F474077

General Info

Members Datasets Scaffolds Average Seq Length
670 320 1340 140

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10660660|Ga0105243_106606602
Length 166
Sequence MTFAGADETSRNKDQLNSMSTKKENRFIQPYLFFNGRCEEAVEFYRKALGAEVEIMMRFKDSPEPHQPGMVPPGFENKIMHTSFHIGETTVMASDGCSAEKPSFQGFSLSLSVPSESEADRAFAALAEAGQVRMPLTKTFWSPRFGMVADRFGIGWMITVPPAGQN

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
182 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
183 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
184 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
185 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
186 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
189 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
198 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
199 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
213 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
236 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
252 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
253 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
310 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
311 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 0.75
Rhizosphere 97.91
Stem 0
Stem Tuber 0
Unclassified 8.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10660660 3300009148 Bacteria 1014
2 SwRhRL2b_contig_3656236 2162886007 Bacteria 944
3 MBSR1b_contig_13185514 2162886012 Bacteria 866
4 JGI24033J26618_1027880 3300002155 Bacteria 749
5 rootH2_10179150 3300003320 Unclassified 1123
6 Ga0065714_10282279 3300005288 Bacteria 721
7 Ga0065704_10137463 3300005289 Bacteria 1552
8 Ga0065707_10097886 3300005295 Bacteria 3132
9 Ga0070658_11985808 3300005327 Unclassified 502
10 Ga0070676_10006697 3300005328 Bacteria 6173
11 Ga0070676_10460829 3300005328 Bacteria 896
12 Ga0070683_100057726 3300005329 Bacteria 3606
13 Ga0070683_100670578 3300005329 Bacteria 993
14 Ga0070683_101492597 3300005329 Bacteria 650
15 Ga0070690_100103505 3300005330 Bacteria 1890
16 Ga0070690_100673285 3300005330 Bacteria 792
17 Ga0070690_100770067 3300005330 Unclassified 744
18 Ga0070670_100254993 3300005331 Bacteria 1529
19 Ga0070670_100446621 3300005331 Bacteria 1145
20 Ga0070677_10005945 3300005333 Bacteria 4044
21 Ga0070677_10245231 3300005333 Bacteria 886
22 Ga0068869_100006593 3300005334 Bacteria 7367
23 Ga0070666_10021060 3300005335 Bacteria 4222
24 Ga0070680_100307228 3300005336 Bacteria 1345
25 Ga0070680_101132707 3300005336 Unclassified 676
26 Ga0068868_100051356 3300005338 Bacteria 3243
27 Ga0068868_100454666 3300005338 Bacteria 1114
28 Ga0068868_100996147 3300005338 Bacteria 766
29 Ga0068868_102013559 3300005338 Bacteria 548
30 Ga0070689_100104977 3300005340 Bacteria 2240
31 Ga0070689_100502165 3300005340 Bacteria 1039
32 Ga0070689_101337257 3300005340 Unclassified 646
33 Ga0070691_10011578 3300005341 Bacteria 4031
34 Ga0070687_100451693 3300005343 Bacteria 855
35 Ga0070687_100600573 3300005343 Bacteria 756
36 Ga0070692_10062733 3300005345 Bacteria 1962
37 Ga0070692_10548203 3300005345 Bacteria 757
38 Ga0070668_101279098 3300005347 Unclassified 666
39 Ga0070669_100171774 3300005353 Bacteria 1690
40 Ga0070669_100284802 3300005353 Bacteria 1325
41 Ga0070675_100191262 3300005354 Bacteria 1773
42 Ga0070675_100517451 3300005354 Bacteria 1076
43 Ga0070675_102000350 3300005354 Unclassified 534
44 Ga0070671_100028460 3300005355 Bacteria 4602
45 Ga0070671_100075823 3300005355 Bacteria 2810
46 Ga0070671_100255328 3300005355 Bacteria 1489
47 Ga0070671_100761636 3300005355 Bacteria 842
48 Ga0070674_100113001 3300005356 Bacteria 1997
49 Ga0070674_100113445 3300005356 Bacteria 1994
50 Ga0070673_100465860 3300005364 Bacteria 1138
51 Ga0070688_100269385 3300005365 Bacteria 1219
52 Ga0070688_101673864 3300005365 Bacteria 520
53 Ga0070659_101128373 3300005366 Bacteria 692
54 Ga0070667_100280869 3300005367 Bacteria 1495
55 Ga0070667_100737629 3300005367 Bacteria 913
56 Ga0070667_101257158 3300005367 Bacteria 693
57 Ga0070703_10129479 3300005406 Bacteria 925
58 Ga0070709_10455873 3300005434 Bacteria 964
59 Ga0070709_10813712 3300005434 Bacteria 734
60 Ga0070714_100004720 3300005435 Bacteria 10309
61 Ga0070714_100191167 3300005435 Bacteria 1868
62 Ga0070714_100956092 3300005435 Unclassified 833
63 Ga0070714_101262542 3300005435 Bacteria 721
64 Ga0070713_100713031 3300005436 Unclassified 958
65 Ga0070713_101811134 3300005436 Bacteria 592
66 Ga0070710_10076220 3300005437 Bacteria 1946
67 Ga0070701_10577749 3300005438 Unclassified 741
68 Ga0070701_10584205 3300005438 Bacteria 737
69 Ga0070711_100160343 3300005439 Bacteria 1705
70 Ga0070705_100015637 3300005440 Bacteria 3927
71 Ga0070700_100251410 3300005441 Bacteria 1268
72 Ga0070700_100302460 3300005441 Bacteria 1168
73 Ga0070694_100796156 3300005444 Unclassified 775
74 Ga0070708_100041235 3300005445 Bacteria 4047
75 Ga0070708_100341698 3300005445 Bacteria 1411
76 Ga0070708_100750149 3300005445 Bacteria 918
77 Ga0070663_100711116 3300005455 Bacteria 855
78 Ga0070678_100134872 3300005456 Bacteria 1967
79 Ga0070678_100349560 3300005456 Bacteria 1271
80 Ga0070678_101315180 3300005456 Bacteria 673
81 Ga0070662_100169171 3300005457 Bacteria 1715
82 Ga0070662_100228439 3300005457 Bacteria 1488
83 Ga0070662_100252671 3300005457 Bacteria 1418
84 Ga0070681_10099661 3300005458 Bacteria 2851
85 Ga0070681_10545646 3300005458 Bacteria 1073
86 Ga0070681_10972983 3300005458 Bacteria 768
87 Ga0068867_100039383 3300005459 Bacteria 3446
88 Ga0068867_100120300 3300005459 Bacteria 2029
89 Ga0068867_100162813 3300005459 Bacteria 1760
90 Ga0070685_10247387 3300005466 Bacteria 1179
91 Ga0070706_100108905 3300005467 Bacteria 2577
92 Ga0070706_100154369 3300005467 Bacteria 2143
93 Ga0070707_100029338 3300005468 Bacteria 5238
94 Ga0070707_100082110 3300005468 Bacteria 3112
95 Ga0070707_101571094 3300005468 Bacteria 625
96 Ga0070698_100010681 3300005471 Bacteria 9783
97 Ga0070698_100407519 3300005471 Bacteria 1293
98 Ga0070698_100605363 3300005471 Bacteria 1036
99 Ga0070699_100801640 3300005518 Unclassified 862
100 Ga0070679_100289260 3300005530 Bacteria 1590
101 Ga0070679_100442045 3300005530 Bacteria 1245
102 Ga0070684_101413003 3300005535 Unclassified 655
103 Ga0070697_100048365 3300005536 Bacteria 3448
104 Ga0070697_100476468 3300005536 Bacteria 1090
105 Ga0068853_101518488 3300005539 Bacteria 649
106 Ga0070672_100042667 3300005543 Bacteria 3493
107 Ga0070672_100064861 3300005543 Bacteria 2887
108 Ga0070686_100049183 3300005544 Bacteria 2674
109 Ga0070695_100689810 3300005545 Bacteria 810
110 Ga0070695_101092125 3300005545 Bacteria 652
111 Ga0070696_100405936 3300005546 Bacteria 1067
112 Ga0070696_100496446 3300005546 Bacteria 970
113 Ga0070696_100560636 3300005546 Bacteria 916
114 Ga0070693_100154340 3300005547 Bacteria 1457
115 Ga0070693_100665073 3300005547 Bacteria 759
116 Ga0070665_100000213 3300005548 Bacteria 100019
117 Ga0070665_100224024 3300005548 Bacteria 1881
118 Ga0070665_100270395 3300005548 Unclassified 1701
119 Ga0070665_100581028 3300005548 Unclassified 1133
120 Ga0070704_100122532 3300005549 Bacteria 2000
121 Ga0070704_100165672 3300005549 Bacteria 1752
122 Ga0070704_100845743 3300005549 Unclassified 820
123 Ga0068855_100416113 3300005563 Bacteria 1471
124 Ga0068855_101117399 3300005563 Bacteria 823
125 Ga0070664_100354320 3300005564 Bacteria 1336
126 Ga0070664_100785045 3300005564 Unclassified 890
127 Ga0068857_101221424 3300005577 Bacteria 728
128 Ga0068854_101520972 3300005578 Bacteria 608
129 Ga0068856_100046850 3300005614 Bacteria 4258
130 Ga0070702_100009578 3300005615 Bacteria 4748
131 Ga0068852_100468748 3300005616 Bacteria 1250
132 Ga0068852_101723331 3300005616 Bacteria 649
133 Ga0068859_100065189 3300005617 Bacteria 3677
134 Ga0068859_100399868 3300005617 Bacteria 1470
135 Ga0068859_100520746 3300005617 Bacteria 1284
136 Ga0068864_100129379 3300005618 Bacteria 2266
137 Ga0068864_100570896 3300005618 Bacteria 1095
138 Ga0068866_10262125 3300005718 Bacteria 1063
139 Ga0068866_11044219 3300005718 Bacteria 583
140 Ga0068866_11147425 3300005718 Bacteria 559
141 Ga0068861_100093020 3300005719 Bacteria 2383
142 Ga0068851_10692184 3300005834 Bacteria 627
143 Ga0068851_10859940 3300005834 Bacteria 566
144 Ga0068870_10084739 3300005840 Bacteria 1760
145 Ga0068863_100008248 3300005841 Bacteria 10178
146 Ga0068863_100059673 3300005841 Bacteria 3609
147 Ga0068863_102259039 3300005841 Bacteria 554
148 Ga0068858_100050595 3300005842 Bacteria 3845
149 Ga0068860_100065520 3300005843 Bacteria 3450
150 Ga0068862_100324760 3300005844 Bacteria 1421
151 Ga0068862_101102400 3300005844 Bacteria 789
152 Ga0068862_101252450 3300005844 Unclassified 742
153 Ga0081455_10001038 3300005937 Bacteria 35067
154 Ga0081455_10254376 3300005937 Bacteria 1283
155 Ga0081538_10005463 3300005981 Bacteria 11415
156 Ga0081538_10021530 3300005981 Bacteria 4701
157 Ga0081538_10335284 3300005981 Bacteria 549
158 Ga0081540_1138026 3300005983 Bacteria 984
159 Ga0070717_10021015 3300006028 Bacteria 5142
160 Ga0075363_100308751 3300006048 Bacteria 919
161 Ga0070716_100063940 3300006173 Bacteria 2138
162 Ga0075362_10253828 3300006177 Bacteria 865
163 Ga0075427_10025225 3300006194 Bacteria 958
164 Ga0075366_10026233 3300006195 Bacteria 3411
165 Ga0075366_10074178 3300006195 Bacteria 2028
166 Ga0097621_100107358 3300006237 Bacteria 2356
167 Ga0097621_100622818 3300006237 Bacteria 988
168 Ga0068871_100890579 3300006358 Bacteria 824
169 Ga0075428_100033970 3300006844 Bacteria 5627
170 Ga0075428_100146614 3300006844 Bacteria 2565
171 Ga0075428_100333119 3300006844 Bacteria 1630
172 Ga0075428_100879519 3300006844 Bacteria 951
173 Ga0075428_101163997 3300006844 Bacteria 813
174 Ga0075428_101836071 3300006844 Bacteria 630
175 Ga0075430_100034821 3300006846 Bacteria 4274
176 Ga0075430_100086200 3300006846 Bacteria 2629
177 Ga0075430_100104588 3300006846 Bacteria 2363
178 Ga0075431_100004030 3300006847 Bacteria 14308
179 Ga0075431_100021493 3300006847 Bacteria 6600
180 Ga0075431_100716502 3300006847 Bacteria 977
181 Ga0075431_101231338 3300006847 Bacteria 711
182 Ga0075433_10000563 3300006852 Bacteria 24441
183 Ga0075433_10335548 3300006852 Bacteria 1336
184 Ga0075433_10344199 3300006852 Bacteria 1318
185 Ga0075433_11686332 3300006852 Bacteria 546
186 Ga0075434_100007123 3300006871 Bacteria 10331
187 Ga0075434_100027156 3300006871 Bacteria 5617
188 Ga0075434_100176498 3300006871 Bacteria 2156
189 Ga0075434_100686298 3300006871 Bacteria 1042
190 Ga0075434_100901216 3300006871 Bacteria 899
191 Ga0075429_100028261 3300006880 Bacteria 4870
192 Ga0075429_101109440 3300006880 Bacteria 691
193 Ga0075429_101337146 3300006880 Bacteria 624
194 Ga0075429_101360632 3300006880 Unclassified 619
195 Ga0075429_101615048 3300006880 Bacteria 563
196 Ga0068865_100056205 3300006881 Bacteria 2741
197 Ga0068865_100082112 3300006881 Bacteria 2316
198 Ga0068865_101395657 3300006881 Unclassified 625
199 Ga0075436_100086008 3300006914 Bacteria 2183
200 Ga0075436_100192897 3300006914 Bacteria 1442
201 Ga0075436_100284912 3300006914 Bacteria 1182
202 Ga0097620_100065193 3300006931 Bacteria 3677
203 Ga0097620_100399868 3300006931 Bacteria 1470
204 Ga0097620_100520704 3300006931 Bacteria 1284
205 Ga0075435_100074197 3300007076 Bacteria 2782
206 Ga0075435_100136640 3300007076 Bacteria 2054
207 Ga0075435_100153599 3300007076 Bacteria 1936
208 Ga0105240_10527188 3300009093 Bacteria 1310
209 Ga0111539_10152367 3300009094 Bacteria 2706
210 Ga0111539_10448084 3300009094 Unclassified 1503
211 Ga0111539_10506146 3300009094 Bacteria 1407
212 Ga0111539_11064073 3300009094 Bacteria 940
213 Ga0111539_12854796 3300009094 Bacteria 559
214 Ga0105245_10353838 3300009098 Bacteria 1456
215 Ga0105245_11854281 3300009098 Unclassified 656
216 Ga0105247_10293878 3300009101 Bacteria 1125
217 Ga0105247_11414443 3300009101 Bacteria 563
218 Ga0114129_10001057 3300009147 Bacteria 36115
219 Ga0114129_10002853 3300009147 Bacteria 24169
220 Ga0114129_10064442 3300009147 Bacteria 5114
221 Ga0114129_10389415 3300009147 Bacteria 1839
222 Ga0114129_10833197 3300009147 Bacteria 1174
223 Ga0114129_11334113 3300009147 Bacteria 888
224 Ga0114129_11398260 3300009147 Bacteria 863
225 Ga0114129_11604281 3300009147 Bacteria 796
226 Ga0114129_12128998 3300009147 Bacteria 676
227 Ga0114129_12283945 3300009147 Unclassified 650
228 Ga0114129_13108299 3300009147 Bacteria 542
229 Ga0105243_10302239 3300009148 Bacteria 1451
230 Ga0105241_10965480 3300009174 Bacteria 795
231 Ga0105242_10124258 3300009176 Bacteria 2219
232 Ga0105242_10182571 3300009176 Bacteria 1852
233 Ga0105248_10011418 3300009177 Bacteria 9789
234 Ga0105248_10105975 3300009177 Bacteria 3170
235 Ga0105238_10018245 3300009551 Bacteria 7137
236 Ga0105249_10118923 3300009553 Bacteria 2509
237 Ga0105249_10189724 3300009553 Bacteria 2005
238 Ga0105249_12300166 3300009553 Bacteria 612
239 Ga0099796_10080296 3300010159 Bacteria 1195
240 Ga0099796_10299585 3300010159 Bacteria 681
241 Ga0105239_10160510 3300010375 Bacteria 2511
242 Ga0105239_11120665 3300010375 Bacteria 906
243 Ga0105239_12367018 3300010375 Bacteria 618
244 Ga0105246_10070025 3300011119 Bacteria 2466
245 Ga0105246_10237977 3300011119 Bacteria 1438
246 Ga0105246_11284024 3300011119 Bacteria 678
247 Ga0157370_10138398 3300013104 Bacteria 2268
248 Ga0157369_10125280 3300013105 Bacteria 2724
249 Ga0157374_10165330 3300013296 Bacteria 2156
250 Ga0157374_10210725 3300013296 Bacteria 1905
251 Ga0157374_10225191 3300013296 Bacteria 1841
252 Ga0157374_10438900 3300013296 Bacteria 1306
253 Ga0157378_10030129 3300013297 Bacteria 4794
254 Ga0157378_10113850 3300013297 Bacteria 2484
255 Ga0157378_10847352 3300013297 Bacteria 942
256 Ga0157372_10013791 3300013307 Bacteria 8636
257 Ga0157372_10105472 3300013307 Bacteria 3223
258 Ga0157375_10000111 3300013308 Bacteria 79589
259 Ga0157375_10048135 3300013308 Bacteria 4168
260 Ga0157375_10078285 3300013308 Bacteria 3338
261 Ga0157375_10117523 3300013308 Bacteria 2765
262 Ga0157375_10493520 3300013308 Bacteria 1389
263 Ga0157375_13247026 3300013308 Unclassified 542
264 Ga0163163_10789135 3300014325 Bacteria 1013
265 Ga0163163_11189296 3300014325 Bacteria 825
266 Ga0157379_10015814 3300014968 Bacteria 6630
267 Ga0157379_10457428 3300014968 Bacteria 1179
268 Ga0157376_10449346 3300014969 Bacteria 1257
269 Ga0163161_10405754 3300017792 Bacteria 1094
270 Ga0163161_10451046 3300017792 Bacteria 1040
271 Ga0207697_10324372 3300025315 Bacteria 683
272 Ga0207656_10564555 3300025321 Bacteria 580
273 Ga0207682_10056075 3300025893 Bacteria 1640
274 Ga0207688_10010225 3300025901 Bacteria 5108
275 Ga0207680_10010143 3300025903 Bacteria 4701
276 Ga0207685_10201061 3300025905 Bacteria 936
277 Ga0207685_10438866 3300025905 Bacteria 677
278 Ga0207645_10004849 3300025907 Bacteria 9876
279 Ga0207643_10060709 3300025908 Bacteria 2159
280 Ga0207643_10093008 3300025908 Bacteria 1760
281 Ga0207684_10099871 3300025910 Bacteria 2479
282 Ga0207684_10153184 3300025910 Bacteria 1984
283 Ga0207684_10490460 3300025910 Bacteria 1053
284 Ga0207684_11356458 3300025910 Unclassified 584
285 Ga0207654_10747114 3300025911 Bacteria 705
286 Ga0207707_10285019 3300025912 Bacteria 1430
287 Ga0207695_10046527 3300025913 Bacteria 4599
288 Ga0207693_10062934 3300025915 Bacteria 2907
289 Ga0207660_10277645 3300025917 Bacteria 1329
290 Ga0207662_10277776 3300025918 Bacteria 1107
291 Ga0207662_10728406 3300025918 Bacteria 696
292 Ga0207662_10911090 3300025918 Bacteria 623
293 Ga0207649_11621418 3300025920 Bacteria 512
294 Ga0207652_10370143 3300025921 Bacteria 1293
295 Ga0207646_10040212 3300025922 Bacteria 4206
296 Ga0207646_10065229 3300025922 Bacteria 3251
297 Ga0207646_11251808 3300025922 Bacteria 649
298 Ga0207694_10053367 3300025924 Bacteria 3134
299 Ga0207650_10003791 3300025925 Bacteria 10339
300 Ga0207650_10126538 3300025925 Bacteria 1995
301 Ga0207659_10038703 3300025926 Bacteria 3319
302 Ga0207659_10155406 3300025926 Bacteria 1790
303 Ga0207659_10265962 3300025926 Bacteria 1397
304 Ga0207687_10364018 3300025927 Bacteria 1181
305 Ga0207687_11272338 3300025927 Unclassified 632
306 Ga0207700_11011003 3300025928 Unclassified 744
307 Ga0207664_10003657 3300025929 Bacteria 10301
308 Ga0207664_10451878 3300025929 Bacteria 1147
309 Ga0207664_11091830 3300025929 Bacteria 713
310 Ga0207644_10014819 3300025931 Bacteria 5226
311 Ga0207644_10054631 3300025931 Bacteria 2877
312 Ga0207644_10074166 3300025931 Bacteria 2497
313 Ga0207706_10350969 3300025933 Bacteria 1283
314 Ga0207706_10504641 3300025933 Bacteria 1044
315 Ga0207686_10004561 3300025934 Bacteria 7423
316 Ga0207670_10116145 3300025936 Unclassified 1937
317 Ga0207670_10352971 3300025936 Bacteria 1165
318 Ga0207670_11943425 3300025936 Bacteria 500
319 Ga0207669_10155085 3300025937 Bacteria 1609
320 Ga0207669_10297584 3300025937 Bacteria 1225
321 Ga0207704_10010162 3300025938 Bacteria 4576
322 Ga0207704_10248624 3300025938 Bacteria 1333
323 Ga0207665_10386809 3300025939 Bacteria 1063
324 Ga0207691_10045532 3300025940 Bacteria 4032
325 Ga0207691_10103612 3300025940 Bacteria 2537
326 Ga0207691_10407093 3300025940 Bacteria 1160
327 Ga0207711_10011139 3300025941 Bacteria 7473
328 Ga0207711_10473394 3300025941 Bacteria 1167
329 Ga0207689_10086096 3300025942 Bacteria 2583
330 Ga0207661_10041605 3300025944 Bacteria 3618
331 Ga0207661_10170911 3300025944 Bacteria 1892
332 Ga0207661_10861483 3300025944 Bacteria 834
333 Ga0207679_10807060 3300025945 Bacteria 856
334 Ga0207651_10361960 3300025960 Bacteria 1224
335 Ga0207651_10369113 3300025960 Bacteria 1213
336 Ga0207712_10242359 3300025961 Bacteria 1453
337 Ga0207712_11718799 3300025961 Bacteria 562
338 Ga0207668_11247361 3300025972 Bacteria 669
339 Ga0207640_10922796 3300025981 Bacteria 764
340 Ga0207658_10039086 3300025986 Bacteria 3422
341 Ga0207658_10146762 3300025986 Bacteria 1917
342 Ga0207658_10680917 3300025986 Bacteria 928
343 Ga0207658_11366225 3300025986 Bacteria 648
344 Ga0207658_11868426 3300025986 Bacteria 547
345 Ga0207677_10036461 3300026023 Bacteria 3205
346 Ga0207677_10497984 3300026023 Bacteria 1053
347 Ga0207677_11386508 3300026023 Bacteria 647
348 Ga0207703_10617354 3300026035 Bacteria 1026
349 Ga0207678_10227492 3300026067 Bacteria 1597
350 Ga0207678_10913400 3300026067 Unclassified 776
351 Ga0207678_11165037 3300026067 Bacteria 682
352 Ga0207708_10054534 3300026075 Bacteria 3048
353 Ga0207708_10149509 3300026075 Bacteria 1837
354 Ga0207702_10135629 3300026078 Bacteria 2220
355 Ga0207641_10015592 3300026088 Bacteria 6228
356 Ga0207641_10037704 3300026088 Bacteria 4038
357 Ga0207641_10040804 3300026088 Bacteria 3888
358 Ga0207648_10020832 3300026089 Bacteria 5903
359 Ga0207648_10050253 3300026089 Bacteria 3646
360 Ga0207648_10095534 3300026089 Bacteria 2600
361 Ga0207676_10002193 3300026095 Bacteria 14076
362 Ga0207676_10461096 3300026095 Bacteria 1200
363 Ga0207676_10519004 3300026095 Bacteria 1134
364 Ga0207676_10782828 3300026095 Bacteria 929
365 Ga0207675_100458575 3300026118 Bacteria 1264
366 Ga0207683_10009965 3300026121 Bacteria 8107
367 Ga0207683_10498849 3300026121 Bacteria 1124
368 Ga0207683_10766097 3300026121 Bacteria 895
369 Ga0207698_11121233 3300026142 Bacteria 800
370 Ga0207698_11199623 3300026142 Bacteria 773
371 Ga0207698_11904645 3300026142 Bacteria 609
372 Ga0207428_10497186 3300027907 Bacteria 886
373 Ga0207428_10619363 3300027907 Bacteria 779
374 Ga0268266_10000235 3300028379 Bacteria 94600
375 Ga0268266_10095516 3300028379 Bacteria 2611
376 Ga0268266_10228718 3300028379 Unclassified 1712
377 Ga0268266_10356960 3300028379 Bacteria 1375
378 Ga0268266_10397223 3300028379 Bacteria 1303
379 Ga0268266_10404554 3300028379 Bacteria 1291
380 Ga0268266_11949731 3300028379 Bacteria 561
381 Ga0268265_10754321 3300028380 Unclassified 945
382 Ga0268265_11062208 3300028380 Unclassified 802
383 Ga0268264_10189181 3300028381 Bacteria 1875
384 Ga0268264_11839185 3300028381 Bacteria 616
385 Ga0265334_10099086 3300028573 Bacteria 1057
386 Ga0265318_10030913 3300028577 Bacteria 2080
387 Ga0265323_10012238 3300028653 Bacteria 3446
388 Ga0265336_10147173 3300028666 Bacteria 701
389 Ga0265338_10003888 3300028800 Bacteria 20654
390 Ga0265338_10006496 3300028800 Bacteria 14868
391 Ga0265338_10031473 3300028800 Bacteria 5201
392 Ga0265338_10231801 3300028800 Unclassified 1373
393 Ga0265338_10237743 3300028800 Bacteria 1351
394 Ga0265338_10822887 3300028800 Bacteria 635
395 Ga0265330_10008764 3300031235 Bacteria 4847
396 Ga0265332_10073987 3300031238 Bacteria 1449
397 Ga0265328_10004615 3300031239 Bacteria 5965
398 Ga0265328_10005251 3300031239 Bacteria 5562
399 Ga0265320_10091412 3300031240 Bacteria 1409
400 Ga0265325_10004125 3300031241 Bacteria 9241
401 Ga0265329_10073748 3300031242 Bacteria 1080
402 Ga0265339_10003464 3300031249 Bacteria 11037
403 Ga0265339_10183160 3300031249 Bacteria 1042
404 Ga0265339_10324857 3300031249 Bacteria 729
405 Ga0265331_10001550 3300031250 Bacteria 16851
406 Ga0265331_10013174 3300031250 Bacteria 4452
407 Ga0265327_10098150 3300031251 Bacteria 1418
408 Ga0265327_10139810 3300031251 Bacteria 1132
409 Ga0265316_10104668 3300031344 Bacteria 2148
410 Ga0265316_10171011 3300031344 Bacteria 1621
411 Ga0307408_100237898 3300031548 Bacteria 1495
412 Ga0307408_100676921 3300031548 Bacteria 925
413 Ga0265313_10003585 3300031595 Bacteria 12487
414 Ga0265313_10017323 3300031595 Bacteria 4100
415 Ga0307508_10000191 3300031616 Bacteria 74025
416 Ga0316575_10079749 3300031665 Bacteria 1320
417 Ga0265314_10000948 3300031711 Bacteria 34109
418 Ga0265342_10033300 3300031712 Bacteria 3169
419 Ga0265342_10060308 3300031712 Bacteria 2237
420 Ga0265342_10080744 3300031712 Bacteria 1879
421 Ga0307405_10013515 3300031731 Bacteria 4358
422 Ga0307410_10121511 3300031852 Bacteria 1905
423 Ga0307406_10016265 3300031901 Bacteria 4321
424 Ga0307407_10073603 3300031903 Bacteria 2042
425 Ga0307412_12283486 3300031911 Bacteria 505
426 Ga0307409_100090527 3300031995 Bacteria 2505
427 Ga0307409_100223826 3300031995 Bacteria 1700
428 Ga0307416_100021690 3300032002 Bacteria 4618
429 Ga0307416_100072122 3300032002 Bacteria 2873
430 Ga0307416_102103371 3300032002 Bacteria 666
431 Ga0307414_10358594 3300032004 Bacteria 1254
432 Ga0307411_10069496 3300032005 Bacteria 2379
433 Ga0307415_100023898 3300032126 Bacteria 3805
434 Ga0307415_102317834 3300032126 Bacteria 527
435 Ga0373958_0122844 3300034819 Bacteria 629
436 Ga0373926_0221978 3300035083 Bacteria 730
437 Ga0373923_0286571 3300035111 Bacteria 777
438 Ga0373923_0352098 3300035111 Bacteria 703
439 Ga0373936_0047766 3300035113 Bacteria 1727
440 Ga0373939_0059637 3300035114 Bacteria 1211
441 Ga0373945_0255923 3300035116 Unclassified 740
442 Ga0373953_0242552 3300035117 Bacteria 782
443 Ga0373954_0034522 3300035118 Unclassified 2343
444 Ga0373956_0021865 3300035119 Bacteria 2731
445 Ga0373946_0080081 3300035171 Bacteria 1428
446 Ga0373946_0359939 3300035171 Unclassified 729
447 Ga0373955_0211557 3300035172 Unclassified 1156
448 Ga0373924_0099196 3300035410 Bacteria 1252
449 Ga0373924_0404555 3300035410 Unclassified 610
450 Ga0373935_0017087 3300035692 Bacteria 4395
451 Ga0373935_0145270 3300035692 Bacteria 1605
452 Ga0373927_0023279 3300035695 Bacteria 4057
453 Ga0373927_1010937 3300035695 Unclassified 548
454 Ga0373933_0056585 3300035724 Bacteria 2355
455 Ga0373947_0006717 3300035725 Bacteria 6674
456 Ga0373947_0357300 3300035725 Bacteria 981
457 Ga0373947_1262779 3300035725 Bacteria 503
458 Ga0373937_0082838 3300036401 Bacteria 2968
459 Ga0373937_0198114 3300036401 Bacteria 1888
460 Ga0373937_0377890 3300036401 Bacteria 1343
461 Ga0373937_1136852 3300036401 Bacteria 730
462 Ga0373937_1483469 3300036401 Unclassified 626
463 Ga0373925_0002783 3300037068 Bacteria 13812
464 Ga0373925_0013259 3300037068 Bacteria 5965
465 Ga0373925_0178458 3300037068 Bacteria 1680
466 Ga0373925_1374995 3300037068 Unclassified 579
467 Ga0395899_0000570 3300037312 Bacteria 39268
468 Ga0395899_0002181 3300037312 Bacteria 16076
469 Ga0395899_0726312 3300037312 Bacteria 621
470 Ga0395900_0205304 3300037418 Bacteria 1991
471 Ga0395900_0450626 3300037418 Bacteria 1243
472 Ga0395900_0680672 3300037418 Bacteria 963
473 Ga0395898_0021031 3300037466 Bacteria 6619
474 Ga0395905_0004846 3300037471 Bacteria 13877
475 Ga0395905_1122908 3300037471 Bacteria 689
476 Ga0395901_0125606 3300038443 Bacteria 2696
477 Ga0395901_0182121 3300038443 Bacteria 2203
478 Ga0395901_0449362 3300038443 Bacteria 1318
479 Ga0436365_1502616 3300039437 Bacteria 755
480 Ga0439441_034999 3300042001 Bacteria 988
481 Ga0439441_062713 3300042001 Bacteria 785
482 Ga0451577_0012047 3300042876 Bacteria 8136
483 Ga0453683_0373036 3300044673 Bacteria 918
484 Ga0453684_0000511 3300044712 Bacteria 150804
485 Ga0453684_0040410 3300044712 Bacteria 6334
486 Ga0453684_0167635 3300044712 Bacteria 2591
487 Ga0451576_0062672 3300045051 Bacteria 3876
488 Ga0451576_0088056 3300045051 Bacteria 3230
489 Ga0451576_0268675 3300045051 Bacteria 1783
490 Ga0451576_0957971 3300045051 Unclassified 897
491 Ga0451576_1116925 3300045051 Bacteria 825
492 Ga0451576_1200430 3300045051 Bacteria 792
493 Ga0451576_1342421 3300045051 Bacteria 745
494 Ga0451576_1630420 3300045051 Bacteria 669
495 Ga0451576_2457465 3300045051 Bacteria 532
496 Ga0466967_0441981 3300045976 Bacteria 1270
497 Ga0466967_0553257 3300045976 Bacteria 1133
498 Ga0495629_0503611 3300046459 Bacteria 816
499 Ga0495580_0002914 3300046472 Bacteria 14695
500 Ga0495580_0464753 3300046472 Bacteria 848
501 Ga0495582_0493483 3300046473 Unclassified 708
502 Ga0495639_0074003 3300046475 Bacteria 1578
503 Ga0495594_0507739 3300046499 Bacteria 685
504 Ga0495594_0604976 3300046499 Unclassified 621
505 Ga0495608_0514362 3300046511 Unclassified 724
506 Ga0495618_0014600 3300046514 Unclassified 4787
507 Ga0495618_0423461 3300046514 Unclassified 811
508 Ga0495630_0026387 3300046517 Unclassified 4301
509 Ga0495630_0040776 3300046517 Bacteria 3469
510 Ga0495630_1528137 3300046517 Bacteria 501
511 Ga0495643_0010957 3300046522 Bacteria 5550
512 Ga0495666_0282539 3300046526 Bacteria 752
513 Ga0495666_0431747 3300046526 Unclassified 591
514 Ga0495666_0455475 3300046526 Bacteria 573
515 Ga0495642_0054389 3300046528 Bacteria 1651
516 Ga0495642_0265037 3300046528 Bacteria 752
517 Ga0495654_0179994 3300046530 Bacteria 916
518 Ga0495586_0008895 3300046535 Bacteria 5345
519 Ga0495598_0016727 3300046537 Bacteria 1877
520 Ga0495598_0133134 3300046537 Bacteria 854
521 Ga0495621_0083098 3300046539 Bacteria 1197
522 Ga0495621_0108963 3300046539 Bacteria 1060
523 Ga0495597_0054544 3300046542 Bacteria 1755
524 Ga0495667_0054104 3300046559 Bacteria 2642
525 Ga0495668_0058083 3300046616 Bacteria 2135
526 Ga0495634_0010848 3300046642 Bacteria 6660
527 Ga0495661_0007815 3300046665 Bacteria 7439
528 Ga0495599_0544688 3300046678 Bacteria 680
529 Ga0495647_0082717 3300046681 Bacteria 1304
530 Ga0495658_0784968 3300046683 Bacteria 610
531 Ga0495613_0006984 3300046689 Bacteria 8414
532 Ga0495674_0170584 3300047319 Bacteria 1816
533 Ga0495680_0079942 3300047322 Unclassified 2471
534 Ga0495687_006968 3300047443 Bacteria 6789
535 Ga0495675_0280600 3300047444 Bacteria 993
536 Ga0495684_0053441 3300047471 Bacteria 3082
537 Ga0495615_0056629 3300048090 Bacteria 1024
538 Ga0495615_0268881 3300048090 Bacteria 545
539 Ga0496104_1339741 3300048907 Bacteria 619
540 Ga0496108_0955136 3300048911 Bacteria 734
541 Ga0496109_0303147 3300048912 Bacteria 1507
542 Ga0496109_0409720 3300048912 Bacteria 1281
543 Ga0496112_0840173 3300048915 Bacteria 842
544 Ga0501031_0000631 3300049568 Bacteria 20805
545 Ga0501031_0049874 3300049568 Unclassified 2728
546 Ga0501032_0000148 3300049569 Bacteria 57181
547 Ga0501032_0002706 3300049569 Bacteria 13828
548 Ga0501032_0140210 3300049569 Unclassified 1592
549 Ga0501033_0003368 3300049570 Bacteria 13186
550 Ga0501033_0034024 3300049570 Bacteria 3824
551 Ga0501033_0057492 3300049570 Bacteria 2875
552 Ga0501034_0156034 3300049571 Bacteria 2256
553 Ga0501036_0448808 3300049572 Bacteria 1074
554 Ga0501037_0101773 3300049573 Bacteria 2073
555 Ga0501037_0183297 3300049573 Unclassified 1485
556 Ga0501038_0033270 3300049574 Bacteria 4542
557 Ga0501038_0145081 3300049574 Bacteria 1939
558 Ga0501038_0700898 3300049574 Bacteria 759
559 Ga0501039_0095339 3300049575 Unclassified 2320
560 Ga0501039_0294199 3300049575 Bacteria 1276
561 Ga0501040_0108555 3300049576 Bacteria 1940
562 Ga0501042_0163154 3300049578 Bacteria 1608
563 Ga0501042_0502304 3300049578 Bacteria 881
564 Ga0501042_0608144 3300049578 Bacteria 795
565 Ga0501043_0152387 3300049579 Bacteria 1809
566 Ga0501043_0345472 3300049579 Bacteria 1131
567 Ga0501043_0545397 3300049579 Bacteria 862
568 Ga0501046_0009935 3300049580 Bacteria 8198
569 Ga0501046_0055377 3300049580 Bacteria 3117
570 Ga0501047_0000909 3300049581 Bacteria 30250
571 Ga0501047_0066763 3300049581 Bacteria 3468
572 Ga0501047_0201263 3300049581 Bacteria 1852
573 Ga0501047_0203284 3300049581 Bacteria 1841
574 Ga0501047_0365332 3300049581 Bacteria 1279
575 Ga0501048_0298524 3300049582 Bacteria 1146
576 Ga0501048_0627722 3300049582 Bacteria 771
577 Ga0501048_0906802 3300049582 Bacteria 634
578 Ga0501067_0102532 3300049583 Bacteria 1590
579 Ga0501068_0042370 3300049584 Bacteria 2738
580 Ga0501068_0216012 3300049584 Bacteria 1218
581 Ga0501069_0020517 3300049585 Bacteria 3581
582 Ga0501069_0098424 3300049585 Bacteria 1659
583 Ga0501070_0006216 3300049586 Bacteria 10166
584 Ga0501070_0051481 3300049586 Bacteria 3418
585 Ga0501071_0176569 3300049587 Bacteria 1600
586 Ga0501071_0754992 3300049587 Bacteria 749
587 Ga0501072_0166695 3300049588 Bacteria 1758
588 Ga0501072_0228777 3300049588 Bacteria 1481
589 Ga0501072_0487980 3300049588 Bacteria 975
590 Ga0501073_0082404 3300049589 Bacteria 2238
591 Ga0501073_0203462 3300049589 Bacteria 1369
592 Ga0501073_0282951 3300049589 Bacteria 1144
593 Ga0501074_0005852 3300049590 Bacteria 8870
594 Ga0501074_0106334 3300049590 Bacteria 2009
595 Ga0501074_0271256 3300049590 Bacteria 1206
596 Ga0501074_0538933 3300049590 Unclassified 826
597 Ga0501075_0323306 3300049591 Bacteria 1175
598 Ga0501076_0026248 3300049592 Bacteria 4510
599 Ga0501076_0522250 3300049592 Bacteria 979
600 Ga0501077_0152362 3300049593 Bacteria 1467
601 Ga0501077_0773897 3300049593 Bacteria 617
602 Ga0501079_0022932 3300049741 Bacteria 4793
603 Ga0501079_0096703 3300049741 Bacteria 2289
604 Ga0501079_1000871 3300049741 Bacteria 658
605 Ga0501080_0146967 3300049742 Bacteria 2179
606 Ga0501080_0167459 3300049742 Bacteria 2027
607 Ga0501080_0358473 3300049742 Bacteria 1316
608 Ga0501080_0632198 3300049742 Bacteria 948
609 Ga0501081_0192703 3300049743 Bacteria 1476
610 Ga0501035_0027702 3300049822 Bacteria 5179
611 Ga0501035_0057958 3300049822 Bacteria 3452
612 Ga0501044_0000268 3300049823 Bacteria 66050
613 Ga0501044_0000442 3300049823 Bacteria 50741
614 Ga0501044_0006715 3300049823 Bacteria 12682
615 Ga0501044_0223050 3300049823 Bacteria 1835
616 Ga0501044_0350512 3300049823 Bacteria 1396
617 Ga0501045_0132239 3300049824 Bacteria 1855
618 Ga0501045_0773257 3300049824 Bacteria 707
619 nmdc:mga03683_285916_c1 3300050489 Bacteria 771
620 nmdc:mga0k408_20281_c1 3300050493 Bacteria 3722
621 nmdc:mga05p37_100422_c1 3300050507 Bacteria 3564
622 nmdc:mga05p37_1488656_c1 3300050507 Bacteria 675
623 nmdc:mga05p37_2034756_c1 3300050507 Bacteria 542
624 nmdc:mga05p37_237205_c1 3300050507 Bacteria 2195
625 nmdc:mga05p37_368604_c1 3300050507 Bacteria 1686
626 nmdc:mga05p37_48070_c1 3300050507 Bacteria 5247
627 nmdc:mga05p37_639_c1 3300050507 Bacteria 38794
628 nmdc:mga05p37_693605_c1 3300050507 Unclassified 1133
629 nmdc:mga05p37_9412_c1 3300050507 Bacteria 11566
630 nmdc:mga09592_18418_c1 3300050508 Bacteria 5728
631 nmdc:mga09592_298966_c1 3300050508 Bacteria 1396
632 nmdc:mga09592_688361_c1 3300050508 Unclassified 871
633 nmdc:mga09592_77365_c1 3300050508 Bacteria 2830
634 nmdc:mga0qj67_169204_c1 3300050509 Bacteria 1774
635 nmdc:mga0qj67_61221_c1 3300050509 Bacteria 2988
636 nmdc:mga0qj67_75438_c1 3300050509 Bacteria 2695
637 nmdc:mga06r32_1071_c1 3300050510 Bacteria 6048
638 nmdc:mga06r32_415554_c1 3300050510 Bacteria 554
639 nmdc:mga06r32_423676_c1 3300050510 Unclassified 1312
640 nmdc:mga06r32_456177_c1 3300050510 Bacteria 1258
641 nmdc:mga06r32_591106_c1 3300050510 Bacteria 1081
642 nmdc:mga08y16_2027684_c1 3300050511 Bacteria 524
643 nmdc:mga08y16_789807_c1 3300050511 Bacteria 943
644 nmdc:mga08y16_845572_c1 3300050511 Bacteria 905
645 nmdc:mga08y16_948676_c1 3300050511 Bacteria 843
646 nmdc:mga0n895_1322660_c1 3300050512 Bacteria 691
647 nmdc:mga0n895_1597249_c1 3300050512 Bacteria 617
648 nmdc:mga0n895_27412_c1 3300050512 Bacteria 5413
649 nmdc:mga0n895_558486_c1 3300050512 Bacteria 1150
650 nmdc:mga0n895_83406_c1 3300050512 Bacteria 3188
651 nmdc:mga0rr50_1114364_c1 3300050513 Bacteria 671
652 nmdc:mga0rr50_1282879_c1 3300050513 Bacteria 621
653 nmdc:mga0rr50_1766787_c1 3300050513 Bacteria 521
654 nmdc:mga0rr50_530763_c1 3300050513 Bacteria 1002
655 nmdc:mga0rr50_7612_c1 3300050513 Bacteria 6696
656 nmdc:mga08x19_458659_c1 3300050514 Bacteria 897
657 nmdc:mga08x19_506466_c1 3300050514 Bacteria 853
658 nmdc:mga08x19_882294_c1 3300050514 Bacteria 635
659 nmdc:mga0a205_212288_c1 3300050515 Bacteria 1823
660 nmdc:mga0a205_625855_c1 3300050515 Bacteria 928
661 nmdc:mga0a205_73683_c1 3300050515 Bacteria 3299
662 nmdc:mga0a205_746217_c1 3300050515 Bacteria 828
663 Ga0495601_0061455 3300053077 Unclassified 2385
664 Ga0495601_0324159 3300053077 Bacteria 1003
665 Ga0501084_0056030 3300054114 Bacteria 3298
666 Ga0501084_0170957 3300054114 Bacteria 1834
667 Ga0501084_1487873 3300054114 Bacteria 567
668 Ga0501084_1560849 3300054114 Bacteria 552
669 Ga0530510_0024902 3300061734 Bacteria 4276
670 Ga0530510_0586565 3300061734 Bacteria 847
671 Ga0105243_10660660
672 SwRhRL2b_contig_3656236
673 MBSR1b_contig_13185514
674 JGI24033J26618_1027880
675 rootH2_10179150
676 Ga0065714_10282279
677 Ga0065704_10137463
678 Ga0065707_10097886
679 Ga0070658_11985808
680 Ga0070676_10006697
681 Ga0070676_10460829
682 Ga0070683_100057726
683 Ga0070683_100670578
684 Ga0070683_101492597
685 Ga0070690_100103505
686 Ga0070690_100673285
687 Ga0070690_100770067
688 Ga0070670_100254993
689 Ga0070670_100446621
690 Ga0070677_10005945
691 Ga0070677_10245231
692 Ga0068869_100006593
693 Ga0070666_10021060
694 Ga0070680_100307228
695 Ga0070680_101132707
696 Ga0068868_100051356
697 Ga0068868_100454666
698 Ga0068868_100996147
699 Ga0068868_102013559
700 Ga0070689_100104977
701 Ga0070689_100502165
702 Ga0070689_101337257
703 Ga0070691_10011578
704 Ga0070687_100451693
705 Ga0070687_100600573
706 Ga0070692_10062733
707 Ga0070692_10548203
708 Ga0070668_101279098
709 Ga0070669_100171774
710 Ga0070669_100284802
711 Ga0070675_100191262
712 Ga0070675_100517451
713 Ga0070675_102000350
714 Ga0070671_100028460
715 Ga0070671_100075823
716 Ga0070671_100255328
717 Ga0070671_100761636
718 Ga0070674_100113001
719 Ga0070674_100113445
720 Ga0070673_100465860
721 Ga0070688_100269385
722 Ga0070688_101673864
723 Ga0070659_101128373
724 Ga0070667_100280869
725 Ga0070667_100737629
726 Ga0070667_101257158
727 Ga0070703_10129479
728 Ga0070709_10455873
729 Ga0070709_10813712
730 Ga0070714_100004720
731 Ga0070714_100191167
732 Ga0070714_100956092
733 Ga0070714_101262542
734 Ga0070713_100713031
735 Ga0070713_101811134
736 Ga0070710_10076220
737 Ga0070701_10577749
738 Ga0070701_10584205
739 Ga0070711_100160343
740 Ga0070705_100015637
741 Ga0070700_100251410
742 Ga0070700_100302460
743 Ga0070694_100796156
744 Ga0070708_100041235
745 Ga0070708_100341698
746 Ga0070708_100750149
747 Ga0070663_100711116
748 Ga0070678_100134872
749 Ga0070678_100349560
750 Ga0070678_101315180
751 Ga0070662_100169171
752 Ga0070662_100228439
753 Ga0070662_100252671
754 Ga0070681_10099661
755 Ga0070681_10545646
756 Ga0070681_10972983
757 Ga0068867_100039383
758 Ga0068867_100120300
759 Ga0068867_100162813
760 Ga0070685_10247387
761 Ga0070706_100108905
762 Ga0070706_100154369
763 Ga0070707_100029338
764 Ga0070707_100082110
765 Ga0070707_101571094
766 Ga0070698_100010681
767 Ga0070698_100407519
768 Ga0070698_100605363
769 Ga0070699_100801640
770 Ga0070679_100289260
771 Ga0070679_100442045
772 Ga0070684_101413003
773 Ga0070697_100048365
774 Ga0070697_100476468
775 Ga0068853_101518488
776 Ga0070672_100042667
777 Ga0070672_100064861
778 Ga0070686_100049183
779 Ga0070695_100689810
780 Ga0070695_101092125
781 Ga0070696_100405936
782 Ga0070696_100496446
783 Ga0070696_100560636
784 Ga0070693_100154340
785 Ga0070693_100665073
786 Ga0070665_100000213
787 Ga0070665_100224024
788 Ga0070665_100270395
789 Ga0070665_100581028
790 Ga0070704_100122532
791 Ga0070704_100165672
792 Ga0070704_100845743
793 Ga0068855_100416113
794 Ga0068855_101117399
795 Ga0070664_100354320
796 Ga0070664_100785045
797 Ga0068857_101221424
798 Ga0068854_101520972
799 Ga0068856_100046850
800 Ga0070702_100009578
801 Ga0068852_100468748
802 Ga0068852_101723331
803 Ga0068859_100065189
804 Ga0068859_100399868
805 Ga0068859_100520746
806 Ga0068864_100129379
807 Ga0068864_100570896
808 Ga0068866_10262125
809 Ga0068866_11044219
810 Ga0068866_11147425
811 Ga0068861_100093020
812 Ga0068851_10692184
813 Ga0068851_10859940
814 Ga0068870_10084739
815 Ga0068863_100008248
816 Ga0068863_100059673
817 Ga0068863_102259039
818 Ga0068858_100050595
819 Ga0068860_100065520
820 Ga0068862_100324760
821 Ga0068862_101102400
822 Ga0068862_101252450
823 Ga0081455_10001038
824 Ga0081455_10254376
825 Ga0081538_10005463
826 Ga0081538_10021530
827 Ga0081538_10335284
828 Ga0081540_1138026
829 Ga0070717_10021015
830 Ga0075363_100308751
831 Ga0070716_100063940
832 Ga0075362_10253828
833 Ga0075427_10025225
834 Ga0075366_10026233
835 Ga0075366_10074178
836 Ga0097621_100107358
837 Ga0097621_100622818
838 Ga0068871_100890579
839 Ga0075428_100033970
840 Ga0075428_100146614
841 Ga0075428_100333119
842 Ga0075428_100879519
843 Ga0075428_101163997
844 Ga0075428_101836071
845 Ga0075430_100034821
846 Ga0075430_100086200
847 Ga0075430_100104588
848 Ga0075431_100004030
849 Ga0075431_100021493
850 Ga0075431_100716502
851 Ga0075431_101231338
852 Ga0075433_10000563
853 Ga0075433_10335548
854 Ga0075433_10344199
855 Ga0075433_11686332
856 Ga0075434_100007123
857 Ga0075434_100027156
858 Ga0075434_100176498
859 Ga0075434_100686298
860 Ga0075434_100901216
861 Ga0075429_100028261
862 Ga0075429_101109440
863 Ga0075429_101337146
864 Ga0075429_101360632
865 Ga0075429_101615048
866 Ga0068865_100056205
867 Ga0068865_100082112
868 Ga0068865_101395657
869 Ga0075436_100086008
870 Ga0075436_100192897
871 Ga0075436_100284912
872 Ga0097620_100065193
873 Ga0097620_100399868
874 Ga0097620_100520704
875 Ga0075435_100074197
876 Ga0075435_100136640
877 Ga0075435_100153599
878 Ga0105240_10527188
879 Ga0111539_10152367
880 Ga0111539_10448084
881 Ga0111539_10506146
882 Ga0111539_11064073
883 Ga0111539_12854796
884 Ga0105245_10353838
885 Ga0105245_11854281
886 Ga0105247_10293878
887 Ga0105247_11414443
888 Ga0114129_10001057
889 Ga0114129_10002853
890 Ga0114129_10064442
891 Ga0114129_10389415
892 Ga0114129_10833197
893 Ga0114129_11334113
894 Ga0114129_11398260
895 Ga0114129_11604281
896 Ga0114129_12128998
897 Ga0114129_12283945
898 Ga0114129_13108299
899 Ga0105243_10302239
900 Ga0105241_10965480
901 Ga0105242_10124258
902 Ga0105242_10182571
903 Ga0105248_10011418
904 Ga0105248_10105975
905 Ga0105238_10018245
906 Ga0105249_10118923
907 Ga0105249_10189724
908 Ga0105249_12300166
909 Ga0099796_10080296
910 Ga0099796_10299585
911 Ga0105239_10160510
912 Ga0105239_11120665
913 Ga0105239_12367018
914 Ga0105246_10070025
915 Ga0105246_10237977
916 Ga0105246_11284024
917 Ga0157370_10138398
918 Ga0157369_10125280
919 Ga0157374_10165330
920 Ga0157374_10210725
921 Ga0157374_10225191
922 Ga0157374_10438900
923 Ga0157378_10030129
924 Ga0157378_10113850
925 Ga0157378_10847352
926 Ga0157372_10013791
927 Ga0157372_10105472
928 Ga0157375_10000111
929 Ga0157375_10048135
930 Ga0157375_10078285
931 Ga0157375_10117523
932 Ga0157375_10493520
933 Ga0157375_13247026
934 Ga0163163_10789135
935 Ga0163163_11189296
936 Ga0157379_10015814
937 Ga0157379_10457428
938 Ga0157376_10449346
939 Ga0163161_10405754
940 Ga0163161_10451046
941 Ga0207697_10324372
942 Ga0207656_10564555
943 Ga0207682_10056075
944 Ga0207688_10010225
945 Ga0207680_10010143
946 Ga0207685_10201061
947 Ga0207685_10438866
948 Ga0207645_10004849
949 Ga0207643_10060709
950 Ga0207643_10093008
951 Ga0207684_10099871
952 Ga0207684_10153184
953 Ga0207684_10490460
954 Ga0207684_11356458
955 Ga0207654_10747114
956 Ga0207707_10285019
957 Ga0207695_10046527
958 Ga0207693_10062934
959 Ga0207660_10277645
960 Ga0207662_10277776
961 Ga0207662_10728406
962 Ga0207662_10911090
963 Ga0207649_11621418
964 Ga0207652_10370143
965 Ga0207646_10040212
966 Ga0207646_10065229
967 Ga0207646_11251808
968 Ga0207694_10053367
969 Ga0207650_10003791
970 Ga0207650_10126538
971 Ga0207659_10038703
972 Ga0207659_10155406
973 Ga0207659_10265962
974 Ga0207687_10364018
975 Ga0207687_11272338
976 Ga0207700_11011003
977 Ga0207664_10003657
978 Ga0207664_10451878
979 Ga0207664_11091830
980 Ga0207644_10014819
981 Ga0207644_10054631
982 Ga0207644_10074166
983 Ga0207706_10350969
984 Ga0207706_10504641
985 Ga0207686_10004561
986 Ga0207670_10116145
987 Ga0207670_10352971
988 Ga0207670_11943425
989 Ga0207669_10155085
990 Ga0207669_10297584
991 Ga0207704_10010162
992 Ga0207704_10248624
993 Ga0207665_10386809
994 Ga0207691_10045532
995 Ga0207691_10103612
996 Ga0207691_10407093
997 Ga0207711_10011139
998 Ga0207711_10473394
999 Ga0207689_10086096
1000 Ga0207661_10041605
1001 Ga0207661_10170911
1002 Ga0207661_10861483
1003 Ga0207679_10807060
1004 Ga0207651_10361960
1005 Ga0207651_10369113
1006 Ga0207712_10242359
1007 Ga0207712_11718799
1008 Ga0207668_11247361
1009 Ga0207640_10922796
1010 Ga0207658_10039086
1011 Ga0207658_10146762
1012 Ga0207658_10680917
1013 Ga0207658_11366225
1014 Ga0207658_11868426
1015 Ga0207677_10036461
1016 Ga0207677_10497984
1017 Ga0207677_11386508
1018 Ga0207703_10617354
1019 Ga0207678_10227492
1020 Ga0207678_10913400
1021 Ga0207678_11165037
1022 Ga0207708_10054534
1023 Ga0207708_10149509
1024 Ga0207702_10135629
1025 Ga0207641_10015592
1026 Ga0207641_10037704
1027 Ga0207641_10040804
1028 Ga0207648_10020832
1029 Ga0207648_10050253
1030 Ga0207648_10095534
1031 Ga0207676_10002193
1032 Ga0207676_10461096
1033 Ga0207676_10519004
1034 Ga0207676_10782828
1035 Ga0207675_100458575
1036 Ga0207683_10009965
1037 Ga0207683_10498849
1038 Ga0207683_10766097
1039 Ga0207698_11121233
1040 Ga0207698_11199623
1041 Ga0207698_11904645
1042 Ga0207428_10497186
1043 Ga0207428_10619363
1044 Ga0268266_10000235
1045 Ga0268266_10095516
1046 Ga0268266_10228718
1047 Ga0268266_10356960
1048 Ga0268266_10397223
1049 Ga0268266_10404554
1050 Ga0268266_11949731
1051 Ga0268265_10754321
1052 Ga0268265_11062208
1053 Ga0268264_10189181
1054 Ga0268264_11839185
1055 Ga0265334_10099086
1056 Ga0265318_10030913
1057 Ga0265323_10012238
1058 Ga0265336_10147173
1059 Ga0265338_10003888
1060 Ga0265338_10006496
1061 Ga0265338_10031473
1062 Ga0265338_10231801
1063 Ga0265338_10237743
1064 Ga0265338_10822887
1065 Ga0265330_10008764
1066 Ga0265332_10073987
1067 Ga0265328_10004615
1068 Ga0265328_10005251
1069 Ga0265320_10091412
1070 Ga0265325_10004125
1071 Ga0265329_10073748
1072 Ga0265339_10003464
1073 Ga0265339_10183160
1074 Ga0265339_10324857
1075 Ga0265331_10001550
1076 Ga0265331_10013174
1077 Ga0265327_10098150
1078 Ga0265327_10139810
1079 Ga0265316_10104668
1080 Ga0265316_10171011
1081 Ga0307408_100237898
1082 Ga0307408_100676921
1083 Ga0265313_10003585
1084 Ga0265313_10017323
1085 Ga0307508_10000191
1086 Ga0316575_10079749
1087 Ga0265314_10000948
1088 Ga0265342_10033300
1089 Ga0265342_10060308
1090 Ga0265342_10080744
1091 Ga0307405_10013515
1092 Ga0307410_10121511
1093 Ga0307406_10016265
1094 Ga0307407_10073603
1095 Ga0307412_12283486
1096 Ga0307409_100090527
1097 Ga0307409_100223826
1098 Ga0307416_100021690
1099 Ga0307416_100072122
1100 Ga0307416_102103371
1101 Ga0307414_10358594
1102 Ga0307411_10069496
1103 Ga0307415_100023898
1104 Ga0307415_102317834
1105 Ga0373958_0122844
1106 Ga0373926_0221978
1107 Ga0373923_0286571
1108 Ga0373923_0352098
1109 Ga0373936_0047766
1110 Ga0373939_0059637
1111 Ga0373945_0255923
1112 Ga0373953_0242552
1113 Ga0373954_0034522
1114 Ga0373956_0021865
1115 Ga0373946_0080081
1116 Ga0373946_0359939
1117 Ga0373955_0211557
1118 Ga0373924_0099196
1119 Ga0373924_0404555
1120 Ga0373935_0017087
1121 Ga0373935_0145270
1122 Ga0373927_0023279
1123 Ga0373927_1010937
1124 Ga0373933_0056585
1125 Ga0373947_0006717
1126 Ga0373947_0357300
1127 Ga0373947_1262779
1128 Ga0373937_0082838
1129 Ga0373937_0198114
1130 Ga0373937_0377890
1131 Ga0373937_1136852
1132 Ga0373937_1483469
1133 Ga0373925_0002783
1134 Ga0373925_0013259
1135 Ga0373925_0178458
1136 Ga0373925_1374995
1137 Ga0395899_0000570
1138 Ga0395899_0002181
1139 Ga0395899_0726312
1140 Ga0395900_0205304
1141 Ga0395900_0450626
1142 Ga0395900_0680672
1143 Ga0395898_0021031
1144 Ga0395905_0004846
1145 Ga0395905_1122908
1146 Ga0395901_0125606
1147 Ga0395901_0182121
1148 Ga0395901_0449362
1149 Ga0436365_1502616
1150 Ga0439441_034999
1151 Ga0439441_062713
1152 Ga0451577_0012047
1153 Ga0453683_0373036
1154 Ga0453684_0000511
1155 Ga0453684_0040410
1156 Ga0453684_0167635
1157 Ga0451576_0062672
1158 Ga0451576_0088056
1159 Ga0451576_0268675
1160 Ga0451576_0957971
1161 Ga0451576_1116925
1162 Ga0451576_1200430
1163 Ga0451576_1342421
1164 Ga0451576_1630420
1165 Ga0451576_2457465
1166 Ga0466967_0441981
1167 Ga0466967_0553257
1168 Ga0495629_0503611
1169 Ga0495580_0002914
1170 Ga0495580_0464753
1171 Ga0495582_0493483
1172 Ga0495639_0074003
1173 Ga0495594_0507739
1174 Ga0495594_0604976
1175 Ga0495608_0514362
1176 Ga0495618_0014600
1177 Ga0495618_0423461
1178 Ga0495630_0026387
1179 Ga0495630_0040776
1180 Ga0495630_1528137
1181 Ga0495643_0010957
1182 Ga0495666_0282539
1183 Ga0495666_0431747
1184 Ga0495666_0455475
1185 Ga0495642_0054389
1186 Ga0495642_0265037
1187 Ga0495654_0179994
1188 Ga0495586_0008895
1189 Ga0495598_0016727
1190 Ga0495598_0133134
1191 Ga0495621_0083098
1192 Ga0495621_0108963
1193 Ga0495597_0054544
1194 Ga0495667_0054104
1195 Ga0495668_0058083
1196 Ga0495634_0010848
1197 Ga0495661_0007815
1198 Ga0495599_0544688
1199 Ga0495647_0082717
1200 Ga0495658_0784968
1201 Ga0495613_0006984
1202 Ga0495674_0170584
1203 Ga0495680_0079942
1204 Ga0495687_006968
1205 Ga0495675_0280600
1206 Ga0495684_0053441
1207 Ga0495615_0056629
1208 Ga0495615_0268881
1209 Ga0496104_1339741
1210 Ga0496108_0955136
1211 Ga0496109_0303147
1212 Ga0496109_0409720
1213 Ga0496112_0840173
1214 Ga0501031_0000631
1215 Ga0501031_0049874
1216 Ga0501032_0000148
1217 Ga0501032_0002706
1218 Ga0501032_0140210
1219 Ga0501033_0003368
1220 Ga0501033_0034024
1221 Ga0501033_0057492
1222 Ga0501034_0156034
1223 Ga0501036_0448808
1224 Ga0501037_0101773
1225 Ga0501037_0183297
1226 Ga0501038_0033270
1227 Ga0501038_0145081
1228 Ga0501038_0700898
1229 Ga0501039_0095339
1230 Ga0501039_0294199
1231 Ga0501040_0108555
1232 Ga0501042_0163154
1233 Ga0501042_0502304
1234 Ga0501042_0608144
1235 Ga0501043_0152387
1236 Ga0501043_0345472
1237 Ga0501043_0545397
1238 Ga0501046_0009935
1239 Ga0501046_0055377
1240 Ga0501047_0000909
1241 Ga0501047_0066763
1242 Ga0501047_0201263
1243 Ga0501047_0203284
1244 Ga0501047_0365332
1245 Ga0501048_0298524
1246 Ga0501048_0627722
1247 Ga0501048_0906802
1248 Ga0501067_0102532
1249 Ga0501068_0042370
1250 Ga0501068_0216012
1251 Ga0501069_0020517
1252 Ga0501069_0098424
1253 Ga0501070_0006216
1254 Ga0501070_0051481
1255 Ga0501071_0176569
1256 Ga0501071_0754992
1257 Ga0501072_0166695
1258 Ga0501072_0228777
1259 Ga0501072_0487980
1260 Ga0501073_0082404
1261 Ga0501073_0203462
1262 Ga0501073_0282951
1263 Ga0501074_0005852
1264 Ga0501074_0106334
1265 Ga0501074_0271256
1266 Ga0501074_0538933
1267 Ga0501075_0323306
1268 Ga0501076_0026248
1269 Ga0501076_0522250
1270 Ga0501077_0152362
1271 Ga0501077_0773897
1272 Ga0501079_0022932
1273 Ga0501079_0096703
1274 Ga0501079_1000871
1275 Ga0501080_0146967
1276 Ga0501080_0167459
1277 Ga0501080_0358473
1278 Ga0501080_0632198
1279 Ga0501081_0192703
1280 Ga0501035_0027702
1281 Ga0501035_0057958
1282 Ga0501044_0000268
1283 Ga0501044_0000442
1284 Ga0501044_0006715
1285 Ga0501044_0223050
1286 Ga0501044_0350512
1287 Ga0501045_0132239
1288 Ga0501045_0773257
1289 nmdc:mga03683_285916_c1
1290 nmdc:mga0k408_20281_c1
1291 nmdc:mga05p37_100422_c1
1292 nmdc:mga05p37_1488656_c1
1293 nmdc:mga05p37_2034756_c1
1294 nmdc:mga05p37_237205_c1
1295 nmdc:mga05p37_368604_c1
1296 nmdc:mga05p37_48070_c1
1297 nmdc:mga05p37_639_c1
1298 nmdc:mga05p37_693605_c1
1299 nmdc:mga05p37_9412_c1
1300 nmdc:mga09592_18418_c1
1301 nmdc:mga09592_298966_c1
1302 nmdc:mga09592_688361_c1
1303 nmdc:mga09592_77365_c1
1304 nmdc:mga0qj67_169204_c1
1305 nmdc:mga0qj67_61221_c1
1306 nmdc:mga0qj67_75438_c1
1307 nmdc:mga06r32_1071_c1
1308 nmdc:mga06r32_415554_c1
1309 nmdc:mga06r32_423676_c1
1310 nmdc:mga06r32_456177_c1
1311 nmdc:mga06r32_591106_c1
1312 nmdc:mga08y16_2027684_c1
1313 nmdc:mga08y16_789807_c1
1314 nmdc:mga08y16_845572_c1
1315 nmdc:mga08y16_948676_c1
1316 nmdc:mga0n895_1322660_c1
1317 nmdc:mga0n895_1597249_c1
1318 nmdc:mga0n895_27412_c1
1319 nmdc:mga0n895_558486_c1
1320 nmdc:mga0n895_83406_c1
1321 nmdc:mga0rr50_1114364_c1
1322 nmdc:mga0rr50_1282879_c1
1323 nmdc:mga0rr50_1766787_c1
1324 nmdc:mga0rr50_530763_c1
1325 nmdc:mga0rr50_7612_c1
1326 nmdc:mga08x19_458659_c1
1327 nmdc:mga08x19_506466_c1
1328 nmdc:mga08x19_882294_c1
1329 nmdc:mga0a205_212288_c1
1330 nmdc:mga0a205_625855_c1
1331 nmdc:mga0a205_73683_c1
1332 nmdc:mga0a205_746217_c1
1333 Ga0495601_0061455
1334 Ga0495601_0324159
1335 Ga0501084_0056030
1336 Ga0501084_0170957
1337 Ga0501084_1487873
1338 Ga0501084_1560849
1339 Ga0530510_0024902
1340 Ga0530510_0586565

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

27

158

0.89

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

26

159

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8992 1 136
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8738 1 136
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8484 1 136
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8423 1 136
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.8349 1 135
ID Description Score Start End Superfamily
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9517 80 135 3.30.720.110
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9218 78 136 3.30.720.110
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9108 11 137 3.10.180.10
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9072 78 136 3.30.720.110
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8772 80 135 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A1J5SNH6-F1-model_v4 Uncharacterized protein 0.9977 2 137
AF-A0A536UDD0-F1-model_v4 VOC family protein 0.9939 1 137
AF-A1VUF7-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9933 1 137 GO:0008168
GO:0032259
AF-A0A1Y6BHF6-F1-model_v4 PhnB protein 0.9928 1 137
AF-A0A534STB7-F1-model_v4 VOC family protein 0.9917 1 136

Map