacteria 10221
292 Ga0207684_10017517 3300025910 Bacteria 6144
293 Ga0207684_10066963 3300025910 Bacteria 3051
294 Ga0207684_10110882 3300025910 Bacteria 2349
295 Ga0207654_10000969 3300025911 Bacteria 15755
296 Ga0207707_10000138 3300025912 Bacteria 74881
297 Ga0207707_10052810 3300025912 Bacteria 3537
298 Ga0207695_10046534 3300025913 Bacteria 4599
299 Ga0207693_10001346 3300025915 Bacteria 21707
300 Ga0207693_10003717 3300025915 Bacteria 13007
301 Ga0207693_10043695 3300025915 Bacteria 3523
302 Ga0207693_10096764 3300025915 Bacteria 2314
303 Ga0207693_10152749 3300025915 Bacteria 1816
304 Ga0207693_10231867 3300025915 Bacteria 1450
305 Ga0207663_10031912 3300025916 Bacteria 3122
306 Ga0207663_10086081 3300025916 Bacteria 2071
307 Ga0207663_10102103 3300025916 Bacteria 1928
308 Ga0207663_10172723 3300025916 Bacteria 1537
309 Ga0207660_10000848 3300025917 Bacteria 20138
310 Ga0207660_10026822 3300025917 Bacteria 3926
311 Ga0207662_10021513 3300025918 Bacteria 3688
312 Ga0207657_10000135 3300025919 Bacteria 75248
313 Ga0207649_10002171 3300025920 Bacteria 11096
314 Ga0207652_10004011 3300025921 Bacteria 12022
315 Ga0207646_10000466 3300025922 Bacteria 54002
316 Ga0207646_10001054 3300025922 Bacteria 35091
317 Ga0207646_10004703 3300025922 Bacteria 14713
318 Ga0207646_10007870 3300025922 Bacteria 10763
319 Ga0207646_10041956 3300025922 Bacteria 4111
320 Ga0207646_10061179 3300025922 Bacteria 3362
321 Ga0207650_10032026 3300025925 Bacteria 3802
322 Ga0207650_10070293 3300025925 Bacteria 2631
323 Ga0207700_10005378 3300025928 Bacteria 7649
324 Ga0207700_10156884 3300025928 Bacteria 1886
325 Ga0207664_10035058 3300025929 Bacteria 3869
326 Ga0207664_10051285 3300025929 Bacteria 3257
327 Ga0207664_10055109 3300025929 Bacteria 3154
328 Ga0207664_10098812 3300025929 Bacteria 2407
329 Ga0207664_10237139 3300025929 Bacteria 1587
330 Ga0207644_10076888 3300025931 Bacteria 2457
331 Ga0207644_10111628 3300025931 Bacteria 2068
332 Ga0207690_10006221 3300025932 Bacteria 7069
333 Ga0207706_10002886 3300025933 Bacteria 16648
334 Ga0207686_10061423 3300025934 Bacteria 2382
335 Ga0207709_10004526 3300025935 Bacteria 8018
336 Ga0207665_10005555 3300025939 Bacteria 8409
337 Ga0207665_10005704 3300025939 Bacteria 8294
338 Ga0207665_10096390 3300025939 Bacteria 2057
339 Ga0207689_10000340 3300025942 Bacteria 43593
340 Ga0207661_10198796 3300025944 Bacteria 1761
341 Ga0207679_10000212 3300025945 Bacteria 46385
342 Ga0207667_10000296 3300025949 Bacteria 68803
343 Ga0207667_10020302 3300025949 Bacteria 7394
344 Ga0207651_10067759 3300025960 Bacteria 2513
345 Ga0207640_10002509 3300025981 Bacteria 9840
346 Ga0207639_10002273 3300026041 Bacteria 12918
347 Ga0207678_10048334 3300026067 Bacteria 3677
348 Ga0207678_10118253 3300026067 Bacteria 2261
349 Ga0207708_10022732 3300026075 Bacteria 4736
350 Ga0207708_10024700 3300026075 Bacteria 4545
351 Ga0207708_10025963 3300026075 Bacteria 4432
352 Ga0207702_10001150 3300026078 Bacteria 27070
353 Ga0207702_10007137 3300026078 Bacteria 9560
354 Ga0207702_10041312 3300026078 Bacteria 3867
355 Ga0207702_10261929 3300026078 Unclassified 1628
356 Ga0207648_10001239 3300026089 Bacteria 28649
357 Ga0207676_10047786 3300026095 Bacteria 3318
358 Ga0207674_10000684 3300026116 Bacteria 44066
359 Ga0207674_10135326 3300026116 Bacteria 2426
360 Ga0207675_100067675 3300026118 Bacteria 3338
361 Ga0207675_100140740 3300026118 Bacteria 2292
362 Ga0209996_1000295 3300027395 Bacteria 6258
363 Ga0209968_1002318 3300027526 Bacteria 2879
364 Ga0209999_1000126 3300027543 Bacteria 9747
365 Ga0209999_1013651 3300027543 Bacteria 1473
366 Ga0209982_1000242 3300027552 Bacteria 6502
367 Ga0209970_1001480 3300027614 Bacteria 4093
368 Ga0210002_1001838 3300027617 Bacteria 3025
369 Ga0209983_1001198 3300027665 Bacteria 5741
370 Ga0209588_1000983 3300027671 Bacteria 7324
371 Ga0209971_1000010 3300027682 Bacteria 84272
372 Ga0209966_1000110 3300027695 Bacteria 36054
373 Ga0209998_10000131 3300027717 Bacteria 29645
374 Ga0209998_10010084 3300027717 Bacteria 1956
375 Ga0209974_10000212 3300027876 Bacteria 18842
376 Ga0207428_10000018 3300027907 Bacteria 293117
377 Ga0207428_10000119 3300027907 Bacteria 106261
378 Ga0207428_10011195 3300027907 Bacteria 7955
379 Ga0207428_10061036 3300027907 Bacteria 2986
380 Ga0207428_10067671 3300027907 Bacteria 2812
381 Ga0207428_10226252 3300027907 Bacteria 1401
382 Ga0268265_10011395 3300028380 Bacteria 6013
383 Ga0268265_10014769 3300028380 Bacteria 5329
384 Ga0268265_10193887 3300028380 Bacteria 1757
385 Ga0268264_10039815 3300028381 Bacteria 3883
386 Ga0268264_10164858 3300028381 Bacteria 2000
387 Ga0265325_10096175 3300031241 Bacteria 1455
388 Ga0307408_100058847 3300031548 Bacteria 2795
389 Ga0307408_100125451 3300031548 Bacteria 1995
390 Ga0307405_10206023 3300031731 Bacteria 1432
391 Ga0307411_10080566 3300032005 Bacteria 2239
392 Ga0373930_0009288 3300034816 Bacteria 1738
393 Ga0373926_0016334 3300035083 Bacteria 2537
394 Ga0373952_0016245 3300035092 Bacteria 1511
395 Ga0373941_0021723 3300035115 Bacteria 1815
396 Ga0373941_0023233 3300035115 Bacteria 1768
397 Ga0373945_0011913 3300035116 Bacteria 2882
398 Ga0373954_0013823 3300035118 Bacteria 3598
399 Ga0373956_0018834 3300035119 Bacteria 2926
400 Ga0373956_0026489 3300035119 Bacteria 2512
401 Ga0373957_0037120 3300035120 Bacteria 1819
402 Ga0373960_0020369 3300035121 Bacteria 1753
403 Ga0373960_0035323 3300035121 Bacteria 1418
404 Ga0373961_0005083 3300035241 Bacteria 3164
405 Ga0373962_0016692 3300035242 Bacteria 1896
406 Ga0373931_0000715 3300035691 Bacteria 13744
407 Ga0373931_0017701 3300035691 Bacteria 3530
408 Ga0373931_0140910 3300035691 Unclassified 1396
409 Ga0373933_0004756 3300035724 Bacteria 7425
410 Ga0373947_0044903 3300035725 Bacteria 2643
411 Ga0373937_0016274 3300036401 Bacteria 6600
412 Ga0373937_0021005 3300036401 Bacteria 5857
413 Ga0373937_0049264 3300036401 Bacteria 3858
414 Ga0373937_0074521 3300036401 Bacteria 3132
415 Ga0373925_0031764 3300037068 Bacteria 3883
416 Ga0395899_0012087 3300037312 Bacteria 6613
417 Ga0395900_0003990 3300037418 Bacteria 15763
418 Ga0395898_0025567 3300037466 Bacteria 5947
419 Ga0436364_0331623 3300037853 Bacteria 59138
420 Ga0436364_0773474 3300037853 Bacteria 29224
421 Ga0436364_1258355 3300037853 Bacteria 3574
422 Ga0436364_1326053 3300037853 Bacteria 2168
423 Ga0395901_0002291 3300038443 Bacteria 19520
424 Ga0395901_0056362 3300038443 Bacteria 4088
425 Ga0436365_0230297 3300039437 Bacteria 2923
426 Ga0436365_0958354 3300039437 Bacteria 1505
427 Ga0436365_1194317 3300039437 Bacteria 2212
428 Ga0436360_1348286 3300039438 Bacteria 1596
429 Ga0436361_0264733 3300039447 Bacteria 3313
430 Ga0436363_0441940 3300039450 Bacteria 3662
431 Ga0436363_0641214 3300039450 Bacteria 2882
432 Ga0436363_1105234 3300039450 Bacteria 1608
433 Ga0436362_0080012 3300039453 Bacteria 1578
434 Ga0436362_0285804 3300039453 Bacteria 2081
435 Ga0436362_0692183 3300039453 Bacteria 7003
436 Ga0439441_003743 3300042001 Bacteria 2265
437 Ga0439441_015854 3300042001 Bacteria 1338
438 Ga0439448_0008866 3300042005 Bacteria 2952
439 Ga0439458_0013256 3300042157 Bacteria 1856
440 Ga0439459_0000674 3300042438 Bacteria 4653
441 Ga0439460_0000053 3300042461 Bacteria 17302
442 Ga0451577_0000878 3300042876 Bacteria 44604
443 Ga0451577_0006974 3300042876 Bacteria 11162
444 Ga0453683_0005279 3300044673 Bacteria 9041
445 Ga0453683_0016897 3300044673 Bacteria 4703
446 Ga0466963_0072415 3300044694 Bacteria 2322
447 Ga0453684_0015335 3300044712 Bacteria 12140
448 Ga0453684_0122234 3300044712 Bacteria 3141
449 Ga0451576_0007101 3300045051 Bacteria 13522
450 Ga0451576_0051473 3300045051 Bacteria 4318
451 Ga0451576_0423127 3300045051 Bacteria 1397
452 Ga0495592_0144461 3300046454 Bacteria 1651
453 Ga0495651_0002772 3300046462 Bacteria 13596
454 Ga0495580_0027775 3300046472 Bacteria 4116
455 Ga0495580_0094723 3300046472 Bacteria 2077
456 Ga0495628_0190858 3300046516 Bacteria 1547
457 Ga0495667_0008139 3300046559 Bacteria 7115
458 Ga0495667_0083041 3300046559 Bacteria 2081
459 Ga0495600_0005206 3300046809 Bacteria 7820
460 Ga0496102_0009867 3300048905 Bacteria 8209
461 Ga0496102_0099159 3300048905 Bacteria 2704
462 Ga0496104_0008978 3300048907 Bacteria 8889
463 Ga0496104_0120296 3300048907 Bacteria 2521
464 Ga0496105_0090205 3300048908 Bacteria 2532
465 Ga0496106_0052068 3300048909 Bacteria 3088
466 Ga0496108_0108701 3300048911 Bacteria 2369
467 Ga0496108_0270779 3300048911 Bacteria 1478
468 Ga0496110_0079813 3300048913 Bacteria 2914
469 Ga0496110_0206415 3300048913 Bacteria 1786
470 Ga0496111_0146412 3300048914 Bacteria 1751
471 Ga0496112_0043901 3300048915 Bacteria 4377
472 Ga0496113_0022254 3300048916 Bacteria 4481
473 Ga0496113_0197280 3300048916 Bacteria 1599
474 Ga0496113_0202048 3300048916 Bacteria 1580
475 Ga0496115_0004110 3300048918 Bacteria 10504
476 Ga0496115_0092386 3300048918 Bacteria 2474
477 Ga0501033_0059149 3300049570 Bacteria 2830
478 Ga0501034_0161528 3300049571 Bacteria 2211
479 Ga0501039_0050076 3300049575 Bacteria 3231
480 Ga0501039_0059694 3300049575 Bacteria 2954
481 Ga0501039_0127399 3300049575 Bacteria 1997
482 Ga0501040_0025557 3300049576 Bacteria 3971
483 Ga0501040_0037944 3300049576 Bacteria 3275
484 Ga0501040_0067696 3300049576 Bacteria 2461
485 Ga0501040_0123192 3300049576 Bacteria 1820
486 Ga0501041_0011746 3300049577 Bacteria 5184
487 Ga0501041_0034648 3300049577 Bacteria 3057
488 Ga0501041_0086344 3300049577 Bacteria 1935
489 Ga0501041_0098733 3300049577 Bacteria 1806
490 Ga0501042_0013014 3300049578 Bacteria 5653
491 Ga0501042_0021895 3300049578 Bacteria 4461
492 Ga0501042_0022559 3300049578 Bacteria 4398
493 Ga0501042_0219214 3300049578 Bacteria 1372
494 Ga0501046_0000340 3300049580 Bacteria 47112
495 Ga0501046_0028185 3300049580 Bacteria 4576
496 Ga0501047_0059370 3300049581 Bacteria 3693
497 Ga0501048_0004505 3300049582 Bacteria 10612
498 Ga0501068_0187371 3300049584 Unclassified 1310
499 Ga0501070_0249821 3300049586 Bacteria 1451
500 Ga0501071_0043549 3300049587 Bacteria 3219
501 Ga0501071_0155197 3300049587 Bacteria 1709
502 Ga0501072_0008337 3300049588 Bacteria 7871
503 Ga0501072_0050057 3300049588 Bacteria 3289
504 Ga0501072_0085116 3300049588 Bacteria 2507
505 Ga0501072_0129072 3300049588 Bacteria 2014
506 Ga0501072_0130580 3300049588 Bacteria 2002
507 Ga0501072_0157583 3300049588 Bacteria 1811
508 Ga0501075_0057979 3300049591 Bacteria 2916
509 Ga0501075_0059332 3300049591 Bacteria 2882
510 Ga0501075_0060507 3300049591 Bacteria 2854
511 Ga0501075_0076852 3300049591 Bacteria 2526
512 Ga0501075_0096826 3300049591 Bacteria 2239
513 Ga0501075_0143215 3300049591 Bacteria 1822
514 Ga0501075_0146060 3300049591 Bacteria 1802
515 Ga0501075_0164844 3300049591 Bacteria 1691
516 Ga0501075_0169618 3300049591 Bacteria 1665
517 Ga0501076_0000873 3300049592 Bacteria 19565
518 Ga0501076_0004037 3300049592 Bacteria 10370
519 Ga0501076_0013676 3300049592 Bacteria 6089
520 Ga0501076_0030779 3300049592 Bacteria 4182
521 Ga0501076_0032676 3300049592 Bacteria 4062
522 Ga0501076_0088759 3300049592 Bacteria 2485
523 Ga0501077_0005626 3300049593 Bacteria 7636
524 Ga0501077_0041922 3300049593 Bacteria 2913
525 Ga0501077_0065705 3300049593 Bacteria 2300
526 Ga0501079_0000054 3300049741 Bacteria 51028
527 Ga0501079_0002208 3300049741 Bacteria 14038
528 Ga0501079_0017702 3300049741 Bacteria 5443
529 Ga0501079_0054104 3300049741 Bacteria 3096
530 Ga0501079_0097492 3300049741 Bacteria 2279
531 Ga0501079_0171728 3300049741 Bacteria 1691
532 Ga0501079_0219763 3300049741 Unclassified 1484
533 Ga0501080_0216473 3300049742 Bacteria 1754
534 Ga0501081_0000414 3300049743 Bacteria 23540
535 Ga0501081_0041469 3300049743 Bacteria 3152
536 Ga0501081_0082142 3300049743 Bacteria 2257
537 Ga0501083_0017683 3300049744 Bacteria 4971
538 Ga0501083_0051620 3300049744 Bacteria 2765
539 Ga0501083_0116056 3300049744 Bacteria 1757
540 Ga0501035_0172805 3300049822 Bacteria 1866
541 Ga0501045_0000589 3300049824 Bacteria 22827
542 Ga0501045_0006365 3300049824 Bacteria 8171
543 Ga0501045_0020631 3300049824 Bacteria 4709
544 nmdc:mga03683_19849_c1 3300050489 Bacteria 2571
545 nmdc:mga00v17_45837_c1 3300050491 Bacteria 2643
546 nmdc:mga0yw44_47894_c1 3300050492 Bacteria 2575
547 nmdc:mga06z11_17445_c1 3300050494 Bacteria 3258
548 nmdc:mga06z11_68435_c1 3300050494 Bacteria 1871
549 nmdc:mga07m45_46673_c1 3300050496 Bacteria 2434
550 nmdc:mga05p37_100049_c1 3300050507 Bacteria 3571
551 nmdc:mga05p37_114100_c1 3300050507 Bacteria 3321
552 nmdc:mga05p37_114141_c1 3300050507 Bacteria 3320
553 nmdc:mga05p37_11812_c1 3300050507 Bacteria 10409
554 nmdc:mga05p37_149375_c1 3300050507 Bacteria 2859
555 nmdc:mga05p37_160629_c1 3300050507 Bacteria 2745
556 nmdc:mga05p37_163461_c1 3300050507 Bacteria 2718
557 nmdc:mga05p37_178624_c1 3300050507 Bacteria 2584
558 nmdc:mga05p37_1865_c1 3300050507 Bacteria 15138
559 nmdc:mga05p37_228482_c1 3300050507 Bacteria 2243
560 nmdc:mga05p37_34829_c1 3300050507 Bacteria 6168
561 nmdc:mga05p37_36075_c1 3300050507 Bacteria 6066
562 nmdc:mga05p37_388956_c1 3300050507 Bacteria 1632
563 nmdc:mga05p37_5490_c1 3300050507 Bacteria 14894
564 nmdc:mga05p37_65119_c1 3300050507 Bacteria 4485
565 nmdc:mga05p37_84747_c1 3300050507 Bacteria 3905
566 nmdc:mga09592_124416_c1 3300050508 Bacteria 2216
567 nmdc:mga09592_19211_c1 3300050508 Bacteria 5609
568 nmdc:mga09592_26083_c1 3300050508 Bacteria 4840
569 nmdc:mga09592_30261_c1 3300050508 Bacteria 4505
570 nmdc:mga09592_35170_c1 3300050508 Bacteria 4192
571 nmdc:mga09592_40517_c1 3300050508 Bacteria 3913
572 nmdc:mga09592_66_c1 3300050508 Bacteria 59617
573 nmdc:mga09592_80560_c1 3300050508 Bacteria 2773
574 nmdc:mga09592_86185_c1 3300050508 Bacteria 2680
575 nmdc:mga0qj67_10633_c1 3300050509 Bacteria 6877
576 nmdc:mga0qj67_143630_c1 3300050509 Bacteria 1935
577 nmdc:mga0qj67_15838_c1 3300050509 Bacteria 5709
578 nmdc:mga0qj67_32076_c1 3300050509 Bacteria 4096
579 nmdc:mga0qj67_4200_c1 3300050509 Bacteria 10433
580 nmdc:mga0qj67_528_c1 3300050509 Bacteria 26031
581 nmdc:mga0qj67_8409_c1 3300050509 Bacteria 5017
582 nmdc:mga06r32_242077_c1 3300050510 Bacteria 1791
583 nmdc:mga06r32_2588_c1 3300050510 Bacteria 16155
584 nmdc:mga06r32_43191_c1 3300050510 Bacteria 4289
585 nmdc:mga06r32_4700_c1 3300050510 Bacteria 12268
586 nmdc:mga06r32_54094_c1 3300050510 Bacteria 3849
587 nmdc:mga06r32_6269_c1 3300050510 Bacteria 10678
588 nmdc:mga06r32_69457_c1 3300050510 Bacteria 3405
589 nmdc:mga06r32_84373_c1 3300050510 Bacteria 3096
590 nmdc:mga06r32_94036_c1 3300050510 Bacteria 2933
591 nmdc:mga08y16_108437_c1 3300050511 Bacteria 2891
592 nmdc:mga08y16_113308_c1 3300050511 Bacteria 2823
593 nmdc:mga08y16_1288_c1 3300050511 Bacteria 24890
594 nmdc:mga08y16_42135_c1 3300050511 Bacteria 4782
595 nmdc:mga08y16_47598_c1 3300050511 Bacteria 4489
596 nmdc:mga08y16_67326_c1 3300050511 Bacteria 3736
597 nmdc:mga0n895_201928_c1 3300050512 Bacteria 2019
598 nmdc:mga0n895_225895_c1 3300050512 Bacteria 1900
599 nmdc:mga0n895_271149_c1 3300050512 Bacteria 1721
600 nmdc:mga0n895_27826_c1 3300050512 Bacteria 5373
601 nmdc:mga0n895_44044_c1 3300050512 Bacteria 4353
602 nmdc:mga0n895_55226_c1 3300050512 Bacteria 3909
603 nmdc:mga0n895_70965_c1 3300050512 Bacteria 3453
604 nmdc:mga0n895_80001_c1 3300050512 Bacteria 3255
605 nmdc:mga0n895_9374_c1 3300050512 Bacteria 8561
606 nmdc:mga0n895_9734_c1 3300050512 Bacteria 8429
607 nmdc:mga0n895_97415_c1 3300050512 Bacteria 2947
608 nmdc:mga0rr50_130054_c1 3300050513 Bacteria 2015
609 nmdc:mga0rr50_145517_c1 3300050513 Bacteria 1910
610 nmdc:mga0rr50_23017_c1 3300050513 Bacteria 4287
611 nmdc:mga0rr50_253739_c1 3300050513 Bacteria 1461
612 nmdc:mga0rr50_28956_c1 3300050513 Bacteria 3899
613 nmdc:mga0rr50_45061_c1 3300050513 Plasmid 3239
614 nmdc:mga0rr50_47199_c1 3300050513 Bacteria 3175
615 nmdc:mga0rr50_5944_c1 3300050513 Bacteria 7350
616 nmdc:mga0rr50_60585_c1 3300050513 Bacteria 2848
617 nmdc:mga0rr50_69508_c1 3300050513 Bacteria 2680
618 nmdc:mga0rr50_72972_c1 3300050513 Bacteria 2623
619 nmdc:mga0rr50_8215_c1 3300050513 Bacteria 6485
620 nmdc:mga08x19_30996_c1 3300050514 Bacteria 3361
621 nmdc:mga08x19_75213_c1 3300050514 Bacteria 2208
622 nmdc:mga08x19_8751_c1 3300050514 Bacteria 6038
623 nmdc:mga0a205_1518_c1 3300050515 Bacteria 19847
624 nmdc:mga0a205_155992_c1 3300050515 Bacteria 2181
625 nmdc:mga0a205_15732_c1 3300050515 Bacteria 7072
626 nmdc:mga0a205_17096_c1 3300050515 Bacteria 6792
627 nmdc:mga0a205_17404_c1 3300050515 Bacteria 6737
628 nmdc:mga0a205_249984_c1 3300050515 Bacteria 1653
629 nmdc:mga0a205_6409_c1 3300050515 Bacteria 10634
630 nmdc:mga0a205_9077_c1 3300050515 Bacteria 9070
631 nmdc:mga0a205_9892_c1 3300050515 Bacteria 8747
632 nmdc:mga0sz30_418_c1 3300050516 Bacteria 16148
633 Ga0495601_0018629 3300053077 Bacteria 4226
634 Ga0495601_0056456 3300053077 Bacteria 2487
635 Ga0495595_0024540 3300053084 Bacteria 2664
636 Ga0495619_0109556 3300053085 Bacteria 1886
637 Ga0500552_000294 3300053733 Bacteria 4539
638 Ga0501084_0008128 3300054114 Bacteria 8645
639 Ga0501084_0012959 3300054114 Bacteria 6904
640 Ga0501084_0013346 3300054114 Bacteria 6797
641 Ga0501084_0055766 3300054114 Bacteria 3306
642 Ga0501084_0067465 3300054114 Bacteria 2994
643 Ga0587101_003929 3300059623 Unclassified 1552
644 Ga0501082_0003903 3300060353 Bacteria 13024
645 Ga0501082_0006304 3300060353 Bacteria 10290
646 Ga0501082_0074975 3300060353 Bacteria 2914
647 Ga0501082_0142343 3300060353 Bacteria 2081
648 Ga0501082_0302465 3300060353 Bacteria 1393
649 Ga0530510_0005974 3300061734 Bacteria 8445
650 Ga0530510_0025549 3300061734 Bacteria 4224
651 Ga0530510_0038517 3300061734 Bacteria 3452
652 Ga0530510_0079786 3300061734 Bacteria 2381
653 Ga0099795_10009510
654 JGI26128J50194_1000188
655 JGI26141J51220_1000192
656 Ga0058861_11932370
657 Ga0058862_12836770
658 Ga0065715_10092378
659 Ga0065707_10098962
660 Ga0065707_10163033
661 Ga0070683_100203124
662 Ga0070670_100008457
663 Ga0068869_100004156
664 Ga0070666_10139086
665 Ga0070680_100001533
666 Ga0070680_100025302
667 Ga0070682_100005933
668 Ga0070660_100000294
669 Ga0070689_100137496
670 Ga0070691_10003143
671 Ga0070691_10013765
672 Ga0070691_10018967
673 Ga0070691_10021697
674 Ga0070661_100001809
675 Ga0070692_10000718
676 Ga0070669_100038256
677 Ga0070671_100005025
678 Ga0070671_100105042
679 Ga0070673_100096009
680 Ga0070659_100000151
681 Ga0070703_10013725
682 Ga0070709_10006490
683 Ga0070709_10055764
684 Ga0070709_10096722
685 Ga0070714_100066202
686 Ga0070714_100188518
687 Ga0070713_100086332
688 Ga0070710_10014539
689 Ga0070710_10036468
690 Ga0070710_10096519
691 Ga0070701_10023393
692 Ga0070711_100009806
693 Ga0070711_100032726
694 Ga0070705_100000874
695 Ga0070705_100002711
696 Ga0070700_100014943
697 Ga0070700_100177142
698 Ga0070694_100000390
699 Ga0070694_100004310
700 Ga0070694_100014041
701 Ga0070694_100016933
702 Ga0070694_100018195
703 Ga0070694_100028129
704 Ga0070694_100105108
705 Ga0070708_100006096
706 Ga0070708_100007181
707 Ga0070708_100013756
708 Ga0070708_100337815
709 Ga0070708_100347958
710 Ga0070678_100024005
711 Ga0070662_100012111
712 Ga0070681_10004586
713 Ga0070681_10011457
714 Ga0070681_10043348
715 Ga0068867_100001967
716 Ga0070706_100001137
717 Ga0070706_100006516
718 Ga0070706_100027858
719 Ga0070706_100033774
720 Ga0070706_100054138
721 Ga0070706_100057560
722 Ga0070706_100176420
723 Ga0070706_100306040
724 Ga0070706_100351015
725 Ga0070707_100006962
726 Ga0070707_100009939
727 Ga0070707_100038387
728 Ga0070707_100051538
729 Ga0070707_100058068
730 Ga0070707_100185321
731 Ga0070698_100007738
732 Ga0070698_100015254
733 Ga0070698_100044706
734 Ga0070698_100279270
735 Ga0070698_100307768
736 Ga0070698_100324574
737 Ga0070699_100010525
738 Ga0070699_100064562
739 Ga0070699_100080125
740 Ga0070699_100186319
741 Ga0070699_100217154
742 Ga0070679_100001088
743 Ga0070684_100005850
744 Ga0070697_100071630
745 Ga0070697_100103386
746 Ga0070697_100117806
747 Ga0070697_100193012
748 Ga0070697_100217497
749 Ga0070697_100237355
750 Ga0070697_100248506
751 Ga0070697_100273364
752 Ga0068853_100029933
753 Ga0070695_100002358
754 Ga0070695_100013190
755 Ga0070695_100039133
756 Ga0070695_100116244
757 Ga0070696_100001176
758 Ga0070696_100028965
759 Ga0070696_100140234
760 Ga0070693_100000418
761 Ga0070704_100000990
762 Ga0070704_100006089
763 Ga0070704_100015537
764 Ga0070704_100015891
765 Ga0070704_100022768
766 Ga0070704_100133357
767 Ga0068855_100001154
768 Ga0068855_100010490
769 Ga0070664_100027857
770 Ga0068857_100003634
771 Ga0068857_100213379
772 Ga0068854_100005822
773 Ga0068856_100001162
774 Ga0068856_100010253
775 Ga0068856_100252455
776 Ga0068859_100001630
777 Ga0068861_100038377
778 Ga0068861_100067287
779 Ga0068870_10000280
780 Ga0068863_100031188
781 Ga0068863_100365188
782 Ga0068860_100032109
783 Ga0068862_100009378
784 Ga0068862_100030739
785 Ga0081455_10000429
786 Ga0081455_10000614
787 Ga0081455_10059594
788 Ga0081538_10008934
789 Ga0081540_1000439
790 Ga0081540_1006694
791 Ga0081540_1010324
792 Ga0081540_1042107
793 Ga0081540_1053756
794 Ga0081539_10000009
795 Ga0081539_10003370
796 Ga0070717_10037224
797 Ga0070717_10081295
798 Ga0070717_10082992
799 Ga0070717_10123932
800 Ga0070717_10173863
801 Ga0075365_10009014
802 Ga0075365_10106595
803 Ga0075363_100001768
804 Ga0075364_10078025
805 Ga0070715_10014494
806 Ga0070715_10068651
807 Ga0070716_100005122
808 Ga0070716_100039347
809 Ga0070716_100086981
810 Ga0070712_100063920
811 Ga0070712_100098498
812 Ga0070712_100190433
813 Ga0070712_100206548
814 Ga0070712_100207614
815 Ga0075362_10016961
816 Ga0075367_10010976
817 Ga0075369_10003009
818 Ga0075370_10030522
819 Ga0075428_100006217
820 Ga0075428_100023977
821 Ga0075428_100027980
822 Ga0075428_100037436
823 Ga0075428_100086809
824 Ga0075428_100092066
825 Ga0075428_100152416
826 Ga0075428_100228753
827 Ga0075428_100432832
828 Ga0075430_100000036
829 Ga0075430_100016546
830 Ga0075430_100016657
831 Ga0075430_100017473
832 Ga0075430_100152937
833 Ga0075431_100000629
834 Ga0075431_100000714
835 Ga0075431_100006204
836 Ga0075431_100009272
837 Ga0075431_100016995
838 Ga0075431_100034402
839 Ga0075431_100035508
840 Ga0075433_10001697
841 Ga0075433_10003287
842 Ga0075433_10009479
843 Ga0075433_10011281
844 Ga0075433_10016038
845 Ga0075433_10027779
846 Ga0075433_10085100
847 Ga0075433_10250220
848 Ga0075433_10252497
849 Ga0075434_100003287
850 Ga0075434_100006800
851 Ga0075434_100008755
852 Ga0075434_100022580
853 Ga0075434_100054956
854 Ga0075434_100263310
855 Ga0075434_100415914
856 Ga0075429_100000001
857 Ga0075429_100001368
858 Ga0075429_100010885
859 Ga0075429_100020932
860 Ga0075429_100032661
861 Ga0075429_100100553
862 Ga0075429_100214966
863 Ga0075436_100042958
864 Ga0075436_100061850
865 Ga0075436_100062790
866 Ga0075436_100069559
867 Ga0097620_100001630
868 Ga0075435_100001997
869 Ga0075435_100005120
870 Ga0075435_100008181
871 Ga0075435_100009154
872 Ga0075435_100009192
873 Ga0075435_100026975
874 Ga0075435_100039031
875 Ga0075435_100071253
876 Ga0075435_100172336
877 Ga0099794_10000487
878 Ga0099794_10086648
879 Ga0099795_10008810
880 Ga0099795_10023522
881 Ga0099795_10030337
882 Ga0105240_10007999
883 Ga0111539_10002135
884 Ga0111539_10015983
885 Ga0111539_10016701
886 Ga0111539_10026718
887 Ga0111539_10056697
888 Ga0111539_10220953
889 Ga0111539_10232723
890 Ga0111539_10247909
891 Ga0114129_10000322
892 Ga0114129_10002831
893 Ga0114129_10007315
894 Ga0114129_10010340
895 Ga0114129_10010897
896 Ga0114129_10018134
897 Ga0114129_10048367
898 Ga0114129_10055099
899 Ga0114129_10060423
900 Ga0114129_10155772
901 Ga0114129_10204292
902 Ga0114129_10235006
903 Ga0114129_10303008
904 Ga0114129_10340129
905 Ga0114129_10510172
906 Ga0114129_10587045
907 Ga0105243_10037182
908 Ga0105241_10000054
909 Ga0105242_10006067
910 Ga0105242_10018131
911 Ga0105248_10031959
912 Ga0105248_10266746
913 Ga0105238_10242800
914 Ga0105249_10250181
915 Ga0099796_10000554
916 Ga0099796_10017494
917 Ga0105246_10159295
918 Ga0105246_10178903
919 Ga0157373_10001456
920 Ga0157369_10009863
921 Ga0157378_10083998
922 Ga0157378_10084416
923 Ga0157372_10002144
924 Ga0157372_10278494
925 Ga0157375_10260744
926 Ga0182008_10005560
927 Ga0157379_10162769
928 Ga0206356_11142278
929 Ga0213875_10000093
930 Ga0213875_10001013
931 Ga0207697_10069156
932 Ga0207653_10002520
933 Ga0207653_10006469
934 Ga0207692_10050655
935 Ga0207647_10021823
936 Ga0207685_10007298
937 Ga0207699_10003489
938 Ga0207645_10000589
939 Ga0207643_10000014
940 Ga0207684_10000370
941 Ga0207684_10002192
942 Ga0207684_10003860
943 Ga0207684_10006972
944 Ga0207684_10017517
945 Ga0207684_10066963
946 Ga0207684_10110882
947 Ga0207654_10000969
948 Ga0207707_10000138
949 Ga0207707_10052810
950 Ga0207695_10046534
951 Ga0207693_10001346
952 Ga0207693_10003717
953 Ga0207693_10043695
954 Ga0207693_10096764
955 Ga0207693_10152749
956 Ga0207693_10231867
957 Ga0207663_10031912
958 Ga0207663_10086081
959 Ga0207663_10102103
960 Ga0207663_10172723
961 Ga0207660_10000848
962 Ga0207660_10026822
963 Ga0207662_10021513
964 Ga0207657_10000135
965 Ga0207649_10002171
966 Ga0207652_10004011
967 Ga0207646_10000466
968 Ga0207646_10001054
969 Ga0207646_10004703
970 Ga0207646_10007870
971 Ga0207646_10041956
972 Ga0207646_10061179
973 Ga0207650_10032026
974 Ga0207650_10070293
975 Ga0207700_10005378
976 Ga0207700_10156884
977 Ga0207664_10035058
978 Ga0207664_10051285
979 Ga0207664_10055109
980 Ga0207664_10098812
981 Ga0207664_10237139
982 Ga0207644_10076888
983 Ga0207644_10111628
984 Ga0207690_10006221
985 Ga0207706_10002886
986 Ga0207686_10061423
987 Ga0207709_10004526
988 Ga0207665_10005555
989 Ga0207665_10005704
990 Ga0207665_10096390
991 Ga0207689_10000340
992 Ga0207661_10198796
993 Ga0207679_10000212
994 Ga0207667_10000296
995 Ga0207667_10020302
996 Ga0207651_10067759
997 Ga0207640_10002509
998 Ga0207639_10002273
999 Ga0207678_10048334
1000 Ga0207678_10118253
1001 Ga0207708_10022732
1002 Ga0207708_10024700
1003 Ga0207708_10025963
1004 Ga0207702_10001150
1005 Ga0207702_10007137
1006 Ga0207702_10041312
1007 Ga0207702_10261929
1008 Ga0207648_10001239
1009 Ga0207676_10047786
1010 Ga0207674_10000684
1011 Ga0207674_10135326
1012 Ga0207675_100067675
1013 Ga0207675_100140740
1014 Ga0209996_1000295
1015 Ga0209968_1002318
1016 Ga0209999_1000126
1017 Ga0209999_1013651
1018 Ga0209982_1000242
1019 Ga0209970_1001480
1020 Ga0210002_1001838
1021 Ga0209983_1001198
1022 Ga0209588_1000983
1023 Ga0209971_1000010
1024 Ga0209966_1000110
1025 Ga0209998_10000131
1026 Ga0209998_10010084
1027 Ga0209974_10000212
1028 Ga0207428_10000018
1029 Ga0207428_10000119
1030 Ga0207428_10011195
1031 Ga0207428_10061036
1032 Ga0207428_10067671
1033 Ga0207428_10226252
1034 Ga0268265_10011395
1035 Ga0268265_10014769
1036 Ga0268265_10193887
1037 Ga0268264_10039815
1038 Ga0268264_10164858
1039 Ga0265325_10096175
1040 Ga0307408_100058847
1041 Ga0307408_100125451
1042 Ga0307405_10206023
1043 Ga0307411_10080566
1044 Ga0373930_0009288
1045 Ga0373926_0016334
1046 Ga0373952_0016245
1047 Ga0373941_0021723
1048 Ga0373941_0023233
1049 Ga0373945_0011913
1050 Ga0373954_0013823
1051 Ga0373956_0018834
1052 Ga0373956_0026489
1053 Ga0373957_0037120
1054 Ga0373960_0020369
1055 Ga0373960_0035323
1056 Ga0373961_0005083
1057 Ga0373962_0016692
1058 Ga0373931_0000715
1059 Ga0373931_0017701
1060 Ga0373931_0140910
1061 Ga0373933_0004756
1062 Ga0373947_0044903
1063 Ga0373937_0016274
1064 Ga0373937_0021005
1065 Ga0373937_0049264
1066 Ga0373937_0074521
1067 Ga0373925_0031764
1068 Ga0395899_0012087
1069 Ga0395900_0003990
1070 Ga0395898_0025567
1071 Ga0436364_0331623
1072 Ga0436364_0773474
1073 Ga0436364_1258355
1074 Ga0436364_1326053
1075 Ga0395901_0002291
1076 Ga0395901_0056362
1077 Ga0436365_0230297
1078 Ga0436365_0958354
1079 Ga0436365_1194317
1080 Ga0436360_1348286
1081 Ga0436361_0264733
1082 Ga0436363_0441940
1083 Ga0436363_0641214
1084 Ga0436363_1105234
1085 Ga0436362_0080012
1086 Ga0436362_0285804
1087 Ga0436362_0692183
1088 Ga0439441_003743
1089 Ga0439441_015854
1090 Ga0439448_0008866
1091 Ga0439458_0013256
1092 Ga0439459_0000674
1093 Ga0439460_0000053
1094 Ga0451577_0000878
1095 Ga0451577_0006974
1096 Ga0453683_0005279
1097 Ga0453683_0016897
1098 Ga0466963_0072415
1099 Ga0453684_0015335
1100 Ga0453684_0122234
1101 Ga0451576_0007101
1102 Ga0451576_0051473
1103 Ga0451576_0423127
1104 Ga0495592_0144461
1105 Ga0495651_0002772
1106 Ga0495580_0027775
1107 Ga0495580_0094723
1108 Ga0495628_0190858
1109 Ga0495667_0008139
1110 Ga0495667_0083041
1111 Ga0495600_0005206
1112 Ga0496102_0009867
1113 Ga0496102_0099159
1114 Ga0496104_0008978
1115 Ga0496104_0120296
1116 Ga0496105_0090205
1117 Ga0496106_0052068
1118 Ga0496108_0108701
1119 Ga0496108_0270779
1120 Ga0496110_0079813
1121 Ga0496110_0206415
1122 Ga0496111_0146412
1123 Ga0496112_0043901
1124 Ga0496113_0022254
1125 Ga0496113_0197280
1126 Ga0496113_0202048
1127 Ga0496115_0004110
1128 Ga0496115_0092386
1129 Ga0501033_0059149
1130 Ga0501034_0161528
1131 Ga0501039_0050076
1132 Ga0501039_0059694
1133 Ga0501039_0127399
1134 Ga0501040_0025557
1135 Ga0501040_0037944
1136 Ga0501040_0067696
1137 Ga0501040_0123192
1138 Ga0501041_0011746
1139 Ga0501041_0034648
1140 Ga0501041_0086344
1141 Ga0501041_0098733
1142 Ga0501042_0013014
1143 Ga0501042_0021895
1144 Ga0501042_0022559
1145 Ga0501042_0219214
1146 Ga0501046_0000340
1147 Ga0501046_0028185
1148 Ga0501047_0059370
1149 Ga0501048_0004505
1150 Ga0501068_0187371
1151 Ga0501070_0249821
1152 Ga0501071_0043549
1153 Ga0501071_0155197
1154 Ga0501072_0008337
1155 Ga0501072_0050057
1156 Ga0501072_0085116
1157 Ga0501072_0129072
1158 Ga0501072_0130580
1159 Ga0501072_0157583
1160 Ga0501075_0057979
1161 Ga0501075_0059332
1162 Ga0501075_0060507
1163 Ga0501075_0076852
1164 Ga0501075_0096826
1165 Ga0501075_0143215
1166 Ga0501075_0146060
1167 Ga0501075_0164844
1168 Ga0501075_0169618
1169 Ga0501076_0000873
1170 Ga0501076_0004037
1171 Ga0501076_0013676
1172 Ga0501076_0030779
1173 Ga0501076_0032676
1174 Ga0501076_0088759
1175 Ga0501077_0005626
1176 Ga0501077_0041922
1177 Ga0501077_0065705
1178 Ga0501079_0000054
1179 Ga0501079_0002208
1180 Ga0501079_0017702
1181 Ga0501079_0054104
1182 Ga0501079_0097492
1183 Ga0501079_0171728
1184 Ga0501079_0219763
1185 Ga0501080_0216473
1186 Ga0501081_0000414
1187 Ga0501081_0041469
1188 Ga0501081_0082142
1189 Ga0501083_0017683
1190 Ga0501083_0051620
1191 Ga0501083_0116056
1192 Ga0501035_0172805
1193 Ga0501045_0000589
1194 Ga0501045_0006365
1195 Ga0501045_0020631
1196 nmdc:mga03683_19849_c1
1197 nmdc:mga00v17_45837_c1
1198 nmdc:mga0yw44_47894_c1
1199 nmdc:mga06z11_17445_c1
1200 nmdc:mga06z11_68435_c1
1201 nmdc:mga07m45_46673_c1
1202 nmdc:mga05p37_100049_c1
1203 nmdc:mga05p37_114100_c1
1204 nmdc:mga05p37_114141_c1
1205 nmdc:mga05p37_11812_c1
1206 nmdc:mga05p37_149375_c1
1207 nmdc:mga05p37_160629_c1
1208 nmdc:mga05p37_163461_c1
1209 nmdc:mga05p37_178624_c1
1210 nmdc:mga05p37_1865_c1
1211 nmdc:mga05p37_228482_c1
1212 nmdc:mga05p37_34829_c1
1213 nmdc:mga05p37_36075_c1
1214 nmdc:mga05p37_388956_c1
1215 nmdc:mga05p37_5490_c1
1216 nmdc:mga05p37_65119_c1
1217 nmdc:mga05p37_84747_c1
1218 nmdc:mga09592_124416_c1
1219 nmdc:mga09592_19211_c1
1220 nmdc:mga09592_26083_c1
1221 nmdc:mga09592_30261_c1
1222 nmdc:mga09592_35170_c1
1223 nmdc:mga09592_40517_c1
1224 nmdc:mga09592_66_c1
1225 nmdc:mga09592_80560_c1
1226 nmdc:mga09592_86185_c1
1227 nmdc:mga0qj67_10633_c1
1228 nmdc:mga0qj67_143630_c1
1229 nmdc:mga0qj67_15838_c1
1230 nmdc:mga0qj67_32076_c1
1231 nmdc:mga0qj67_4200_c1
1232 nmdc:mga0qj67_528_c1
1233 nmdc:mga0qj67_8409_c1
1234 nmdc:mga06r32_242077_c1
1235 nmdc:mga06r32_2588_c1
1236 nmdc:mga06r32_43191_c1
1237 nmdc:mga06r32_4700_c1
1238 nmdc:mga06r32_54094_c1
1239 nmdc:mga06r32_6269_c1
1240 nmdc:mga06r32_69457_c1
1241 nmdc:mga06r32_84373_c1
1242 nmdc:mga06r32_94036_c1
1243 nmdc:mga08y16_108437_c1
1244 nmdc:mga08y16_113308_c1
1245 nmdc:mga08y16_1288_c1
1246 nmdc:mga08y16_42135_c1
1247 nmdc:mga08y16_47598_c1
1248 nmdc:mga08y16_67326_c1
1249 nmdc:mga0n895_201928_c1
1250 nmdc:mga0n895_225895_c1
1251 nmdc:mga0n895_271149_c1
1252 nmdc:mga0n895_27826_c1
1253 nmdc:mga0n895_44044_c1
1254 nmdc:mga0n895_55226_c1
1255 nmdc:mga0n895_70965_c1
1256 nmdc:mga0n895_80001_c1
1257 nmdc:mga0n895_9374_c1
1258 nmdc:mga0n895_9734_c1
1259 nmdc:mga0n895_97415_c1
1260 nmdc:mga0rr50_130054_c1
1261 nmdc:mga0rr50_145517_c1
1262 nmdc:mga0rr50_23017_c1
1263 nmdc:mga0rr50_253739_c1
1264 nmdc:mga0rr50_28956_c1
1265 nmdc:mga0rr50_45061_c1
1266 nmdc:mga0rr50_47199_c1
1267 nmdc:mga0rr50_5944_c1
1268 nmdc:mga0rr50_60585_c1
1269 nmdc:mga0rr50_69508_c1
1270 nmdc:mga0rr50_72972_c1
1271 nmdc:mga0rr50_8215_c1
1272 nmdc:mga08x19_30996_c1
1273 nmdc:mga08x19_75213_c1
1274 nmdc:mga08x19_8751_c1
1275 nmdc:mga0a205_1518_c1
1276 nmdc:mga0a205_155992_c1
1277 nmdc:mga0a205_15732_c1
1278 nmdc:mga0a205_17096_c1
1279 nmdc:mga0a205_17404_c1
1280 nmdc:mga0a205_249984_c1
1281 nmdc:mga0a205_6409_c1
1282 nmdc:mga0a205_9077_c1
1283 nmdc:mga0a205_9892_c1
1284 nmdc:mga0sz30_418_c1
1285 Ga0495601_0018629
1286 Ga0495601_0056456
1287 Ga0495595_0024540
1288 Ga0495619_0109556
1289 Ga0500552_000294
1290 Ga0501084_0008128
1291 Ga0501084_0012959
1292 Ga0501084_0013346
1293 Ga0501084_0055766
1294 Ga0501084_0067465
1295 Ga0587101_003929
1296 Ga0501082_0003903
1297 Ga0501082_0006304
1298 Ga0501082_0074975
1299 Ga0501082_0142343
1300 Ga0501082_0302465
1301 Ga0530510_0005974
1302 Ga0530510_0025549
1303 Ga0530510_0038517
1304 Ga0530510_0079786

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

60

419

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ru0-assembly2.cif.gz_B the crystal structure of abc transporter permease from pseudomonas fluorescens group 0.9058 25 406
3eaf-assembly1.cif.gz_A crystal structure of abc transporter, substrate binding protein aeropyrum pernix 0.855 25 408
3lkb-assembly1.cif.gz_A crystal structure of a branched chain amino acid abc transporter from thermus thermophilus with bound valine 0.85 25 403
4ru0-assembly2.cif.gz_B the crystal structure of abc transporter permease from pseudomonas fluorescens group 0.849 25 406
3eaf-assembly1.cif.gz_A crystal structure of abc transporter, substrate binding protein aeropyrum pernix 0.8487 25 408
ID Description Score Start End Superfamily
3sg0A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.855 148 278 3.40.50.2300
3lkbB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8338 143 403 3.40.50.2300
1usiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8326 147 276 3.40.50.2300
4nqrA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8315 143 278 3.40.50.2300
4jb2A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8307 148 277 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V6UW34-F1-model_v4 Leucine-binding protein domain-containing protein 0.9655 21 289
AF-A0A529P6M4-F1-model_v4 ABC transporter permease 0.9488 21 407
AF-A0A356QZT0-F1-model_v4 ABC transporter permease 0.941 21 380
AF-A0A3C1IKB3-F1-model_v4 ABC transporter permease 0.9408 26 406
AF-I3V2Y9-F1-model_v4 Branched-chain amino acid ABC transporter periplasmic component-like protein 0.9389 21 405

Map