F474005
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 669 | 396 | 650 | 96 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10024937|Ga0163163_100249371 |
| Length | 108 |
| Sequence | MSEQPETTEVTADAAATENAAPAVKARGERKTRQGYVVSDKMDKTVVVAVEDRFKHALYGKVLRQTARLKAHDEQNECGTGDRVLIMETRPLSATKRWRVSQILEKAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 2 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 3 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 4 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 5 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 6 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 7 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 8 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 9 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 10 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 11 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 12 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 13 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 14 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 15 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 16 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 17 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 18 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 19 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 20 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 21 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 22 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 23 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 107 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 112 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Metagenome | Unclassified |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 162 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 169 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 170 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 183 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 184 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 185 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 191 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 200 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 204 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 211 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 212 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 219 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 220 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 221 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 222 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 229 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 230 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 231 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 232 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 233 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 236 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 237 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 238 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 239 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 240 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 241 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 242 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 243 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 244 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 245 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 246 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 247 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 248 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 249 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 250 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 251 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 252 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 253 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 254 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 255 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 256 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 257 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 258 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 259 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 304 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 305 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 306 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 307 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 311 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 312 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 317 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 358 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 359 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 362 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 363 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 364 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 369 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 370 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 371 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 396 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.96 |
| Metatranscriptomes | 14.2 |
| Isolates | 2.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.43 |
| Nodule | 0 |
| Rhizoplane | 7.17 |
| Rhizosphere | 82.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1022013 | 3300001915 | Bacteria | 991 |
| 2 | JGI24739J22299_10252701 | 3300001989 | Bacteria | 516 |
| 3 | JGI24735J21928_10032301 | 3300002067 | Bacteria | 1550 |
| 4 | Ga0058863_10060076 | 3300004799 | Bacteria | 2020 |
| 5 | Ga0058861_11933151 | 3300004800 | Bacteria | 1064 |
| 6 | Ga0058862_10086705 | 3300004803 | Bacteria | 980 |
| 7 | Ga0070683_100273207 | 3300005329 | Bacteria | 1608 |
| 8 | Ga0070683_100311672 | 3300005329 | Bacteria | 1497 |
| 9 | Ga0070683_100451471 | 3300005329 | Bacteria | 1226 |
| 10 | Ga0070683_101183110 | 3300005329 | Bacteria | 735 |
| 11 | Ga0070683_101632912 | 3300005329 | Bacteria | 620 |
| 12 | Ga0070690_101235759 | 3300005330 | Bacteria | 597 |
| 13 | Ga0070670_100811020 | 3300005331 | Bacteria | 845 |
| 14 | Ga0070677_10116410 | 3300005333 | Bacteria | 1201 |
| 15 | Ga0070677_10731688 | 3300005333 | Bacteria | 560 |
| 16 | Ga0070680_100758217 | 3300005336 | Bacteria | 836 |
| 17 | Ga0070682_100065239 | 3300005337 | Bacteria | 2313 |
| 18 | Ga0070682_100107395 | 3300005337 | Bacteria | 1854 |
| 19 | Ga0070682_100846756 | 3300005337 | Bacteria | 747 |
| 20 | Ga0070682_101106103 | 3300005337 | Bacteria | 664 |
| 21 | Ga0068868_101052770 | 3300005338 | Bacteria | 747 |
| 22 | Ga0070660_100432332 | 3300005339 | Bacteria | 1091 |
| 23 | Ga0070689_100962810 | 3300005340 | Bacteria | 758 |
| 24 | Ga0070689_101297147 | 3300005340 | Bacteria | 656 |
| 25 | Ga0070661_100889375 | 3300005344 | Bacteria | 735 |
| 26 | Ga0070661_101223654 | 3300005344 | Bacteria | 628 |
| 27 | Ga0070661_101373986 | 3300005344 | Bacteria | 594 |
| 28 | Ga0070692_10120656 | 3300005345 | Bacteria | 1462 |
| 29 | Ga0070668_100319542 | 3300005347 | Bacteria | 1307 |
| 30 | Ga0070668_100519866 | 3300005347 | Bacteria | 1033 |
| 31 | Ga0070675_100105721 | 3300005354 | Bacteria | 2375 |
| 32 | Ga0070675_101528454 | 3300005354 | Bacteria | 616 |
| 33 | Ga0070675_102236886 | 3300005354 | Bacteria | 504 |
| 34 | Ga0070671_100384485 | 3300005355 | Bacteria | 1200 |
| 35 | Ga0070671_101118933 | 3300005355 | Bacteria | 692 |
| 36 | Ga0070674_100270107 | 3300005356 | Bacteria | 1343 |
| 37 | Ga0070674_100330570 | 3300005356 | Bacteria | 1225 |
| 38 | Ga0070673_100310990 | 3300005364 | Bacteria | 1390 |
| 39 | Ga0070673_101664321 | 3300005364 | Bacteria | 603 |
| 40 | Ga0070659_101219955 | 3300005366 | Bacteria | 665 |
| 41 | Ga0070667_100079087 | 3300005367 | Bacteria | 2810 |
| 42 | Ga0070667_102132150 | 3300005367 | Bacteria | 528 |
| 43 | Ga0070709_10124124 | 3300005434 | Bacteria | 1754 |
| 44 | Ga0070710_10073724 | 3300005437 | Bacteria | 1974 |
| 45 | Ga0070711_100020873 | 3300005439 | Bacteria | 4228 |
| 46 | Ga0070700_100958072 | 3300005441 | Bacteria | 701 |
| 47 | Ga0070700_101107743 | 3300005441 | Bacteria | 657 |
| 48 | Ga0070663_100177359 | 3300005455 | Bacteria | 1650 |
| 49 | Ga0070663_101058255 | 3300005455 | Bacteria | 708 |
| 50 | Ga0070678_100066368 | 3300005456 | Bacteria | 2682 |
| 51 | Ga0070678_100382263 | 3300005456 | Bacteria | 1218 |
| 52 | Ga0070678_100666381 | 3300005456 | Bacteria | 934 |
| 53 | Ga0070678_102161360 | 3300005456 | Bacteria | 528 |
| 54 | Ga0070662_100759619 | 3300005457 | Bacteria | 823 |
| 55 | Ga0070681_11656726 | 3300005458 | Bacteria | 565 |
| 56 | Ga0068867_100154927 | 3300005459 | Bacteria | 1803 |
| 57 | Ga0070707_100017376 | 3300005468 | Bacteria | 6762 |
| 58 | Ga0070698_100006774 | 3300005471 | Bacteria | 12422 |
| 59 | Ga0070699_101433024 | 3300005518 | Bacteria | 633 |
| 60 | Ga0070679_100651974 | 3300005530 | Bacteria | 995 |
| 61 | Ga0070684_100210157 | 3300005535 | Bacteria | 1773 |
| 62 | Ga0070684_100305772 | 3300005535 | Bacteria | 1459 |
| 63 | Ga0070684_100499327 | 3300005535 | Bacteria | 1127 |
| 64 | Ga0070693_101242679 | 3300005547 | Bacteria | 574 |
| 65 | Ga0070665_100422486 | 3300005548 | Bacteria | 1342 |
| 66 | Ga0068857_100214101 | 3300005577 | Bacteria | 1759 |
| 67 | Ga0068857_100227036 | 3300005577 | Bacteria | 1707 |
| 68 | Ga0068856_101964677 | 3300005614 | Bacteria | 596 |
| 69 | Ga0070702_100229424 | 3300005615 | Bacteria | 1246 |
| 70 | Ga0070702_101213015 | 3300005615 | Bacteria | 609 |
| 71 | Ga0068852_101084856 | 3300005616 | Bacteria | 821 |
| 72 | Ga0068852_102641118 | 3300005616 | Bacteria | 522 |
| 73 | Ga0068859_102796048 | 3300005617 | Bacteria | 536 |
| 74 | Ga0068864_100762876 | 3300005618 | Bacteria | 949 |
| 75 | Ga0068861_100802120 | 3300005719 | Bacteria | 884 |
| 76 | Ga0068861_101387784 | 3300005719 | Bacteria | 686 |
| 77 | Ga0068870_10016699 | 3300005840 | Bacteria | 3514 |
| 78 | Ga0068858_100795276 | 3300005842 | Bacteria | 923 |
| 79 | Ga0081540_1060450 | 3300005983 | Bacteria | 1812 |
| 80 | Ga0070717_10207041 | 3300006028 | Bacteria | 1720 |
| 81 | Ga0075365_10596167 | 3300006038 | Bacteria | 781 |
| 82 | Ga0075365_10858253 | 3300006038 | Bacteria | 640 |
| 83 | Ga0075365_11061651 | 3300006038 | Bacteria | 570 |
| 84 | Ga0075365_11130317 | 3300006038 | Bacteria | 551 |
| 85 | Ga0075368_10025723 | 3300006042 | Bacteria | 2259 |
| 86 | Ga0075368_10123757 | 3300006042 | Bacteria | 1072 |
| 87 | Ga0075363_100019633 | 3300006048 | Bacteria | 3380 |
| 88 | Ga0075363_100060635 | 3300006048 | Bacteria | 2037 |
| 89 | Ga0075363_100591250 | 3300006048 | Bacteria | 664 |
| 90 | Ga0075364_10828663 | 3300006051 | Bacteria | 630 |
| 91 | Ga0075364_11074626 | 3300006051 | Bacteria | 546 |
| 92 | Ga0070715_10006159 | 3300006163 | Bacteria | 4059 |
| 93 | Ga0070715_10433980 | 3300006163 | Bacteria | 738 |
| 94 | Ga0070716_100037140 | 3300006173 | Bacteria | 2690 |
| 95 | Ga0070712_100035731 | 3300006175 | Bacteria | 3374 |
| 96 | Ga0075362_10573466 | 3300006177 | Bacteria | 581 |
| 97 | Ga0075366_11053888 | 3300006195 | Bacteria | 508 |
| 98 | Ga0097621_100501219 | 3300006237 | Bacteria | 1100 |
| 99 | Ga0075370_10078009 | 3300006353 | Bacteria | 1901 |
| 100 | Ga0075370_10285066 | 3300006353 | Bacteria | 981 |
| 101 | Ga0075370_10336572 | 3300006353 | Bacteria | 900 |
| 102 | Ga0075430_101373158 | 3300006846 | Bacteria | 581 |
| 103 | Ga0068865_101114283 | 3300006881 | Bacteria | 696 |
| 104 | Ga0068865_101262236 | 3300006881 | Bacteria | 656 |
| 105 | Ga0097620_102796255 | 3300006931 | Bacteria | 536 |
| 106 | Ga0105243_10146698 | 3300009148 | Bacteria | 2019 |
| 107 | Ga0105243_10360349 | 3300009148 | Bacteria | 1338 |
| 108 | Ga0105242_10074568 | 3300009176 | Bacteria | 2823 |
| 109 | Ga0105242_11021495 | 3300009176 | Bacteria | 836 |
| 110 | Ga0105248_12578970 | 3300009177 | Bacteria | 579 |
| 111 | Ga0105237_11345211 | 3300009545 | Bacteria | 720 |
| 112 | Ga0105238_11714173 | 3300009551 | Bacteria | 659 |
| 113 | Ga0105249_10187575 | 3300009553 | Bacteria | 2016 |
| 114 | Ga0105249_10189951 | 3300009553 | Bacteria | 2004 |
| 115 | Ga0105249_11192357 | 3300009553 | Bacteria | 832 |
| 116 | Ga0105239_10343319 | 3300010375 | Bacteria | 1685 |
| 117 | Ga0105246_10158771 | 3300011119 | Bacteria | 1720 |
| 118 | Ga0105246_10167003 | 3300011119 | Bacteria | 1682 |
| 119 | Ga0157373_11033076 | 3300013100 | Bacteria | 614 |
| 120 | Ga0157371_10611080 | 3300013102 | Bacteria | 811 |
| 121 | Ga0157371_10738373 | 3300013102 | Bacteria | 739 |
| 122 | Ga0157371_11117769 | 3300013102 | Bacteria | 605 |
| 123 | Ga0157374_10428838 | 3300013296 | Bacteria | 1322 |
| 124 | Ga0157378_10010737 | 3300013297 | Bacteria | 8006 |
| 125 | Ga0157378_11089778 | 3300013297 | Bacteria | 835 |
| 126 | Ga0163162_10081947 | 3300013306 | Bacteria | 3298 |
| 127 | Ga0163162_10293331 | 3300013306 | Bacteria | 1758 |
| 128 | Ga0163162_10472890 | 3300013306 | Bacteria | 1385 |
| 129 | Ga0163162_11491256 | 3300013306 | Bacteria | 770 |
| 130 | Ga0157372_10787012 | 3300013307 | Bacteria | 1105 |
| 131 | Ga0157372_10922008 | 3300013307 | Bacteria | 1013 |
| 132 | Ga0157375_10008009 | 3300013308 | Bacteria | 9253 |
| 133 | Ga0157375_11289503 | 3300013308 | Bacteria | 858 |
| 134 | Ga0163163_10024937 | 3300014325 | Bacteria | 5694 |
| 135 | Ga0163163_10901979 | 3300014325 | Bacteria | 947 |
| 136 | Ga0157380_10036717 | 3300014326 | Bacteria | 3793 |
| 137 | Ga0157380_10108855 | 3300014326 | Bacteria | 2324 |
| 138 | Ga0157380_10391403 | 3300014326 | Bacteria | 1315 |
| 139 | Ga0157380_13422903 | 3300014326 | Bacteria | 508 |
| 140 | Ga0157376_11728478 | 3300014969 | Bacteria | 661 |
| 141 | Ga0197907_10647083 | 3300020069 | Bacteria | 1819 |
| 142 | Ga0197907_11170858 | 3300020069 | Bacteria | 989 |
| 143 | Ga0206356_11565064 | 3300020070 | Bacteria | 1219 |
| 144 | Ga0206349_1141404 | 3300020075 | Bacteria | 767 |
| 145 | Ga0206349_1354096 | 3300020075 | Bacteria | 949 |
| 146 | Ga0206349_1934290 | 3300020075 | Bacteria | 627 |
| 147 | Ga0206355_1069744 | 3300020076 | Bacteria | 1016 |
| 148 | Ga0206355_1090915 | 3300020076 | Bacteria | 1652 |
| 149 | Ga0206355_1407428 | 3300020076 | Bacteria | 589 |
| 150 | Ga0206350_10745375 | 3300020080 | Bacteria | 1033 |
| 151 | Ga0206354_10057345 | 3300020081 | Bacteria | 535 |
| 152 | Ga0206354_11411084 | 3300020081 | Bacteria | 869 |
| 153 | Ga0206353_10414422 | 3300020082 | Bacteria | 1658 |
| 154 | Ga0154015_1147349 | 3300020610 | Bacteria | 1747 |
| 155 | Ga0213875_10088929 | 3300021388 | Bacteria | 1441 |
| 156 | Ga0224712_10293475 | 3300022467 | Bacteria | 759 |
| 157 | Ga0224712_10419276 | 3300022467 | Bacteria | 640 |
| 158 | Ga0228600_1006526 | 3300024123 | Bacteria | 870 |
| 159 | Ga0207656_10096111 | 3300025321 | Bacteria | 1352 |
| 160 | Ga0207692_10005017 | 3300025898 | Bacteria | 5270 |
| 161 | Ga0207692_10380793 | 3300025898 | Bacteria | 876 |
| 162 | Ga0207688_10036973 | 3300025901 | Bacteria | 2707 |
| 163 | Ga0207688_10555246 | 3300025901 | Bacteria | 722 |
| 164 | Ga0207647_10670051 | 3300025904 | Bacteria | 567 |
| 165 | Ga0207685_10077352 | 3300025905 | Bacteria | 1367 |
| 166 | Ga0207699_10012149 | 3300025906 | Bacteria | 4373 |
| 167 | Ga0207645_10674583 | 3300025907 | Bacteria | 702 |
| 168 | Ga0207643_10024696 | 3300025908 | Bacteria | 3316 |
| 169 | Ga0207705_10847246 | 3300025909 | Bacteria | 709 |
| 170 | Ga0207684_10697678 | 3300025910 | Bacteria | 863 |
| 171 | Ga0207707_10503279 | 3300025912 | Bacteria | 1033 |
| 172 | Ga0207707_11430485 | 3300025912 | Bacteria | 550 |
| 173 | Ga0207693_10073798 | 3300025915 | Bacteria | 2671 |
| 174 | Ga0207663_10196153 | 3300025916 | Bacteria | 1453 |
| 175 | Ga0207657_10059474 | 3300025919 | Bacteria | 3283 |
| 176 | Ga0207657_10194651 | 3300025919 | Bacteria | 1634 |
| 177 | Ga0207649_10512263 | 3300025920 | Bacteria | 914 |
| 178 | Ga0207649_11010700 | 3300025920 | Bacteria | 654 |
| 179 | Ga0207652_10239587 | 3300025921 | Bacteria | 1635 |
| 180 | Ga0207646_10080136 | 3300025922 | Bacteria | 2919 |
| 181 | Ga0207694_10456750 | 3300025924 | Bacteria | 1067 |
| 182 | Ga0207650_11047429 | 3300025925 | Bacteria | 694 |
| 183 | Ga0207664_10038812 | 3300025929 | Bacteria | 3694 |
| 184 | Ga0207644_10467299 | 3300025931 | Bacteria | 1038 |
| 185 | Ga0207690_10961151 | 3300025932 | Bacteria | 710 |
| 186 | Ga0207686_11652325 | 3300025934 | Bacteria | 529 |
| 187 | Ga0207709_10060849 | 3300025935 | Bacteria | 2357 |
| 188 | Ga0207670_11295421 | 3300025936 | Bacteria | 618 |
| 189 | Ga0207669_10201528 | 3300025937 | Bacteria | 1445 |
| 190 | Ga0207704_10878510 | 3300025938 | Bacteria | 753 |
| 191 | Ga0207665_10014926 | 3300025939 | Bacteria | 5103 |
| 192 | Ga0207691_10584926 | 3300025940 | Bacteria | 945 |
| 193 | Ga0207711_10809600 | 3300025941 | Bacteria | 872 |
| 194 | Ga0207661_10030802 | 3300025944 | Bacteria | 4136 |
| 195 | Ga0207712_10245420 | 3300025961 | Bacteria | 1445 |
| 196 | Ga0207712_10516564 | 3300025961 | Bacteria | 1023 |
| 197 | Ga0207658_10023394 | 3300025986 | Bacteria | 4312 |
| 198 | Ga0207677_10808731 | 3300026023 | Bacteria | 840 |
| 199 | Ga0207703_12206410 | 3300026035 | Bacteria | 527 |
| 200 | Ga0207678_10392021 | 3300026067 | Bacteria | 1201 |
| 201 | Ga0207708_10381432 | 3300026075 | Bacteria | 1162 |
| 202 | Ga0207702_10845417 | 3300026078 | Bacteria | 906 |
| 203 | Ga0207641_10703894 | 3300026088 | Bacteria | 995 |
| 204 | Ga0207641_11767956 | 3300026088 | Bacteria | 620 |
| 205 | Ga0207641_12252105 | 3300026088 | Bacteria | 545 |
| 206 | Ga0207648_10161787 | 3300026089 | Bacteria | 1977 |
| 207 | Ga0207676_10320409 | 3300026095 | Bacteria | 1423 |
| 208 | Ga0207676_10381580 | 3300026095 | Bacteria | 1312 |
| 209 | Ga0207674_10026320 | 3300026116 | Bacteria | 6181 |
| 210 | Ga0207674_10225152 | 3300026116 | Bacteria | 1824 |
| 211 | Ga0207675_100145970 | 3300026118 | Bacteria | 2250 |
| 212 | Ga0207675_100928854 | 3300026118 | Bacteria | 887 |
| 213 | Ga0207683_10191528 | 3300026121 | Bacteria | 1857 |
| 214 | Ga0207683_10491198 | 3300026121 | Bacteria | 1133 |
| 215 | Ga0209813_10001880 | 3300027866 | Bacteria | 4739 |
| 216 | Ga0268266_10111658 | 3300028379 | Bacteria | 2422 |
| 217 | Ga0268264_10000792 | 3300028381 | Bacteria | 34282 |
| 218 | Ga0316176_1044392 | 3300030732 | Bacteria | 723 |
| 219 | Ga0265763_1001461 | 3300030763 | Bacteria | 1691 |
| 220 | Ga0265766_1005347 | 3300030863 | Bacteria | 812 |
| 221 | Ga0265769_106022 | 3300030888 | Bacteria | 752 |
| 222 | Ga0265768_102109 | 3300030963 | Bacteria | 994 |
| 223 | Ga0265773_1011144 | 3300031018 | Bacteria | 769 |
| 224 | Ga0307408_100025858 | 3300031548 | Bacteria | 4024 |
| 225 | Ga0316579_10005517 | 3300031691 | Bacteria | 5115 |
| 226 | Ga0316579_10119546 | 3300031691 | Bacteria | 1266 |
| 227 | Ga0316579_10228583 | 3300031691 | Bacteria | 900 |
| 228 | Ga0316576_10006920 | 3300031727 | Bacteria | 7091 |
| 229 | Ga0316576_10009973 | 3300031727 | Bacteria | 6151 |
| 230 | Ga0316576_10049104 | 3300031727 | Bacteria | 3063 |
| 231 | Ga0316576_10164950 | 3300031727 | Bacteria | 1671 |
| 232 | Ga0316578_10012098 | 3300031728 | Bacteria | 4541 |
| 233 | Ga0316578_10017124 | 3300031728 | Bacteria | 3939 |
| 234 | Ga0316578_10039413 | 3300031728 | Bacteria | 2729 |
| 235 | Ga0316578_10228139 | 3300031728 | Bacteria | 1119 |
| 236 | Ga0307405_10408320 | 3300031731 | Bacteria | 1065 |
| 237 | Ga0307405_10696624 | 3300031731 | Bacteria | 841 |
| 238 | Ga0307413_10152007 | 3300031824 | Bacteria | 1614 |
| 239 | Ga0307410_10008640 | 3300031852 | Bacteria | 5660 |
| 240 | Ga0307410_10242712 | 3300031852 | Bacteria | 1397 |
| 241 | Ga0307410_10335247 | 3300031852 | Bacteria | 1204 |
| 242 | Ga0307406_11075700 | 3300031901 | Bacteria | 693 |
| 243 | Ga0307407_10091249 | 3300031903 | Bacteria | 1867 |
| 244 | Ga0307412_11195920 | 3300031911 | Bacteria | 680 |
| 245 | Ga0307409_100001225 | 3300031995 | Bacteria | 12356 |
| 246 | Ga0307409_100253869 | 3300031995 | Bacteria | 1609 |
| 247 | Ga0307409_100592740 | 3300031995 | Bacteria | 1094 |
| 248 | Ga0307409_101218585 | 3300031995 | Bacteria | 776 |
| 249 | Ga0307416_100003637 | 3300032002 | Bacteria | 9109 |
| 250 | Ga0307414_11037266 | 3300032004 | Bacteria | 756 |
| 251 | Ga0307411_10568504 | 3300032005 | Bacteria | 970 |
| 252 | Ga0307411_10860531 | 3300032005 | Bacteria | 803 |
| 253 | Ga0307411_11813352 | 3300032005 | Bacteria | 566 |
| 254 | Ga0307415_100317652 | 3300032126 | Bacteria | 1297 |
| 255 | Ga0316583_10012326 | 3300032133 | Bacteria | 3084 |
| 256 | Ga0316583_10189270 | 3300032133 | Bacteria | 715 |
| 257 | Ga0316585_10043899 | 3300032137 | Bacteria | 1428 |
| 258 | Ga0316585_10186517 | 3300032137 | Bacteria | 685 |
| 259 | Ga0316580_10064417 | 3300032139 | Bacteria | 1124 |
| 260 | Ga0316580_10088221 | 3300032139 | Bacteria | 949 |
| 261 | Ga0316593_10000304 | 3300032168 | Bacteria | 8362 |
| 262 | Ga0316593_10002456 | 3300032168 | Bacteria | 4406 |
| 263 | Ga0316593_10006052 | 3300032168 | Bacteria | 3241 |
| 264 | Ga0316593_10071625 | 3300032168 | Bacteria | 1199 |
| 265 | Ga0316593_10292263 | 3300032168 | Bacteria | 616 |
| 266 | Ga0316592_1004568 | 3300033524 | Bacteria | 2580 |
| 267 | Ga0316592_1006305 | 3300033524 | Bacteria | 2281 |
| 268 | Ga0316592_1022884 | 3300033524 | Bacteria | 1338 |
| 269 | Ga0316592_1039236 | 3300033524 | Bacteria | 1046 |
| 270 | Ga0316592_1088949 | 3300033524 | Bacteria | 706 |
| 271 | Ga0316586_1007512 | 3300033527 | Bacteria | 1591 |
| 272 | Ga0316586_1062448 | 3300033527 | Bacteria | 679 |
| 273 | Ga0316588_1046325 | 3300033528 | Bacteria | 1048 |
| 274 | Ga0316596_1000140 | 3300033541 | Bacteria | 9866 |
| 275 | Ga0316596_1007697 | 3300033541 | Bacteria | 2552 |
| 276 | Ga0316596_1014012 | 3300033541 | Bacteria | 1983 |
| 277 | Ga0373950_0017391 | 3300034818 | Bacteria | 1239 |
| 278 | Ga0373959_0025753 | 3300034820 | Bacteria | 1158 |
| 279 | Ga0373934_0001665 | 3300035086 | Bacteria | 8157 |
| 280 | Ga0373923_0007458 | 3300035111 | Bacteria | 3846 |
| 281 | Ga0373936_0070564 | 3300035113 | Bacteria | 1439 |
| 282 | Ga0373936_0288709 | 3300035113 | Bacteria | 738 |
| 283 | Ga0373945_0066209 | 3300035116 | Bacteria | 1358 |
| 284 | Ga0373953_0004941 | 3300035117 | Bacteria | 4291 |
| 285 | Ga0373954_0006014 | 3300035118 | Bacteria | 5280 |
| 286 | Ga0373956_0008114 | 3300035119 | Bacteria | 4249 |
| 287 | Ga0373957_0001036 | 3300035120 | Bacteria | 7312 |
| 288 | Ga0373960_0064490 | 3300035121 | Bacteria | 1119 |
| 289 | Ga0373946_0310502 | 3300035171 | Bacteria | 781 |
| 290 | Ga0373962_0223850 | 3300035242 | Bacteria | 645 |
| 291 | Ga0316574_0000119 | 3300035398 | Bacteria | 24097 |
| 292 | Ga0316574_0003558 | 3300035398 | Bacteria | 8051 |
| 293 | Ga0316574_0022365 | 3300035398 | Bacteria | 3763 |
| 294 | Ga0316574_0023256 | 3300035398 | Bacteria | 3699 |
| 295 | Ga0316574_0034195 | 3300035398 | Bacteria | 3097 |
| 296 | Ga0316574_0049174 | 3300035398 | Bacteria | 2621 |
| 297 | Ga0373924_0044587 | 3300035410 | Bacteria | 1822 |
| 298 | Ga0373931_0637880 | 3300035691 | Bacteria | 699 |
| 299 | Ga0373935_0071970 | 3300035692 | Bacteria | 2231 |
| 300 | Ga0373935_0969695 | 3300035692 | Bacteria | 631 |
| 301 | Ga0373935_1072142 | 3300035692 | Bacteria | 599 |
| 302 | Ga0373933_0002959 | 3300035724 | Bacteria | 9478 |
| 303 | Ga0373937_0068251 | 3300036401 | Bacteria | 3277 |
| 304 | Ga0373937_0644479 | 3300036401 | Bacteria | 1005 |
| 305 | Ga0265778_016495 | 3300036457 | Bacteria | 886 |
| 306 | Ga0316582_0031807 | 3300036647 | Bacteria | 3228 |
| 307 | Ga0316582_0117570 | 3300036647 | Bacteria | 1776 |
| 308 | Ga0316582_0331808 | 3300036647 | Bacteria | 1046 |
| 309 | Ga0316584_0005394 | 3300036712 | Bacteria | 8579 |
| 310 | Ga0316584_0009403 | 3300036712 | Bacteria | 6785 |
| 311 | Ga0316584_0055102 | 3300036712 | Bacteria | 2977 |
| 312 | Ga0316584_0099111 | 3300036712 | Bacteria | 2182 |
| 313 | Ga0316584_0360323 | 3300036712 | Bacteria | 1043 |
| 314 | Ga0373925_0092377 | 3300037068 | Bacteria | 2315 |
| 315 | Ga0395899_0886126 | 3300037312 | Bacteria | 545 |
| 316 | Ga0395900_0068181 | 3300037418 | Bacteria | 3655 |
| 317 | Ga0395900_0205946 | 3300037418 | Bacteria | 1988 |
| 318 | Ga0395900_0278590 | 3300037418 | Bacteria | 1665 |
| 319 | Ga0395898_0039180 | 3300037466 | Bacteria | 4691 |
| 320 | Ga0395898_0353407 | 3300037466 | Bacteria | 1401 |
| 321 | Ga0395898_0613993 | 3300037466 | Bacteria | 1030 |
| 322 | Ga0436364_0124034 | 3300037853 | Bacteria | 626 |
| 323 | Ga0395901_0018326 | 3300038443 | Bacteria | 7147 |
| 324 | Ga0395901_0154973 | 3300038443 | Bacteria | 2406 |
| 325 | Ga0395901_0370453 | 3300038443 | Bacteria | 1475 |
| 326 | Ga0395901_0482913 | 3300038443 | Bacteria | 1263 |
| 327 | Ga0395901_0601842 | 3300038443 | Bacteria | 1108 |
| 328 | Ga0436360_0626054 | 3300039438 | Bacteria | 1532 |
| 329 | Ga0436360_0821879 | 3300039438 | Bacteria | 752 |
| 330 | Ga0436362_0361172 | 3300039453 | Bacteria | 975 |
| 331 | Ga0439466_0219435 | 3300041411 | Bacteria | 577 |
| 332 | Ga0439465_0309839 | 3300041413 | Bacteria | 592 |
| 333 | Ga0451793_1462454 | 3300041452 | Bacteria | 732 |
| 334 | Ga0451797_1542332 | 3300041453 | Bacteria | 615 |
| 335 | Ga0451795_1488462 | 3300041456 | Bacteria | 516 |
| 336 | Ga0451800_0021290 | 3300041459 | Bacteria | 898 |
| 337 | Ga0451800_0225272 | 3300041459 | Bacteria | 1325 |
| 338 | Ga0451802_1939573 | 3300041460 | Bacteria | 860 |
| 339 | Ga0451807_2386134 | 3300041486 | Bacteria | 548 |
| 340 | Ga0451835_0634236 | 3300041492 | Bacteria | 710 |
| 341 | Ga0451847_0859504 | 3300041503 | Bacteria | 516 |
| 342 | Ga0451849_0617100 | 3300041505 | Bacteria | 797 |
| 343 | Ga0451851_0191684 | 3300041507 | Bacteria | 704 |
| 344 | Ga0451843_0895626 | 3300041509 | Bacteria | 1168 |
| 345 | Ga0451843_1048037 | 3300041509 | Bacteria | 746 |
| 346 | Ga0451855_0317925 | 3300041511 | Bacteria | 622 |
| 347 | Ga0451853_2531387 | 3300041512 | Bacteria | 632 |
| 348 | Ga0439433_0119062 | 3300041999 | Bacteria | 665 |
| 349 | Ga0439442_034482 | 3300042002 | Bacteria | 1058 |
| 350 | Ga0439442_085984 | 3300042002 | Bacteria | 675 |
| 351 | Ga0439449_0227513 | 3300042007 | Bacteria | 700 |
| 352 | Ga0439456_157332 | 3300042013 | Bacteria | 531 |
| 353 | Ga0439457_017658 | 3300042014 | Bacteria | 1584 |
| 354 | Ga0450923_030640 | 3300042125 | Bacteria | 1095 |
| 355 | Ga0450906_019906 | 3300042145 | Bacteria | 1202 |
| 356 | Ga0439446_0219087 | 3300042156 | Bacteria | 648 |
| 357 | Ga0439464_0113399 | 3300042439 | Bacteria | 831 |
| 358 | Ga0450918_094996 | 3300042531 | Bacteria | 579 |
| 359 | Ga0466972_0030280 | 3300044658 | Bacteria | 2664 |
| 360 | Ga0466972_0129038 | 3300044658 | Bacteria | 1191 |
| 361 | Ga0466972_0189232 | 3300044658 | Bacteria | 965 |
| 362 | Ga0466965_0045066 | 3300044683 | Bacteria | 2181 |
| 363 | Ga0466965_0170635 | 3300044683 | Bacteria | 1144 |
| 364 | Ga0466965_0214365 | 3300044683 | Bacteria | 1024 |
| 365 | Ga0466965_0380417 | 3300044683 | Bacteria | 777 |
| 366 | Ga0466966_0021458 | 3300044684 | Bacteria | 4241 |
| 367 | Ga0466961_0044759 | 3300044693 | Bacteria | 2832 |
| 368 | Ga0466963_0009270 | 3300044694 | Bacteria | 5926 |
| 369 | Ga0466963_0082336 | 3300044694 | Bacteria | 2181 |
| 370 | Ga0466963_0127964 | 3300044694 | Bacteria | 1752 |
| 371 | Ga0466964_0067090 | 3300044706 | Bacteria | 1507 |
| 372 | Ga0466964_0225089 | 3300044706 | Bacteria | 913 |
| 373 | Ga0453684_0153453 | 3300044712 | Bacteria | 2734 |
| 374 | Ga0466971_0096897 | 3300044719 | Bacteria | 1353 |
| 375 | Ga0466971_0126774 | 3300044719 | Bacteria | 1183 |
| 376 | Ga0466968_0047855 | 3300044735 | Bacteria | 1819 |
| 377 | Ga0466970_0308726 | 3300044765 | Bacteria | 893 |
| 378 | Ga0466957_0002716 | 3300044842 | Bacteria | 9569 |
| 379 | Ga0466957_0005571 | 3300044842 | Bacteria | 7075 |
| 380 | Ga0466960_0036578 | 3300044901 | Bacteria | 2299 |
| 381 | Ga0466958_0016958 | 3300045836 | Bacteria | 4201 |
| 382 | Ga0466958_0064232 | 3300045836 | Bacteria | 2238 |
| 383 | Ga0466967_0039429 | 3300045976 | Bacteria | 4061 |
| 384 | Ga0466967_0068905 | 3300045976 | Bacteria | 3160 |
| 385 | Ga0466967_0102456 | 3300045976 | Bacteria | 2619 |
| 386 | Ga0466967_0166934 | 3300045976 | Bacteria | 2069 |
| 387 | Ga0466967_1284717 | 3300045976 | Bacteria | 729 |
| 388 | Ga0466967_1515293 | 3300045976 | Bacteria | 668 |
| 389 | Ga0495592_0036318 | 3300046454 | Bacteria | 3711 |
| 390 | Ga0495592_0827598 | 3300046454 | Bacteria | 548 |
| 391 | Ga0495629_0168375 | 3300046459 | Bacteria | 1521 |
| 392 | Ga0495629_0253751 | 3300046459 | Bacteria | 1210 |
| 393 | Ga0495629_1151731 | 3300046459 | Bacteria | 500 |
| 394 | Ga0495641_0071039 | 3300046461 | Bacteria | 1563 |
| 395 | Ga0495641_0090096 | 3300046461 | Bacteria | 1370 |
| 396 | Ga0495641_0179949 | 3300046461 | Bacteria | 946 |
| 397 | Ga0495651_0058206 | 3300046462 | Bacteria | 2965 |
| 398 | Ga0495651_0948140 | 3300046462 | Bacteria | 524 |
| 399 | Ga0495653_0009908 | 3300046463 | Bacteria | 7793 |
| 400 | Ga0495653_0051203 | 3300046463 | Bacteria | 3171 |
| 401 | Ga0495582_0244773 | 3300046473 | Bacteria | 1028 |
| 402 | Ga0495662_0008003 | 3300046476 | Bacteria | 5206 |
| 403 | Ga0495662_0581790 | 3300046476 | Bacteria | 548 |
| 404 | Ga0495664_0010379 | 3300046477 | Bacteria | 5222 |
| 405 | Ga0495664_0367311 | 3300046477 | Bacteria | 866 |
| 406 | Ga0495608_0009099 | 3300046511 | Bacteria | 6942 |
| 407 | Ga0495608_0180175 | 3300046511 | Bacteria | 1337 |
| 408 | Ga0495608_0808726 | 3300046511 | Bacteria | 553 |
| 409 | Ga0495618_0019818 | 3300046514 | Bacteria | 4140 |
| 410 | Ga0495620_0204517 | 3300046515 | Bacteria | 759 |
| 411 | Ga0495628_0018735 | 3300046516 | Bacteria | 5729 |
| 412 | Ga0495630_0792944 | 3300046517 | Bacteria | 723 |
| 413 | Ga0495652_0028241 | 3300046529 | Bacteria | 4938 |
| 414 | Ga0495652_1032869 | 3300046529 | Bacteria | 536 |
| 415 | Ga0495640_0013782 | 3300046533 | Bacteria | 6143 |
| 416 | Ga0495640_0490699 | 3300046533 | Bacteria | 748 |
| 417 | Ga0495640_0551081 | 3300046533 | Bacteria | 699 |
| 418 | Ga0495586_0007029 | 3300046535 | Bacteria | 6000 |
| 419 | Ga0495586_0246526 | 3300046535 | Bacteria | 1019 |
| 420 | Ga0495586_0354487 | 3300046535 | Bacteria | 843 |
| 421 | Ga0495587_0252404 | 3300046536 | Bacteria | 991 |
| 422 | Ga0495645_0015924 | 3300046543 | Bacteria | 5357 |
| 423 | Ga0495667_0032466 | 3300046559 | Bacteria | 3498 |
| 424 | Ga0495656_0429651 | 3300046615 | Bacteria | 694 |
| 425 | Ga0495668_0627638 | 3300046616 | Bacteria | 594 |
| 426 | Ga0495634_0018243 | 3300046642 | Bacteria | 4997 |
| 427 | Ga0495635_0008577 | 3300046663 | Bacteria | 7137 |
| 428 | Ga0495635_0125252 | 3300046663 | Bacteria | 1752 |
| 429 | Ga0495635_0452902 | 3300046663 | Bacteria | 848 |
| 430 | Ga0495588_0268103 | 3300046674 | Bacteria | 900 |
| 431 | Ga0495657_0007738 | 3300046675 | Bacteria | 8264 |
| 432 | Ga0495657_0195688 | 3300046675 | Bacteria | 1234 |
| 433 | Ga0495599_0006925 | 3300046678 | Bacteria | 6853 |
| 434 | Ga0495599_0762367 | 3300046678 | Bacteria | 555 |
| 435 | Ga0495623_0093050 | 3300046679 | Bacteria | 1846 |
| 436 | Ga0495623_0520155 | 3300046679 | Bacteria | 626 |
| 437 | Ga0495646_0011402 | 3300046680 | Bacteria | 5644 |
| 438 | Ga0495646_0463265 | 3300046680 | Bacteria | 654 |
| 439 | Ga0495613_1091854 | 3300046689 | Bacteria | 510 |
| 440 | Ga0495624_0268209 | 3300046690 | Bacteria | 1031 |
| 441 | Ga0495649_0622847 | 3300046694 | Bacteria | 532 |
| 442 | Ga0495600_0005775 | 3300046809 | Bacteria | 7475 |
| 443 | Ga0495600_0209912 | 3300046809 | Bacteria | 1248 |
| 444 | Ga0495600_0260765 | 3300046809 | Bacteria | 1101 |
| 445 | Ga0495600_0366695 | 3300046809 | Bacteria | 900 |
| 446 | Ga0495581_0335935 | 3300047315 | Bacteria | 882 |
| 447 | Ga0495581_0764312 | 3300047315 | Bacteria | 555 |
| 448 | Ga0495604_0087106 | 3300047317 | Bacteria | 2327 |
| 449 | Ga0495604_0218905 | 3300047317 | Bacteria | 1312 |
| 450 | Ga0495674_0032123 | 3300047319 | Bacteria | 4764 |
| 451 | Ga0495674_0179954 | 3300047319 | Bacteria | 1761 |
| 452 | Ga0495676_0143826 | 3300047321 | Bacteria | 1706 |
| 453 | Ga0495680_0027683 | 3300047322 | Bacteria | 4652 |
| 454 | Ga0495684_0004161 | 3300047471 | Bacteria | 11297 |
| 455 | Ga0495684_1035324 | 3300047471 | Bacteria | 519 |
| 456 | Ga0495593_0254314 | 3300047673 | Bacteria | 879 |
| 457 | Ga0495593_0423997 | 3300047673 | Bacteria | 665 |
| 458 | Ga0495602_0013833 | 3300048088 | Bacteria | 8227 |
| 459 | Ga0495602_0389883 | 3300048088 | Bacteria | 996 |
| 460 | Ga0495614_0275477 | 3300048089 | Bacteria | 774 |
| 461 | Ga0495614_0297387 | 3300048089 | Bacteria | 745 |
| 462 | Ga0496100_0908799 | 3300048903 | Bacteria | 691 |
| 463 | Ga0496101_0705386 | 3300048904 | Bacteria | 796 |
| 464 | Ga0496101_1035508 | 3300048904 | Bacteria | 645 |
| 465 | Ga0496101_1290546 | 3300048904 | Bacteria | 571 |
| 466 | Ga0496102_0030623 | 3300048905 | Bacteria | 4816 |
| 467 | Ga0496102_0120753 | 3300048905 | Bacteria | 2447 |
| 468 | Ga0496102_0337211 | 3300048905 | Bacteria | 1420 |
| 469 | Ga0496102_0407622 | 3300048905 | Bacteria | 1277 |
| 470 | Ga0496102_1208511 | 3300048905 | Bacteria | 675 |
| 471 | Ga0496103_0005052 | 3300048906 | Bacteria | 7958 |
| 472 | Ga0496103_0279531 | 3300048906 | Bacteria | 1074 |
| 473 | Ga0496104_0129439 | 3300048907 | Bacteria | 2424 |
| 474 | Ga0496104_0255136 | 3300048907 | Bacteria | 1666 |
| 475 | Ga0496104_1107408 | 3300048907 | Bacteria | 695 |
| 476 | Ga0496104_1338060 | 3300048907 | Bacteria | 619 |
| 477 | Ga0496104_1348153 | 3300048907 | Bacteria | 616 |
| 478 | Ga0496105_0288907 | 3300048908 | Bacteria | 1320 |
| 479 | Ga0496105_1018781 | 3300048908 | Bacteria | 618 |
| 480 | Ga0496106_0798608 | 3300048909 | Bacteria | 749 |
| 481 | Ga0496107_0699555 | 3300048910 | Bacteria | 745 |
| 482 | Ga0496107_0962012 | 3300048910 | Bacteria | 621 |
| 483 | Ga0496108_0401780 | 3300048911 | Bacteria | 1196 |
| 484 | Ga0496108_0671955 | 3300048911 | Bacteria | 899 |
| 485 | Ga0496109_0008096 | 3300048912 | Bacteria | 8910 |
| 486 | Ga0496109_1287039 | 3300048912 | Bacteria | 667 |
| 487 | Ga0496110_0300304 | 3300048913 | Bacteria | 1462 |
| 488 | Ga0496110_0906500 | 3300048913 | Bacteria | 788 |
| 489 | Ga0496111_0014401 | 3300048914 | Bacteria | 5401 |
| 490 | Ga0496111_0421053 | 3300048914 | Bacteria | 986 |
| 491 | Ga0496111_1208826 | 3300048914 | Bacteria | 535 |
| 492 | Ga0496112_0112019 | 3300048915 | Bacteria | 2698 |
| 493 | Ga0496112_0430170 | 3300048915 | Bacteria | 1258 |
| 494 | Ga0496113_0070533 | 3300048916 | Bacteria | 2656 |
| 495 | Ga0496113_0352038 | 3300048916 | Bacteria | 1181 |
| 496 | Ga0496114_0016801 | 3300048917 | Bacteria | 5901 |
| 497 | Ga0496114_0232886 | 3300048917 | Bacteria | 1618 |
| 498 | Ga0496114_0379960 | 3300048917 | Bacteria | 1250 |
| 499 | Ga0496114_0422358 | 3300048917 | Bacteria | 1181 |
| 500 | Ga0496115_0262751 | 3300048918 | Bacteria | 1419 |
| 501 | Ga0496115_0276667 | 3300048918 | Bacteria | 1378 |
| 502 | Ga0496115_0327839 | 3300048918 | Bacteria | 1251 |
| 503 | Ga0496119_0064873 | 3300048922 | Bacteria | 2166 |
| 504 | Ga0496119_0195410 | 3300048922 | Bacteria | 1051 |
| 505 | Ga0501306_005147 | 3300049127 | Bacteria | 1489 |
| 506 | Ga0501306_041755 | 3300049127 | Bacteria | 713 |
| 507 | Ga0501308_016907 | 3300049128 | Bacteria | 878 |
| 508 | Ga0501310_019548 | 3300049130 | Bacteria | 835 |
| 509 | Ga0501310_025008 | 3300049130 | Bacteria | 767 |
| 510 | Ga0501305_003692 | 3300049161 | Bacteria | 1750 |
| 511 | Ga0501307_003412 | 3300049162 | Bacteria | 1556 |
| 512 | Ga0501307_037304 | 3300049162 | Bacteria | 695 |
| 513 | Ga0501316_029094 | 3300049532 | Bacteria | 732 |
| 514 | Ga0501317_000571 | 3300049533 | Bacteria | 2698 |
| 515 | Ga0501317_007376 | 3300049533 | Bacteria | 1239 |
| 516 | Ga0501318_000382 | 3300049534 | Bacteria | 2728 |
| 517 | Ga0501318_009260 | 3300049534 | Bacteria | 1070 |
| 518 | Ga0501320_047908 | 3300049536 | Bacteria | 576 |
| 519 | Ga0501320_050847 | 3300049536 | Bacteria | 564 |
| 520 | Ga0501321_033787 | 3300049537 | Bacteria | 694 |
| 521 | Ga0501322_006423 | 3300049538 | Bacteria | 837 |
| 522 | Ga0501324_023152 | 3300049540 | Bacteria | 646 |
| 523 | Ga0501325_001001 | 3300049541 | Bacteria | 1607 |
| 524 | Ga0501325_007828 | 3300049541 | Bacteria | 914 |
| 525 | Ga0501325_019830 | 3300049541 | Bacteria | 700 |
| 526 | Ga0501032_0025353 | 3300049569 | Bacteria | 4088 |
| 527 | Ga0501032_0388183 | 3300049569 | Bacteria | 897 |
| 528 | Ga0501032_0635794 | 3300049569 | Bacteria | 678 |
| 529 | Ga0501033_0176599 | 3300049570 | Bacteria | 1532 |
| 530 | Ga0501034_0378229 | 3300049571 | Bacteria | 1341 |
| 531 | Ga0501034_0517840 | 3300049571 | Bacteria | 1105 |
| 532 | Ga0501036_0177346 | 3300049572 | Bacteria | 1794 |
| 533 | Ga0501039_0068572 | 3300049575 | Bacteria | 2753 |
| 534 | Ga0501039_0113661 | 3300049575 | Bacteria | 2117 |
| 535 | Ga0501039_0765756 | 3300049575 | Bacteria | 754 |
| 536 | Ga0501039_1119976 | 3300049575 | Bacteria | 610 |
| 537 | Ga0501040_0206605 | 3300049576 | Bacteria | 1395 |
| 538 | Ga0501041_0296712 | 3300049577 | Bacteria | 1018 |
| 539 | Ga0501043_0277890 | 3300049579 | Bacteria | 1284 |
| 540 | Ga0501043_0426685 | 3300049579 | Bacteria | 999 |
| 541 | Ga0501043_0529730 | 3300049579 | Bacteria | 877 |
| 542 | Ga0501046_0146996 | 3300049580 | Bacteria | 1780 |
| 543 | Ga0501048_0029778 | 3300049582 | Bacteria | 3954 |
| 544 | Ga0501067_0135302 | 3300049583 | Bacteria | 1372 |
| 545 | Ga0501068_1039765 | 3300049584 | Bacteria | 541 |
| 546 | Ga0501069_0005427 | 3300049585 | Bacteria | 6629 |
| 547 | Ga0501069_0178944 | 3300049585 | Bacteria | 1225 |
| 548 | Ga0501069_0941489 | 3300049585 | Bacteria | 526 |
| 549 | Ga0501070_0006873 | 3300049586 | Bacteria | 9678 |
| 550 | Ga0501070_0013575 | 3300049586 | Bacteria | 6866 |
| 551 | Ga0501070_0099196 | 3300049586 | Bacteria | 2409 |
| 552 | Ga0501070_0206820 | 3300049586 | Bacteria | 1611 |
| 553 | Ga0501071_0039375 | 3300049587 | Bacteria | 3381 |
| 554 | Ga0501071_0354349 | 3300049587 | Bacteria | 1117 |
| 555 | Ga0501072_0047842 | 3300049588 | Bacteria | 3368 |
| 556 | Ga0501072_0087547 | 3300049588 | Bacteria | 2471 |
| 557 | Ga0501072_1565234 | 3300049588 | Bacteria | 508 |
| 558 | Ga0501073_0297204 | 3300049589 | Bacteria | 1114 |
| 559 | Ga0501075_0136382 | 3300049591 | Bacteria | 1869 |
| 560 | Ga0501075_0198760 | 3300049591 | Bacteria | 1529 |
| 561 | Ga0501075_0844784 | 3300049591 | Bacteria | 696 |
| 562 | Ga0501076_0003905 | 3300049592 | Bacteria | 10504 |
| 563 | Ga0501076_0413544 | 3300049592 | Bacteria | 1109 |
| 564 | Ga0501077_0264462 | 3300049593 | Bacteria | 1094 |
| 565 | Ga0501079_0328170 | 3300049741 | Bacteria | 1198 |
| 566 | Ga0501079_1672699 | 3300049741 | Bacteria | 500 |
| 567 | Ga0501080_0004134 | 3300049742 | Bacteria | 12866 |
| 568 | Ga0501080_0259013 | 3300049742 | Bacteria | 1585 |
| 569 | Ga0501080_1132297 | 3300049742 | Bacteria | 675 |
| 570 | Ga0501081_0020597 | 3300049743 | Bacteria | 4395 |
| 571 | Ga0501081_0509230 | 3300049743 | Bacteria | 897 |
| 572 | Ga0501083_0856737 | 3300049744 | Bacteria | 591 |
| 573 | Ga0501035_1076064 | 3300049822 | Bacteria | 629 |
| 574 | Ga0501044_0008850 | 3300049823 | Bacteria | 11009 |
| 575 | Ga0501044_0748542 | 3300049823 | Bacteria | 860 |
| 576 | Ga0501044_1268146 | 3300049823 | Bacteria | 604 |
| 577 | Ga0501045_0215113 | 3300049824 | Bacteria | 1431 |
| 578 | Ga0501045_0638090 | 3300049824 | Bacteria | 787 |
| 579 | nmdc:mga03683_573088_c1 | 3300050489 | Bacteria | 551 |
| 580 | nmdc:mga03n38_349267_c1 | 3300050490 | Bacteria | 805 |
| 581 | nmdc:mga03n38_6080_c1 | 3300050490 | Bacteria | 4168 |
| 582 | nmdc:mga03n38_6768_c1 | 3300050490 | Bacteria | 4010 |
| 583 | nmdc:mga00v17_3224_c1 | 3300050491 | Bacteria | 8405 |
| 584 | nmdc:mga00v17_33777_c1 | 3300050491 | Bacteria | 3034 |
| 585 | nmdc:mga00v17_404833_c1 | 3300050491 | Bacteria | 887 |
| 586 | nmdc:mga00v17_701231_c1 | 3300050491 | Bacteria | 649 |
| 587 | nmdc:mga00v17_932492_c1 | 3300050491 | Bacteria | 549 |
| 588 | nmdc:mga0yw44_12755_c1 | 3300050492 | Bacteria | 4395 |
| 589 | nmdc:mga0yw44_173021_c1 | 3300050492 | Bacteria | 1419 |
| 590 | nmdc:mga0yw44_299857_c1 | 3300050492 | Bacteria | 1077 |
| 591 | nmdc:mga0yw44_544996_c1 | 3300050492 | Bacteria | 788 |
| 592 | nmdc:mga0yw44_77900_c1 | 3300050492 | Bacteria | 2072 |
| 593 | nmdc:mga0yw44_803735_c1 | 3300050492 | Bacteria | 639 |
| 594 | nmdc:mga06z11_1560_c1 | 3300050494 | Bacteria | 8521 |
| 595 | nmdc:mga04h51_4651_c1 | 3300050495 | Bacteria | 3433 |
| 596 | nmdc:mga04h51_6700_c1 | 3300050495 | Bacteria | 3003 |
| 597 | nmdc:mga07m45_362760_c1 | 3300050496 | Bacteria | 842 |
| 598 | nmdc:mga07m45_406968_c1 | 3300050496 | Bacteria | 790 |
| 599 | nmdc:mga07m45_715152_c1 | 3300050496 | Bacteria | 576 |
| 600 | nmdc:mga0sz30_589827_c1 | 3300050516 | Bacteria | 503 |
| 601 | Ga0495612_0090722 | 3300053078 | Bacteria | 1293 |
| 602 | Ga0495595_0072157 | 3300053084 | Bacteria | 1633 |
| 603 | Ga0495595_0469064 | 3300053084 | Bacteria | 640 |
| 604 | Ga0495619_0005374 | 3300053085 | Bacteria | 8112 |
| 605 | Ga0495619_0063850 | 3300053085 | Bacteria | 2454 |
| 606 | Ga0495619_0138558 | 3300053085 | Bacteria | 1674 |
| 607 | Ga0495619_0232043 | 3300053085 | Bacteria | 1279 |
| 608 | Ga0500641_0016659 | 3300053096 | Bacteria | 2739 |
| 609 | Ga0500641_0091319 | 3300053096 | Bacteria | 1300 |
| 610 | Ga0500554_010844 | 3300053102 | Bacteria | 2237 |
| 611 | Ga0500633_0070375 | 3300053160 | Bacteria | 1248 |
| 612 | Ga0501084_0305167 | 3300054114 | Bacteria | 1344 |
| 613 | Ga0587066_067399 | 3300059490 | Bacteria | 745 |
| 614 | Ga0587066_096158 | 3300059490 | Bacteria | 666 |
| 615 | Ga0587070_036856 | 3300059491 | Bacteria | 917 |
| 616 | Ga0587073_0040403 | 3300059492 | Bacteria | 1013 |
| 617 | Ga0587073_0079602 | 3300059492 | Bacteria | 810 |
| 618 | Ga0587077_012193 | 3300059493 | Bacteria | 1369 |
| 619 | Ga0587077_027098 | 3300059493 | Bacteria | 1063 |
| 620 | Ga0587077_243425 | 3300059493 | Bacteria | 517 |
| 621 | Ga0587080_056879 | 3300059503 | Bacteria | 753 |
| 622 | Ga0587083_0038089 | 3300059505 | Bacteria | 993 |
| 623 | Ga0587083_0116209 | 3300059505 | Bacteria | 686 |
| 624 | Ga0587086_002882 | 3300059507 | Bacteria | 1681 |
| 625 | Ga0587090_014925 | 3300059510 | Bacteria | 1142 |
| 626 | Ga0587094_044014 | 3300059513 | Bacteria | 736 |
| 627 | Ga0587098_063711 | 3300059604 | Bacteria | 584 |
| 628 | Ga0587106_005262 | 3300059605 | Bacteria | 1471 |
| 629 | Ga0587101_002171 | 3300059623 | Bacteria | 1832 |
| 630 | Ga0587101_018095 | 3300059623 | Bacteria | 984 |
| 631 | Ga0587101_033249 | 3300059623 | Bacteria | 816 |
| 632 | Ga0587113_031239 | 3300059625 | Bacteria | 605 |
| 633 | Ga0587068_025290 | 3300059641 | Bacteria | 999 |
| 634 | Ga0587068_036272 | 3300059641 | Bacteria | 877 |
| 635 | Ga0587072_002939 | 3300059643 | Bacteria | 2345 |
| 636 | Ga0587072_025288 | 3300059643 | Bacteria | 1079 |
| 637 | Ga0587075_065525 | 3300059644 | Bacteria | 664 |
| 638 | Ga0587076_007466 | 3300059645 | Bacteria | 1495 |
| 639 | Ga0587076_022215 | 3300059645 | Bacteria | 1058 |
| 640 | Ga0587079_044922 | 3300059647 | Bacteria | 906 |
| 641 | Ga0587105_028639 | 3300059651 | Bacteria | 523 |
| 642 | Ga0587107_031393 | 3300059652 | Bacteria | 810 |
| 643 | Ga0587124_027662 | 3300059660 | Bacteria | 612 |
| 644 | Ga0587071_008453 | 3300060344 | Bacteria | 1670 |
| 645 | Ga0587071_059618 | 3300060344 | Bacteria | 808 |
| 646 | Ga0501082_0082024 | 3300060353 | Bacteria | 2782 |
| 647 | Ga0501082_0085561 | 3300060353 | Bacteria | 2719 |
| 648 | Ga0466962_0004292 | 3300061719 | Bacteria | 6831 |
| 649 | Ga0466962_0061905 | 3300061719 | Bacteria | 1786 |
| 650 | Ga0530510_0063999 | 3300061734 | Bacteria | 2663 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0153453 | Ga0453684_0153453_454_723 | 84 |
| 2 | 3300044658 | Ga0466972_0129038 | Ga0466972_0129038_743_1012 | 86 |
| 3 | 3300044694 | Ga0466963_0009270 | Ga0466963_0009270_37_306 | 86 |
| 4 | 3300044694 | Ga0466963_0082336 | Ga0466963_0082336_1126_1395 | 86 |
| 5 | 3300044706 | Ga0466964_0225089 | Ga0466964_0225089_372_641 | 86 |
| 6 | 3300044719 | Ga0466971_0126774 | Ga0466971_0126774_17_286 | 86 |
| 7 | 3300044842 | Ga0466957_0002716 | Ga0466957_0002716_4332_4601 | 86 |
| 8 | 3300045836 | Ga0466958_0064232 | Ga0466958_0064232_946_1215 | 86 |
| 9 | 3300045976 | Ga0466967_0068905 | Ga0466967_0068905_2704_2973 | 86 |
| 10 | 3300045976 | Ga0466967_1284717 | Ga0466967_1284717_10_276 | 86 |
| 11 | 3300045976 | Ga0466967_1515293 | Ga0466967_1515293_70_420 | 86 |
| 12 | 3300061719 | Ga0466962_0061905 | Ga0466962_0061905_1072_1341 | 86 |
| 13 | 3300011119 | Ga0105246_10158771 | Ga0105246_101587712 | 87 |
| 14 | 3300044658 | Ga0466972_0030280 | Ga0466972_0030280_122_397 | 87 |
| 15 | 3300044684 | Ga0466966_0021458 | Ga0466966_0021458_3679_3954 | 87 |
| 16 | iso_pu_bacteria | 2868088558 | 2868090554 | 87 |
| 17 | 3300005330 | Ga0070690_101235759 | Ga0070690_1012357591 | 88 |
| 18 | 3300005333 | Ga0070677_10731688 | Ga0070677_107316882 | 88 |
| 19 | 3300005344 | Ga0070661_101373986 | Ga0070661_1013739861 | 88 |
| 20 | 3300005354 | Ga0070675_102236886 | Ga0070675_1022368862 | 88 |
| 21 | 3300005356 | Ga0070674_100270107 | Ga0070674_1002701071 | 88 |
| 22 | 3300005364 | Ga0070673_101664321 | Ga0070673_1016643212 | 88 |
| 23 | 3300005441 | Ga0070700_100958072 | Ga0070700_1009580722 | 88 |
| 24 | 3300005455 | Ga0070663_100177359 | Ga0070663_1001773591 | 88 |
| 25 | 3300005456 | Ga0070678_100382263 | Ga0070678_1003822633 | 88 |
| 26 | 3300005459 | Ga0068867_100154927 | Ga0068867_1001549274 | 88 |
| 27 | 3300005535 | Ga0070684_100305772 | Ga0070684_1003057722 | 88 |
| 28 | 3300005547 | Ga0070693_101242679 | Ga0070693_1012426791 | 88 |
| 29 | 3300025937 | Ga0207669_10201528 | Ga0207669_102015282 | 88 |
| 30 | 3300025940 | Ga0207691_10584926 | Ga0207691_105849262 | 88 |
| 31 | 3300026089 | Ga0207648_10161787 | Ga0207648_101617874 | 88 |
| 32 | 3300026095 | Ga0207676_10381580 | Ga0207676_103815801 | 88 |
| 33 | 3300041459 | Ga0451800_0021290 | Ga0451800_0021290_511_777 | 88 |
| 34 | 3300041505 | Ga0451849_0617100 | Ga0451849_0617100_457_723 | 88 |
| 35 | 3300042439 | Ga0439464_0113399 | Ga0439464_0113399_75_344 | 88 |
| 36 | 3300042531 | Ga0450918_094996 | Ga0450918_094996_48_317 | 88 |
| 37 | 3300046515 | Ga0495620_0204517 | Ga0495620_0204517_284_550 | 88 |
| 38 | 3300049571 | Ga0501034_0378229 | Ga0501034_0378229_141_413 | 88 |
| 39 | 3300049584 | Ga0501068_1039765 | Ga0501068_1039765_53_325 | 88 |
| 40 | 3300049586 | Ga0501070_0206820 | Ga0501070_0206820_505_777 | 88 |
| 41 | 3300049588 | Ga0501072_0087547 | Ga0501072_0087547_989_1261 | 88 |
| 42 | 3300049742 | Ga0501080_0259013 | Ga0501080_0259013_442_714 | 88 |
| 43 | iso_pu_bacteria | 2799112218 | 2799184994 | 88 |
| 44 | iso_pu_bacteria | 2837268691 | 2837269022 | 88 |
| 45 | 3300031727 | Ga0316576_10009973 | Ga0316576_100099734 | 89 |
| 46 | 3300031728 | Ga0316578_10228139 | Ga0316578_102281392 | 89 |
| 47 | 3300035398 | Ga0316574_0049174 | Ga0316574_0049174_2282_2554 | 89 |
| 48 | 3300041511 | Ga0451855_0317925 | Ga0451855_0317925_53_328 | 89 |
| 49 | 3300049569 | Ga0501032_0025353 | Ga0501032_0025353_2396_2668 | 89 |
| 50 | 3300049571 | Ga0501034_0517840 | Ga0501034_0517840_611_883 | 89 |
| 51 | 3300049579 | Ga0501043_0277890 | Ga0501043_0277890_811_1083 | 89 |
| 52 | 3300049586 | Ga0501070_0006873 | Ga0501070_0006873_5981_6253 | 89 |
| 53 | 3300049823 | Ga0501044_0008850 | Ga0501044_0008850_5130_5402 | 89 |
| 54 | 3300050496 | nmdc:mga07m45_362760_c1 | nmdc:mga07m45_362760_c1_474_749 | 89 |
| 55 | 3300053085 | Ga0495619_0005374 | Ga0495619_0005374_4519_4788 | 89 |
| 56 | 3300004800 | Ga0058861_11933151 | Ga0058861_119331512 | 90 |
| 57 | 3300005340 | Ga0070689_100962810 | Ga0070689_1009628102 | 90 |
| 58 | 3300005344 | Ga0070661_101223654 | Ga0070661_1012236542 | 90 |
| 59 | 3300005354 | Ga0070675_101528454 | Ga0070675_1015284541 | 90 |
| 60 | 3300005441 | Ga0070700_101107743 | Ga0070700_1011077431 | 90 |
| 61 | 3300005456 | Ga0070678_100666381 | Ga0070678_1006663812 | 90 |
| 62 | 3300005618 | Ga0068864_100762876 | Ga0068864_1007628762 | 90 |
| 63 | 3300006846 | Ga0075430_101373158 | Ga0075430_1013731581 | 90 |
| 64 | 3300009553 | Ga0105249_11192357 | Ga0105249_111923572 | 90 |
| 65 | 3300014326 | Ga0157380_13422903 | Ga0157380_134229032 | 90 |
| 66 | 3300020081 | Ga0206354_10057345 | Ga0206354_100573452 | 90 |
| 67 | 3300025934 | Ga0207686_11652325 | Ga0207686_116523252 | 90 |
| 68 | 3300025961 | Ga0207712_10516564 | Ga0207712_105165643 | 90 |
| 69 | 3300026075 | Ga0207708_10381432 | Ga0207708_103814323 | 90 |
| 70 | 3300031995 | Ga0307409_101218585 | Ga0307409_1012185852 | 90 |
| 71 | 3300036457 | Ga0265778_016495 | Ga0265778_016495_129_401 | 90 |
| 72 | 3300039438 | Ga0436360_0626054 | Ga0436360_0626054_1148_1465 | 90 |
| 73 | 3300046616 | Ga0495668_0627638 | Ga0495668_0627638_96_374 | 90 |
| 74 | 3300047471 | Ga0495684_1035324 | Ga0495684_1035324_15_287 | 90 |
| 75 | 3300049536 | Ga0501320_050847 | Ga0501320_050847_45_317 | 90 |
| 76 | 3300049585 | Ga0501069_0005427 | Ga0501069_0005427_5766_6041 | 90 |
| 77 | 3300049586 | Ga0501070_0099196 | Ga0501070_0099196_205_480 | 90 |
| 78 | 3300049742 | Ga0501080_0004134 | Ga0501080_0004134_10790_11065 | 90 |
| 79 | 3300049744 | Ga0501083_0856737 | Ga0501083_0856737_66_341 | 90 |
| 80 | 3300049823 | Ga0501044_0748542 | Ga0501044_0748542_538_813 | 90 |
| 81 | iso_pu_bacteria | 2643221711 | 2644607519 | 90 |
| 82 | iso_pu_bacteria | 2739367653 | 2739602969 | 90 |
| 83 | iso_pu_bacteria | 2811994882 | 2812373716 | 90 |
| 84 | iso_pu_bacteria | 2816332305 | 2817508517 | 90 |
| 85 | iso_pu_bacteria | 2818991458 | 2819665367 | 90 |
| 86 | iso_pu_bacteria | 2818991462 | 2819691424 | 90 |
| 87 | iso_pu_bacteria | 2818991469 | 2819727540 | 90 |
| 88 | iso_pu_bacteria | 2857727296 | 2857727953 | 90 |
| 89 | 3300005329 | Ga0070683_100273207 | Ga0070683_1002732074 | 91 |
| 90 | 3300005347 | Ga0070668_100319542 | Ga0070668_1003195423 | 91 |
| 91 | 3300005535 | Ga0070684_100499327 | Ga0070684_1004993271 | 91 |
| 92 | 3300005577 | Ga0068857_100214101 | Ga0068857_1002141014 | 91 |
| 93 | 3300013102 | Ga0157371_11117769 | Ga0157371_111177692 | 91 |
| 94 | 3300013297 | Ga0157378_11089778 | Ga0157378_110897781 | 91 |
| 95 | 3300025944 | Ga0207661_10030802 | Ga0207661_100308024 | 91 |
| 96 | 3300026088 | Ga0207641_12252105 | Ga0207641_122521051 | 91 |
| 97 | 3300026116 | Ga0207674_10225152 | Ga0207674_102251524 | 91 |
| 98 | 3300045976 | Ga0466967_0102456 | Ga0466967_0102456_635_913 | 91 |
| 99 | 3300048913 | Ga0496110_0906500 | Ga0496110_0906500_39_317 | 91 |
| 100 | 3300049583 | Ga0501067_0135302 | Ga0501067_0135302_312_602 | 91 |
| 101 | iso_pu_bacteria | 2818991318 | 2819426330 | 91 |
| 102 | 3300005355 | Ga0070671_101118933 | Ga0070671_1011189332 | 92 |
| 103 | 3300005983 | Ga0081540_1060450 | Ga0081540_10604502 | 92 |
| 104 | 3300006177 | Ga0075362_10573466 | Ga0075362_105734662 | 92 |
| 105 | 3300022467 | Ga0224712_10293475 | Ga0224712_102934751 | 92 |
| 106 | 3300030732 | Ga0316176_1044392 | Ga0316176_10443922 | 92 |
| 107 | 3300044694 | Ga0466963_0127964 | Ga0466963_0127964_1022_1303 | 92 |
| 108 | 3300045976 | Ga0466967_0039429 | Ga0466967_0039429_2399_2680 | 92 |
| 109 | 3300050491 | nmdc:mga00v17_33777_c1 | nmdc:mga00v17_33777_c1_201_479 | 92 |
| 110 | 3300050492 | nmdc:mga0yw44_12755_c1 | nmdc:mga0yw44_12755_c1_3981_4259 | 92 |
| 111 | iso_pu_bacteria | 2643221567 | 2643851177 | 92 |
| 112 | iso_pu_bacteria | 2643221624 | 2644134966 | 92 |
| 113 | iso_pu_bacteria | 2731639228 | 2731908933 | 92 |
| 114 | iso_pu_bacteria | 2784132109 | 2784471475 | 92 |
| 115 | iso_pu_bacteria | 2919446982 | 2919449328 | 92 |
| 116 | 3300005329 | Ga0070683_101632912 | Ga0070683_1016329121 | 93 |
| 117 | 3300005367 | Ga0070667_100079087 | Ga0070667_1000790874 | 93 |
| 118 | 3300006038 | Ga0075365_11061651 | Ga0075365_110616512 | 93 |
| 119 | 3300006042 | Ga0075368_10025723 | Ga0075368_100257234 | 93 |
| 120 | 3300006042 | Ga0075368_10123757 | Ga0075368_101237573 | 93 |
| 121 | 3300006048 | Ga0075363_100060635 | Ga0075363_1000606355 | 93 |
| 122 | 3300006051 | Ga0075364_11074626 | Ga0075364_110746262 | 93 |
| 123 | 3300006163 | Ga0070715_10433980 | Ga0070715_104339801 | 93 |
| 124 | 3300006195 | Ga0075366_11053888 | Ga0075366_110538882 | 93 |
| 125 | 3300006353 | Ga0075370_10078009 | Ga0075370_100780094 | 93 |
| 126 | 3300006353 | Ga0075370_10336572 | Ga0075370_103365722 | 93 |
| 127 | 3300009177 | Ga0105248_12578970 | Ga0105248_125789701 | 93 |
| 128 | 3300020610 | Ga0154015_1147349 | Ga0154015_11473493 | 93 |
| 129 | 3300025909 | Ga0207705_10847246 | Ga0207705_108472461 | 93 |
| 130 | 3300025931 | Ga0207644_10467299 | Ga0207644_104672993 | 93 |
| 131 | 3300025986 | Ga0207658_10023394 | Ga0207658_100233945 | 93 |
| 132 | 3300026088 | Ga0207641_10703894 | Ga0207641_107038943 | 93 |
| 133 | 3300027866 | Ga0209813_10001880 | Ga0209813_100018805 | 93 |
| 134 | 3300031691 | Ga0316579_10119546 | Ga0316579_101195462 | 93 |
| 135 | 3300031727 | Ga0316576_10006920 | Ga0316576_100069207 | 93 |
| 136 | 3300031727 | Ga0316576_10049104 | Ga0316576_100491043 | 93 |
| 137 | 3300031728 | Ga0316578_10012098 | Ga0316578_100120987 | 93 |
| 138 | 3300032133 | Ga0316583_10189270 | Ga0316583_101892702 | 93 |
| 139 | 3300032137 | Ga0316585_10186517 | Ga0316585_101865172 | 93 |
| 140 | 3300032139 | Ga0316580_10064417 | Ga0316580_100644172 | 93 |
| 141 | 3300032139 | Ga0316580_10088221 | Ga0316580_100882212 | 93 |
| 142 | 3300032168 | Ga0316593_10000304 | Ga0316593_1000030410 | 93 |
| 143 | 3300033524 | Ga0316592_1039236 | Ga0316592_10392363 | 93 |
| 144 | 3300033524 | Ga0316592_1088949 | Ga0316592_10889492 | 93 |
| 145 | 3300033528 | Ga0316588_1046325 | Ga0316588_10463252 | 93 |
| 146 | 3300033541 | Ga0316596_1014012 | Ga0316596_10140124 | 93 |
| 147 | 3300035398 | Ga0316574_0000119 | Ga0316574_0000119_7662_7949 | 93 |
| 148 | 3300035398 | Ga0316574_0003558 | Ga0316574_0003558_1343_1627 | 93 |
| 149 | 3300036647 | Ga0316582_0331808 | Ga0316582_0331808_486_773 | 93 |
| 150 | 3300036712 | Ga0316584_0055102 | Ga0316584_0055102_1996_2283 | 93 |
| 151 | 3300036712 | Ga0316584_0360323 | Ga0316584_0360323_367_651 | 93 |
| 152 | 3300039438 | Ga0436360_0821879 | Ga0436360_0821879_57_362 | 93 |
| 153 | 3300041453 | Ga0451797_1542332 | Ga0451797_1542332_189_473 | 93 |
| 154 | 3300041509 | Ga0451843_0895626 | Ga0451843_0895626_837_1118 | 93 |
| 155 | 3300049575 | Ga0501039_0765756 | Ga0501039_0765756_380_670 | 93 |
| 156 | 3300049587 | Ga0501071_0354349 | Ga0501071_0354349_513_803 | 93 |
| 157 | 3300050489 | nmdc:mga03683_573088_c1 | nmdc:mga03683_573088_c1_190_471 | 93 |
| 158 | 3300050490 | nmdc:mga03n38_6080_c1 | nmdc:mga03n38_6080_c1_2629_2910 | 93 |
| 159 | 3300050490 | nmdc:mga03n38_6768_c1 | nmdc:mga03n38_6768_c1_475_759 | 93 |
| 160 | 3300050491 | nmdc:mga00v17_932492_c1 | nmdc:mga00v17_932492_c1_163_444 | 93 |
| 161 | 3300050494 | nmdc:mga06z11_1560_c1 | nmdc:mga06z11_1560_c1_1664_1948 | 93 |
| 162 | 3300050495 | nmdc:mga04h51_6700_c1 | nmdc:mga04h51_6700_c1_820_1104 | 93 |
| 163 | 3300050496 | nmdc:mga07m45_406968_c1 | nmdc:mga07m45_406968_c1_168_449 | 93 |
| 164 | 3300050516 | nmdc:mga0sz30_589827_c1 | nmdc:mga0sz30_589827_c1_179_460 | 93 |
| 165 | 3300059644 | Ga0587075_065525 | Ga0587075_065525_217_501 | 93 |
| 166 | iso_pu_bacteria | 2808606365 | 2808872985 | 93 |
| 167 | 3300005329 | Ga0070683_100311672 | Ga0070683_1003116724 | 94 |
| 168 | 3300005329 | Ga0070683_101183110 | Ga0070683_1011831102 | 94 |
| 169 | 3300005337 | Ga0070682_101106103 | Ga0070682_1011061032 | 94 |
| 170 | 3300005338 | Ga0068868_101052770 | Ga0068868_1010527702 | 94 |
| 171 | 3300005456 | Ga0070678_102161360 | Ga0070678_1021613602 | 94 |
| 172 | 3300005616 | Ga0068852_102641118 | Ga0068852_1026411182 | 94 |
| 173 | 3300013102 | Ga0157371_10611080 | Ga0157371_106110802 | 94 |
| 174 | 3300013306 | Ga0163162_10081947 | Ga0163162_100819476 | 94 |
| 175 | 3300013306 | Ga0163162_11491256 | Ga0163162_114912561 | 94 |
| 176 | 3300013307 | Ga0157372_10787012 | Ga0157372_107870122 | 94 |
| 177 | 3300013308 | Ga0157375_11289503 | Ga0157375_112895032 | 94 |
| 178 | 3300020076 | Ga0206355_1069744 | Ga0206355_10697442 | 94 |
| 179 | 3300025898 | Ga0207692_10380793 | Ga0207692_103807932 | 94 |
| 180 | 3300025932 | Ga0207690_10961151 | Ga0207690_109611512 | 94 |
| 181 | 3300026023 | Ga0207677_10808731 | Ga0207677_108087312 | 94 |
| 182 | 3300026121 | Ga0207683_10491198 | Ga0207683_104911983 | 94 |
| 183 | 3300031731 | Ga0307405_10696624 | Ga0307405_106966242 | 94 |
| 184 | 3300031852 | Ga0307410_10335247 | Ga0307410_103352472 | 94 |
| 185 | 3300031995 | Ga0307409_100592740 | Ga0307409_1005927402 | 94 |
| 186 | 3300037466 | Ga0395898_0353407 | Ga0395898_0353407_886_1176 | 94 |
| 187 | 3300041413 | Ga0439465_0309839 | Ga0439465_0309839_29_319 | 94 |
| 188 | 3300041452 | Ga0451793_1462454 | Ga0451793_1462454_51_335 | 94 |
| 189 | 3300042002 | Ga0439442_034482 | Ga0439442_034482_117_407 | 94 |
| 190 | 3300042156 | Ga0439446_0219087 | Ga0439446_0219087_297_587 | 94 |
| 191 | 3300044683 | Ga0466965_0170635 | Ga0466965_0170635_442_729 | 94 |
| 192 | 3300044683 | Ga0466965_0214365 | Ga0466965_0214365_141_428 | 94 |
| 193 | 3300044693 | Ga0466961_0044759 | Ga0466961_0044759_1806_2093 | 94 |
| 194 | 3300044706 | Ga0466964_0067090 | Ga0466964_0067090_1120_1407 | 94 |
| 195 | 3300044719 | Ga0466971_0096897 | Ga0466971_0096897_257_544 | 94 |
| 196 | 3300044735 | Ga0466968_0047855 | Ga0466968_0047855_1129_1416 | 94 |
| 197 | 3300044842 | Ga0466957_0005571 | Ga0466957_0005571_3850_4137 | 94 |
| 198 | 3300045836 | Ga0466958_0016958 | Ga0466958_0016958_3279_3566 | 94 |
| 199 | 3300046459 | Ga0495629_0253751 | Ga0495629_0253751_577_867 | 94 |
| 200 | 3300046535 | Ga0495586_0246526 | Ga0495586_0246526_349_639 | 94 |
| 201 | 3300046678 | Ga0495599_0762367 | Ga0495599_0762367_141_428 | 94 |
| 202 | 3300046809 | Ga0495600_0209912 | Ga0495600_0209912_749_1039 | 94 |
| 203 | 3300048903 | Ga0496100_0908799 | Ga0496100_0908799_43_333 | 94 |
| 204 | 3300048904 | Ga0496101_0705386 | Ga0496101_0705386_62_352 | 94 |
| 205 | 3300048905 | Ga0496102_0120753 | Ga0496102_0120753_908_1198 | 94 |
| 206 | 3300048905 | Ga0496102_1208511 | Ga0496102_1208511_325_615 | 94 |
| 207 | 3300048906 | Ga0496103_0005052 | Ga0496103_0005052_4269_4559 | 94 |
| 208 | 3300048907 | Ga0496104_0129439 | Ga0496104_0129439_2017_2316 | 94 |
| 209 | 3300048907 | Ga0496104_1348153 | Ga0496104_1348153_135_425 | 94 |
| 210 | 3300048908 | Ga0496105_0288907 | Ga0496105_0288907_354_644 | 94 |
| 211 | 3300048908 | Ga0496105_1018781 | Ga0496105_1018781_147_446 | 94 |
| 212 | 3300048910 | Ga0496107_0699555 | Ga0496107_0699555_151_441 | 94 |
| 213 | 3300048912 | Ga0496109_0008096 | Ga0496109_0008096_7882_8172 | 94 |
| 214 | 3300048913 | Ga0496110_0300304 | Ga0496110_0300304_607_897 | 94 |
| 215 | 3300048914 | Ga0496111_0014401 | Ga0496111_0014401_3035_3325 | 94 |
| 216 | 3300048914 | Ga0496111_0421053 | Ga0496111_0421053_659_958 | 94 |
| 217 | 3300048915 | Ga0496112_0112019 | Ga0496112_0112019_1023_1313 | 94 |
| 218 | 3300048916 | Ga0496113_0352038 | Ga0496113_0352038_334_624 | 94 |
| 219 | 3300048917 | Ga0496114_0232886 | Ga0496114_0232886_1179_1469 | 94 |
| 220 | 3300048917 | Ga0496114_0422358 | Ga0496114_0422358_440_727 | 94 |
| 221 | 3300048918 | Ga0496115_0276667 | Ga0496115_0276667_547_837 | 94 |
| 222 | 3300048922 | Ga0496119_0064873 | Ga0496119_0064873_636_926 | 94 |
| 223 | 3300048922 | Ga0496119_0195410 | Ga0496119_0195410_296_580 | 94 |
| 224 | 3300049128 | Ga0501308_016907 | Ga0501308_016907_69_359 | 94 |
| 225 | 3300049161 | Ga0501305_003692 | Ga0501305_003692_219_509 | 94 |
| 226 | 3300049162 | Ga0501307_003412 | Ga0501307_003412_418_708 | 94 |
| 227 | 3300049532 | Ga0501316_029094 | Ga0501316_029094_346_636 | 94 |
| 228 | 3300049533 | Ga0501317_000571 | Ga0501317_000571_213_503 | 94 |
| 229 | 3300049534 | Ga0501318_000382 | Ga0501318_000382_2072_2362 | 94 |
| 230 | 3300049541 | Ga0501325_007828 | Ga0501325_007828_279_569 | 94 |
| 231 | 3300049541 | Ga0501325_019830 | Ga0501325_019830_287_577 | 94 |
| 232 | 3300049585 | Ga0501069_0178944 | Ga0501069_0178944_899_1195 | 94 |
| 233 | 3300059507 | Ga0587086_002882 | Ga0587086_002882_524_814 | 94 |
| 234 | 3300059623 | Ga0587101_002171 | Ga0587101_002171_562_852 | 94 |
| 235 | 3300059641 | Ga0587068_036272 | Ga0587068_036272_562_852 | 94 |
| 236 | 3300059643 | Ga0587072_002939 | Ga0587072_002939_898_1188 | 94 |
| 237 | 3300060344 | Ga0587071_008453 | Ga0587071_008453_887_1177 | 94 |
| 238 | 3300061719 | Ga0466962_0004292 | Ga0466962_0004292_5541_5828 | 94 |
| 239 | iso_pu_bacteria | 3001889506 | 3001890597 | 94 |
| 240 | 3300001989 | JGI24739J22299_10252701 | JGI24739J22299_102527012 | 95 |
| 241 | 3300005331 | Ga0070670_100811020 | Ga0070670_1008110202 | 95 |
| 242 | 3300005333 | Ga0070677_10116410 | Ga0070677_101164103 | 95 |
| 243 | 3300005337 | Ga0070682_100107395 | Ga0070682_1001073955 | 95 |
| 244 | 3300005339 | Ga0070660_100432332 | Ga0070660_1004323323 | 95 |
| 245 | 3300005340 | Ga0070689_101297147 | Ga0070689_1012971472 | 95 |
| 246 | 3300005345 | Ga0070692_10120656 | Ga0070692_101206563 | 95 |
| 247 | 3300005347 | Ga0070668_100519866 | Ga0070668_1005198663 | 95 |
| 248 | 3300005354 | Ga0070675_100105721 | Ga0070675_1001057215 | 95 |
| 249 | 3300005355 | Ga0070671_100384485 | Ga0070671_1003844853 | 95 |
| 250 | 3300005356 | Ga0070674_100330570 | Ga0070674_1003305702 | 95 |
| 251 | 3300005364 | Ga0070673_100310990 | Ga0070673_1003109901 | 95 |
| 252 | 3300005367 | Ga0070667_102132150 | Ga0070667_1021321501 | 95 |
| 253 | 3300005455 | Ga0070663_101058255 | Ga0070663_1010582552 | 95 |
| 254 | 3300005456 | Ga0070678_100066368 | Ga0070678_1000663684 | 95 |
| 255 | 3300005535 | Ga0070684_100210157 | Ga0070684_1002101574 | 95 |
| 256 | 3300005548 | Ga0070665_100422486 | Ga0070665_1004224862 | 95 |
| 257 | 3300005614 | Ga0068856_101964677 | Ga0068856_1019646771 | 95 |
| 258 | 3300005615 | Ga0070702_101213015 | Ga0070702_1012130152 | 95 |
| 259 | 3300005616 | Ga0068852_101084856 | Ga0068852_1010848563 | 95 |
| 260 | 3300005617 | Ga0068859_102796048 | Ga0068859_1027960481 | 95 |
| 261 | 3300005719 | Ga0068861_100802120 | Ga0068861_1008021203 | 95 |
| 262 | 3300005840 | Ga0068870_10016699 | Ga0068870_100166996 | 95 |
| 263 | 3300005842 | Ga0068858_100795276 | Ga0068858_1007952762 | 95 |
| 264 | 3300006038 | Ga0075365_10596167 | Ga0075365_105961672 | 95 |
| 265 | 3300006038 | Ga0075365_11130317 | Ga0075365_111303172 | 95 |
| 266 | 3300006048 | Ga0075363_100591250 | Ga0075363_1005912502 | 95 |
| 267 | 3300006237 | Ga0097621_100501219 | Ga0097621_1005012192 | 95 |
| 268 | 3300006881 | Ga0068865_101114283 | Ga0068865_1011142832 | 95 |
| 269 | 3300006931 | Ga0097620_102796255 | Ga0097620_1027962551 | 95 |
| 270 | 3300009148 | Ga0105243_10146698 | Ga0105243_101466984 | 95 |
| 271 | 3300009176 | Ga0105242_11021495 | Ga0105242_110214952 | 95 |
| 272 | 3300009551 | Ga0105238_11714173 | Ga0105238_117141732 | 95 |
| 273 | 3300009553 | Ga0105249_10187575 | Ga0105249_101875752 | 95 |
| 274 | 3300010375 | Ga0105239_10343319 | Ga0105239_103433194 | 95 |
| 275 | 3300013100 | Ga0157373_11033076 | Ga0157373_110330762 | 95 |
| 276 | 3300013296 | Ga0157374_10428838 | Ga0157374_104288383 | 95 |
| 277 | 3300013306 | Ga0163162_10472890 | Ga0163162_104728903 | 95 |
| 278 | 3300013307 | Ga0157372_10922008 | Ga0157372_109220082 | 95 |
| 279 | 3300014325 | Ga0163163_10901979 | Ga0163163_109019792 | 95 |
| 280 | 3300014326 | Ga0157380_10036717 | Ga0157380_100367179 | 95 |
| 281 | 3300025321 | Ga0207656_10096111 | Ga0207656_100961113 | 95 |
| 282 | 3300025901 | Ga0207688_10036973 | Ga0207688_100369736 | 95 |
| 283 | 3300025901 | Ga0207688_10555246 | Ga0207688_105552462 | 95 |
| 284 | 3300025904 | Ga0207647_10670051 | Ga0207647_106700512 | 95 |
| 285 | 3300025907 | Ga0207645_10674583 | Ga0207645_106745832 | 95 |
| 286 | 3300025908 | Ga0207643_10024696 | Ga0207643_100246967 | 95 |
| 287 | 3300025919 | Ga0207657_10194651 | Ga0207657_101946513 | 95 |
| 288 | 3300025920 | Ga0207649_10512263 | Ga0207649_105122632 | 95 |
| 289 | 3300025924 | Ga0207694_10456750 | Ga0207694_104567503 | 95 |
| 290 | 3300025925 | Ga0207650_11047429 | Ga0207650_110474292 | 95 |
| 291 | 3300025935 | Ga0207709_10060849 | Ga0207709_100608492 | 95 |
| 292 | 3300025936 | Ga0207670_11295421 | Ga0207670_112954212 | 95 |
| 293 | 3300025941 | Ga0207711_10809600 | Ga0207711_108096003 | 95 |
| 294 | 3300025961 | Ga0207712_10245420 | Ga0207712_102454204 | 95 |
| 295 | 3300026035 | Ga0207703_12206410 | Ga0207703_122064102 | 95 |
| 296 | 3300026067 | Ga0207678_10392021 | Ga0207678_103920212 | 95 |
| 297 | 3300026078 | Ga0207702_10845417 | Ga0207702_108454171 | 95 |
| 298 | 3300026088 | Ga0207641_11767956 | Ga0207641_117679562 | 95 |
| 299 | 3300026095 | Ga0207676_10320409 | Ga0207676_103204093 | 95 |
| 300 | 3300026118 | Ga0207675_100928854 | Ga0207675_1009288542 | 95 |
| 301 | 3300026121 | Ga0207683_10191528 | Ga0207683_101915282 | 95 |
| 302 | 3300028379 | Ga0268266_10111658 | Ga0268266_101116583 | 95 |
| 303 | 3300031852 | Ga0307410_10242712 | Ga0307410_102427122 | 95 |
| 304 | 3300031995 | Ga0307409_100253869 | Ga0307409_1002538691 | 95 |
| 305 | 3300032005 | Ga0307411_10568504 | Ga0307411_105685041 | 95 |
| 306 | 3300034818 | Ga0373950_0017391 | Ga0373950_0017391_506_793 | 95 |
| 307 | 3300034820 | Ga0373959_0025753 | Ga0373959_0025753_458_745 | 95 |
| 308 | 3300035113 | Ga0373936_0288709 | Ga0373936_0288709_367_654 | 95 |
| 309 | 3300035691 | Ga0373931_0637880 | Ga0373931_0637880_143_430 | 95 |
| 310 | 3300035692 | Ga0373935_0969695 | Ga0373935_0969695_23_310 | 95 |
| 311 | 3300035692 | Ga0373935_1072142 | Ga0373935_1072142_223_510 | 95 |
| 312 | 3300036401 | Ga0373937_0644479 | Ga0373937_0644479_357_644 | 95 |
| 313 | 3300041456 | Ga0451795_1488462 | Ga0451795_1488462_154_447 | 95 |
| 314 | 3300041460 | Ga0451802_1939573 | Ga0451802_1939573_375_662 | 95 |
| 315 | 3300041492 | Ga0451835_0634236 | Ga0451835_0634236_241_528 | 95 |
| 316 | 3300044658 | Ga0466972_0189232 | Ga0466972_0189232_201_491 | 95 |
| 317 | 3300044683 | Ga0466965_0045066 | Ga0466965_0045066_1449_1739 | 95 |
| 318 | 3300044765 | Ga0466970_0308726 | Ga0466970_0308726_541_831 | 95 |
| 319 | 3300044901 | Ga0466960_0036578 | Ga0466960_0036578_1057_1347 | 95 |
| 320 | 3300046454 | Ga0495592_0827598 | Ga0495592_0827598_76_363 | 95 |
| 321 | 3300046459 | Ga0495629_0168375 | Ga0495629_0168375_692_979 | 95 |
| 322 | 3300046461 | Ga0495641_0071039 | Ga0495641_0071039_569_856 | 95 |
| 323 | 3300046462 | Ga0495651_0948140 | Ga0495651_0948140_142_429 | 95 |
| 324 | 3300046463 | Ga0495653_0051203 | Ga0495653_0051203_165_452 | 95 |
| 325 | 3300046473 | Ga0495582_0244773 | Ga0495582_0244773_466_753 | 95 |
| 326 | 3300046477 | Ga0495664_0367311 | Ga0495664_0367311_236_523 | 95 |
| 327 | 3300046511 | Ga0495608_0808726 | Ga0495608_0808726_154_441 | 95 |
| 328 | 3300046517 | Ga0495630_0792944 | Ga0495630_0792944_126_413 | 95 |
| 329 | 3300046529 | Ga0495652_1032869 | Ga0495652_1032869_192_479 | 95 |
| 330 | 3300046533 | Ga0495640_0490699 | Ga0495640_0490699_417_704 | 95 |
| 331 | 3300046533 | Ga0495640_0551081 | Ga0495640_0551081_90_377 | 95 |
| 332 | 3300046535 | Ga0495586_0354487 | Ga0495586_0354487_112_399 | 95 |
| 333 | 3300046663 | Ga0495635_0125252 | Ga0495635_0125252_670_957 | 95 |
| 334 | 3300046674 | Ga0495588_0268103 | Ga0495588_0268103_59_346 | 95 |
| 335 | 3300046675 | Ga0495657_0195688 | Ga0495657_0195688_28_315 | 95 |
| 336 | 3300046679 | Ga0495623_0520155 | Ga0495623_0520155_20_307 | 95 |
| 337 | 3300046680 | Ga0495646_0463265 | Ga0495646_0463265_149_436 | 95 |
| 338 | 3300046689 | Ga0495613_1091854 | Ga0495613_1091854_34_321 | 95 |
| 339 | 3300046690 | Ga0495624_0268209 | Ga0495624_0268209_498_785 | 95 |
| 340 | 3300046694 | Ga0495649_0622847 | Ga0495649_0622847_211_498 | 95 |
| 341 | 3300046809 | Ga0495600_0260765 | Ga0495600_0260765_538_825 | 95 |
| 342 | 3300047315 | Ga0495581_0335935 | Ga0495581_0335935_519_806 | 95 |
| 343 | 3300047317 | Ga0495604_0218905 | Ga0495604_0218905_163_450 | 95 |
| 344 | 3300047319 | Ga0495674_0179954 | Ga0495674_0179954_60_347 | 95 |
| 345 | 3300047673 | Ga0495593_0423997 | Ga0495593_0423997_267_554 | 95 |
| 346 | 3300048088 | Ga0495602_0389883 | Ga0495602_0389883_150_437 | 95 |
| 347 | 3300048089 | Ga0495614_0275477 | Ga0495614_0275477_448_735 | 95 |
| 348 | 3300048904 | Ga0496101_1290546 | Ga0496101_1290546_90_377 | 95 |
| 349 | 3300048905 | Ga0496102_0337211 | Ga0496102_0337211_296_583 | 95 |
| 350 | 3300048906 | Ga0496103_0279531 | Ga0496103_0279531_484_771 | 95 |
| 351 | 3300048907 | Ga0496104_0255136 | Ga0496104_0255136_1294_1581 | 95 |
| 352 | 3300048907 | Ga0496104_1107408 | Ga0496104_1107408_188_475 | 95 |
| 353 | 3300048911 | Ga0496108_0401780 | Ga0496108_0401780_614_901 | 95 |
| 354 | 3300048912 | Ga0496109_1287039 | Ga0496109_1287039_313_600 | 95 |
| 355 | 3300048914 | Ga0496111_1208826 | Ga0496111_1208826_124_411 | 95 |
| 356 | 3300048917 | Ga0496114_0016801 | Ga0496114_0016801_5417_5704 | 95 |
| 357 | 3300048918 | Ga0496115_0327839 | Ga0496115_0327839_678_965 | 95 |
| 358 | 3300049127 | Ga0501306_041755 | Ga0501306_041755_76_366 | 95 |
| 359 | 3300049130 | Ga0501310_019548 | Ga0501310_019548_73_363 | 95 |
| 360 | 3300049162 | Ga0501307_037304 | Ga0501307_037304_383_673 | 95 |
| 361 | 3300049534 | Ga0501318_009260 | Ga0501318_009260_609_899 | 95 |
| 362 | 3300049536 | Ga0501320_047908 | Ga0501320_047908_14_304 | 95 |
| 363 | 3300049569 | Ga0501032_0388183 | Ga0501032_0388183_263_550 | 95 |
| 364 | 3300049569 | Ga0501032_0635794 | Ga0501032_0635794_169_459 | 95 |
| 365 | 3300049570 | Ga0501033_0176599 | Ga0501033_0176599_96_383 | 95 |
| 366 | 3300049575 | Ga0501039_0068572 | Ga0501039_0068572_63_350 | 95 |
| 367 | 3300049579 | Ga0501043_0426685 | Ga0501043_0426685_84_371 | 95 |
| 368 | 3300049582 | Ga0501048_0029778 | Ga0501048_0029778_3571_3858 | 95 |
| 369 | 3300049585 | Ga0501069_0941489 | Ga0501069_0941489_87_374 | 95 |
| 370 | 3300049587 | Ga0501071_0039375 | Ga0501071_0039375_963_1250 | 95 |
| 371 | 3300049588 | Ga0501072_0047842 | Ga0501072_0047842_447_734 | 95 |
| 372 | 3300049589 | Ga0501073_0297204 | Ga0501073_0297204_82_369 | 95 |
| 373 | 3300049591 | Ga0501075_0136382 | Ga0501075_0136382_21_308 | 95 |
| 374 | 3300049592 | Ga0501076_0003905 | Ga0501076_0003905_8831_9118 | 95 |
| 375 | 3300049743 | Ga0501081_0020597 | Ga0501081_0020597_2279_2566 | 95 |
| 376 | 3300050492 | nmdc:mga0yw44_299857_c1 | nmdc:mga0yw44_299857_c1_164_454 | 95 |
| 377 | 3300050492 | nmdc:mga0yw44_77900_c1 | nmdc:mga0yw44_77900_c1_1409_1702 | 95 |
| 378 | 3300050496 | nmdc:mga07m45_715152_c1 | nmdc:mga07m45_715152_c1_83_376 | 95 |
| 379 | 3300053084 | Ga0495595_0469064 | Ga0495595_0469064_293_580 | 95 |
| 380 | 3300053085 | Ga0495619_0138558 | Ga0495619_0138558_339_626 | 95 |
| 381 | 3300053085 | Ga0495619_0232043 | Ga0495619_0232043_347_634 | 95 |
| 382 | 3300060353 | Ga0501082_0082024 | Ga0501082_0082024_1941_2228 | 95 |
| 383 | 3300061734 | Ga0530510_0063999 | Ga0530510_0063999_553_840 | 95 |
| 384 | 3300005344 | Ga0070661_100889375 | Ga0070661_1008893752 | 96 |
| 385 | 3300005434 | Ga0070709_10124124 | Ga0070709_101241242 | 96 |
| 386 | 3300005437 | Ga0070710_10073724 | Ga0070710_100737244 | 96 |
| 387 | 3300005439 | Ga0070711_100020873 | Ga0070711_1000208738 | 96 |
| 388 | 3300005457 | Ga0070662_100759619 | Ga0070662_1007596191 | 96 |
| 389 | 3300005468 | Ga0070707_100017376 | Ga0070707_10001737612 | 96 |
| 390 | 3300005471 | Ga0070698_100006774 | Ga0070698_10000677414 | 96 |
| 391 | 3300005518 | Ga0070699_101433024 | Ga0070699_1014330241 | 96 |
| 392 | 3300005615 | Ga0070702_100229424 | Ga0070702_1002294243 | 96 |
| 393 | 3300005719 | Ga0068861_101387784 | Ga0068861_1013877842 | 96 |
| 394 | 3300006028 | Ga0070717_10207041 | Ga0070717_102070413 | 96 |
| 395 | 3300006038 | Ga0075365_10858253 | Ga0075365_108582532 | 96 |
| 396 | 3300006048 | Ga0075363_100019633 | Ga0075363_1000196337 | 96 |
| 397 | 3300006051 | Ga0075364_10828663 | Ga0075364_108286632 | 96 |
| 398 | 3300006163 | Ga0070715_10006159 | Ga0070715_100061596 | 96 |
| 399 | 3300006173 | Ga0070716_100037140 | Ga0070716_1000371406 | 96 |
| 400 | 3300006175 | Ga0070712_100035731 | Ga0070712_1000357314 | 96 |
| 401 | 3300006353 | Ga0075370_10285066 | Ga0075370_102850663 | 96 |
| 402 | 3300006881 | Ga0068865_101262236 | Ga0068865_1012622362 | 96 |
| 403 | 3300009148 | Ga0105243_10360349 | Ga0105243_103603493 | 96 |
| 404 | 3300009176 | Ga0105242_10074568 | Ga0105242_100745685 | 96 |
| 405 | 3300009553 | Ga0105249_10189951 | Ga0105249_101899513 | 96 |
| 406 | 3300011119 | Ga0105246_10167003 | Ga0105246_101670034 | 96 |
| 407 | 3300013102 | Ga0157371_10738373 | Ga0157371_107383732 | 96 |
| 408 | 3300013297 | Ga0157378_10010737 | Ga0157378_100107374 | 96 |
| 409 | 3300013306 | Ga0163162_10293331 | Ga0163162_102933313 | 96 |
| 410 | 3300013308 | Ga0157375_10008009 | Ga0157375_1000800912 | 96 |
| 411 | 3300014326 | Ga0157380_10108855 | Ga0157380_101088554 | 96 |
| 412 | 3300020075 | Ga0206349_1141404 | Ga0206349_11414041 | 96 |
| 413 | 3300020080 | Ga0206350_10745375 | Ga0206350_107453753 | 96 |
| 414 | 3300021388 | Ga0213875_10088929 | Ga0213875_100889294 | 96 |
| 415 | 3300024123 | Ga0228600_1006526 | Ga0228600_10065262 | 96 |
| 416 | 3300025898 | Ga0207692_10005017 | Ga0207692_1000501710 | 96 |
| 417 | 3300025905 | Ga0207685_10077352 | Ga0207685_100773522 | 96 |
| 418 | 3300025906 | Ga0207699_10012149 | Ga0207699_100121497 | 96 |
| 419 | 3300025910 | Ga0207684_10697678 | Ga0207684_106976783 | 96 |
| 420 | 3300025915 | Ga0207693_10073798 | Ga0207693_100737986 | 96 |
| 421 | 3300025916 | Ga0207663_10196153 | Ga0207663_101961531 | 96 |
| 422 | 3300025922 | Ga0207646_10080136 | Ga0207646_100801367 | 96 |
| 423 | 3300025929 | Ga0207664_10038812 | Ga0207664_100388123 | 96 |
| 424 | 3300025938 | Ga0207704_10878510 | Ga0207704_108785102 | 96 |
| 425 | 3300025939 | Ga0207665_10014926 | Ga0207665_100149264 | 96 |
| 426 | 3300026118 | Ga0207675_100145970 | Ga0207675_1001459703 | 96 |
| 427 | 3300028381 | Ga0268264_10000792 | Ga0268264_1000079228 | 96 |
| 428 | 3300030763 | Ga0265763_1001461 | Ga0265763_10014614 | 96 |
| 429 | 3300030863 | Ga0265766_1005347 | Ga0265766_10053472 | 96 |
| 430 | 3300030888 | Ga0265769_106022 | Ga0265769_1060222 | 96 |
| 431 | 3300030963 | Ga0265768_102109 | Ga0265768_1021093 | 96 |
| 432 | 3300031018 | Ga0265773_1011144 | Ga0265773_10111443 | 96 |
| 433 | 3300031691 | Ga0316579_10005517 | Ga0316579_100055179 | 96 |
| 434 | 3300031691 | Ga0316579_10228583 | Ga0316579_102285831 | 96 |
| 435 | 3300031727 | Ga0316576_10164950 | Ga0316576_101649503 | 96 |
| 436 | 3300031728 | Ga0316578_10017124 | Ga0316578_100171249 | 96 |
| 437 | 3300031728 | Ga0316578_10039413 | Ga0316578_100394134 | 96 |
| 438 | 3300031731 | Ga0307405_10408320 | Ga0307405_104083202 | 96 |
| 439 | 3300032004 | Ga0307414_11037266 | Ga0307414_110372662 | 96 |
| 440 | 3300032005 | Ga0307411_10860531 | Ga0307411_108605312 | 96 |
| 441 | 3300032133 | Ga0316583_10012326 | Ga0316583_100123267 | 96 |
| 442 | 3300032137 | Ga0316585_10043899 | Ga0316585_100438993 | 96 |
| 443 | 3300032168 | Ga0316593_10006052 | Ga0316593_100060525 | 96 |
| 444 | 3300032168 | Ga0316593_10071625 | Ga0316593_100716252 | 96 |
| 445 | 3300033524 | Ga0316592_1004568 | Ga0316592_10045684 | 96 |
| 446 | 3300033524 | Ga0316592_1022884 | Ga0316592_10228843 | 96 |
| 447 | 3300033527 | Ga0316586_1062448 | Ga0316586_10624482 | 96 |
| 448 | 3300035086 | Ga0373934_0001665 | Ga0373934_0001665_1446_1745 | 96 |
| 449 | 3300035111 | Ga0373923_0007458 | Ga0373923_0007458_2156_2455 | 96 |
| 450 | 3300035113 | Ga0373936_0070564 | Ga0373936_0070564_349_648 | 96 |
| 451 | 3300035116 | Ga0373945_0066209 | Ga0373945_0066209_291_590 | 96 |
| 452 | 3300035117 | Ga0373953_0004941 | Ga0373953_0004941_308_607 | 96 |
| 453 | 3300035118 | Ga0373954_0006014 | Ga0373954_0006014_1662_1961 | 96 |
| 454 | 3300035119 | Ga0373956_0008114 | Ga0373956_0008114_481_780 | 96 |
| 455 | 3300035120 | Ga0373957_0001036 | Ga0373957_0001036_3222_3521 | 96 |
| 456 | 3300035171 | Ga0373946_0310502 | Ga0373946_0310502_91_390 | 96 |
| 457 | 3300035398 | Ga0316574_0022365 | Ga0316574_0022365_991_1293 | 96 |
| 458 | 3300035398 | Ga0316574_0023256 | Ga0316574_0023256_3389_3682 | 96 |
| 459 | 3300035410 | Ga0373924_0044587 | Ga0373924_0044587_696_995 | 96 |
| 460 | 3300035692 | Ga0373935_0071970 | Ga0373935_0071970_644_943 | 96 |
| 461 | 3300035724 | Ga0373933_0002959 | Ga0373933_0002959_6391_6690 | 96 |
| 462 | 3300036401 | Ga0373937_0068251 | Ga0373937_0068251_2865_3164 | 96 |
| 463 | 3300036647 | Ga0316582_0031807 | Ga0316582_0031807_26_319 | 96 |
| 464 | 3300036647 | Ga0316582_0117570 | Ga0316582_0117570_444_746 | 96 |
| 465 | 3300036712 | Ga0316584_0005394 | Ga0316584_0005394_8027_8320 | 96 |
| 466 | 3300037068 | Ga0373925_0092377 | Ga0373925_0092377_296_595 | 96 |
| 467 | 3300037418 | Ga0395900_0068181 | Ga0395900_0068181_1932_2231 | 96 |
| 468 | 3300037418 | Ga0395900_0205946 | Ga0395900_0205946_1633_1938 | 96 |
| 469 | 3300037466 | Ga0395898_0613993 | Ga0395898_0613993_495_800 | 96 |
| 470 | 3300037853 | Ga0436364_0124034 | Ga0436364_0124034_108_407 | 96 |
| 471 | 3300038443 | Ga0395901_0018326 | Ga0395901_0018326_5598_5888 | 96 |
| 472 | 3300038443 | Ga0395901_0370453 | Ga0395901_0370453_120_425 | 96 |
| 473 | 3300038443 | Ga0395901_0482913 | Ga0395901_0482913_313_612 | 96 |
| 474 | 3300039453 | Ga0436362_0361172 | Ga0436362_0361172_501_800 | 96 |
| 475 | 3300041486 | Ga0451807_2386134 | Ga0451807_2386134_61_357 | 96 |
| 476 | 3300044683 | Ga0466965_0380417 | Ga0466965_0380417_311_601 | 96 |
| 477 | 3300046454 | Ga0495592_0036318 | Ga0495592_0036318_1392_1691 | 96 |
| 478 | 3300046459 | Ga0495629_1151731 | Ga0495629_1151731_107_406 | 96 |
| 479 | 3300046462 | Ga0495651_0058206 | Ga0495651_0058206_54_353 | 96 |
| 480 | 3300046463 | Ga0495653_0009908 | Ga0495653_0009908_2623_2922 | 96 |
| 481 | 3300046476 | Ga0495662_0008003 | Ga0495662_0008003_1229_1528 | 96 |
| 482 | 3300046477 | Ga0495664_0010379 | Ga0495664_0010379_881_1180 | 96 |
| 483 | 3300046511 | Ga0495608_0009099 | Ga0495608_0009099_3055_3354 | 96 |
| 484 | 3300046514 | Ga0495618_0019818 | Ga0495618_0019818_3478_3777 | 96 |
| 485 | 3300046516 | Ga0495628_0018735 | Ga0495628_0018735_3222_3521 | 96 |
| 486 | 3300046529 | Ga0495652_0028241 | Ga0495652_0028241_4319_4618 | 96 |
| 487 | 3300046533 | Ga0495640_0013782 | Ga0495640_0013782_2951_3250 | 96 |
| 488 | 3300046535 | Ga0495586_0007029 | Ga0495586_0007029_3828_4127 | 96 |
| 489 | 3300046536 | Ga0495587_0252404 | Ga0495587_0252404_639_938 | 96 |
| 490 | 3300046543 | Ga0495645_0015924 | Ga0495645_0015924_2933_3232 | 96 |
| 491 | 3300046559 | Ga0495667_0032466 | Ga0495667_0032466_356_655 | 96 |
| 492 | 3300046642 | Ga0495634_0018243 | Ga0495634_0018243_2583_2882 | 96 |
| 493 | 3300046663 | Ga0495635_0008577 | Ga0495635_0008577_1557_1856 | 96 |
| 494 | 3300046675 | Ga0495657_0007738 | Ga0495657_0007738_6586_6885 | 96 |
| 495 | 3300046678 | Ga0495599_0006925 | Ga0495599_0006925_1988_2287 | 96 |
| 496 | 3300046679 | Ga0495623_0093050 | Ga0495623_0093050_376_675 | 96 |
| 497 | 3300046680 | Ga0495646_0011402 | Ga0495646_0011402_5292_5591 | 96 |
| 498 | 3300046809 | Ga0495600_0005775 | Ga0495600_0005775_6357_6656 | 96 |
| 499 | 3300047317 | Ga0495604_0087106 | Ga0495604_0087106_651_950 | 96 |
| 500 | 3300047319 | Ga0495674_0032123 | Ga0495674_0032123_4006_4305 | 96 |
| 501 | 3300047321 | Ga0495676_0143826 | Ga0495676_0143826_173_472 | 96 |
| 502 | 3300047322 | Ga0495680_0027683 | Ga0495680_0027683_3828_4127 | 96 |
| 503 | 3300047471 | Ga0495684_0004161 | Ga0495684_0004161_6807_7106 | 96 |
| 504 | 3300048088 | Ga0495602_0013833 | Ga0495602_0013833_3525_3824 | 96 |
| 505 | 3300048907 | Ga0496104_1338060 | Ga0496104_1338060_226_525 | 96 |
| 506 | 3300048909 | Ga0496106_0798608 | Ga0496106_0798608_300_596 | 96 |
| 507 | 3300048911 | Ga0496108_0671955 | Ga0496108_0671955_436_732 | 96 |
| 508 | 3300048915 | Ga0496112_0430170 | Ga0496112_0430170_678_980 | 96 |
| 509 | 3300048916 | Ga0496113_0070533 | Ga0496113_0070533_648_950 | 96 |
| 510 | 3300049127 | Ga0501306_005147 | Ga0501306_005147_989_1279 | 96 |
| 511 | 3300049130 | Ga0501310_025008 | Ga0501310_025008_340_630 | 96 |
| 512 | 3300049533 | Ga0501317_007376 | Ga0501317_007376_867_1160 | 96 |
| 513 | 3300049537 | Ga0501321_033787 | Ga0501321_033787_189_479 | 96 |
| 514 | 3300049538 | Ga0501322_006423 | Ga0501322_006423_370_660 | 96 |
| 515 | 3300049541 | Ga0501325_001001 | Ga0501325_001001_768_1058 | 96 |
| 516 | 3300049575 | Ga0501039_0113661 | Ga0501039_0113661_1192_1488 | 96 |
| 517 | 3300049576 | Ga0501040_0206605 | Ga0501040_0206605_603_899 | 96 |
| 518 | 3300049577 | Ga0501041_0296712 | Ga0501041_0296712_339_635 | 96 |
| 519 | 3300049588 | Ga0501072_1565234 | Ga0501072_1565234_104_400 | 96 |
| 520 | 3300049591 | Ga0501075_0198760 | Ga0501075_0198760_307_603 | 96 |
| 521 | 3300049592 | Ga0501076_0413544 | Ga0501076_0413544_25_321 | 96 |
| 522 | 3300049593 | Ga0501077_0264462 | Ga0501077_0264462_652_948 | 96 |
| 523 | 3300049741 | Ga0501079_0328170 | Ga0501079_0328170_682_978 | 96 |
| 524 | 3300049743 | Ga0501081_0509230 | Ga0501081_0509230_115_411 | 96 |
| 525 | 3300049822 | Ga0501035_1076064 | Ga0501035_1076064_147_443 | 96 |
| 526 | 3300049824 | Ga0501045_0215113 | Ga0501045_0215113_217_513 | 96 |
| 527 | 3300050490 | nmdc:mga03n38_349267_c1 | nmdc:mga03n38_349267_c1_490_792 | 96 |
| 528 | 3300050491 | nmdc:mga00v17_3224_c1 | nmdc:mga00v17_3224_c1_1639_1941 | 96 |
| 529 | 3300050491 | nmdc:mga00v17_404833_c1 | nmdc:mga00v17_404833_c1_176_472 | 96 |
| 530 | 3300050491 | nmdc:mga00v17_701231_c1 | nmdc:mga00v17_701231_c1_179_478 | 96 |
| 531 | 3300050492 | nmdc:mga0yw44_173021_c1 | nmdc:mga0yw44_173021_c1_891_1193 | 96 |
| 532 | 3300050492 | nmdc:mga0yw44_544996_c1 | nmdc:mga0yw44_544996_c1_170_469 | 96 |
| 533 | 3300050492 | nmdc:mga0yw44_803735_c1 | nmdc:mga0yw44_803735_c1_243_545 | 96 |
| 534 | 3300050495 | nmdc:mga04h51_4651_c1 | nmdc:mga04h51_4651_c1_85_387 | 96 |
| 535 | 3300053078 | Ga0495612_0090722 | Ga0495612_0090722_684_983 | 96 |
| 536 | 3300053084 | Ga0495595_0072157 | Ga0495595_0072157_226_525 | 96 |
| 537 | 3300053096 | Ga0500641_0016659 | Ga0500641_0016659_288_590 | 96 |
| 538 | 3300053102 | Ga0500554_010844 | Ga0500554_010844_1315_1617 | 96 |
| 539 | 3300059490 | Ga0587066_067399 | Ga0587066_067399_422_724 | 96 |
| 540 | 3300059491 | Ga0587070_036856 | Ga0587070_036856_548_850 | 96 |
| 541 | 3300059492 | Ga0587073_0040403 | Ga0587073_0040403_449_751 | 96 |
| 542 | 3300059493 | Ga0587077_012193 | Ga0587077_012193_898_1197 | 96 |
| 543 | 3300059493 | Ga0587077_027098 | Ga0587077_027098_412_714 | 96 |
| 544 | 3300059503 | Ga0587080_056879 | Ga0587080_056879_361_663 | 96 |
| 545 | 3300059505 | Ga0587083_0038089 | Ga0587083_0038089_657_959 | 96 |
| 546 | 3300059505 | Ga0587083_0116209 | Ga0587083_0116209_35_334 | 96 |
| 547 | 3300059510 | Ga0587090_014925 | Ga0587090_014925_441_743 | 96 |
| 548 | 3300059513 | Ga0587094_044014 | Ga0587094_044014_80_382 | 96 |
| 549 | 3300059604 | Ga0587098_063711 | Ga0587098_063711_213_503 | 96 |
| 550 | 3300059605 | Ga0587106_005262 | Ga0587106_005262_655_957 | 96 |
| 551 | 3300059623 | Ga0587101_018095 | Ga0587101_018095_252_554 | 96 |
| 552 | 3300059641 | Ga0587068_025290 | Ga0587068_025290_176_478 | 96 |
| 553 | 3300059643 | Ga0587072_025288 | Ga0587072_025288_464_766 | 96 |
| 554 | 3300059645 | Ga0587076_007466 | Ga0587076_007466_848_1150 | 96 |
| 555 | 3300059647 | Ga0587079_044922 | Ga0587079_044922_517_819 | 96 |
| 556 | 3300059651 | Ga0587105_028639 | Ga0587105_028639_109_411 | 96 |
| 557 | 3300059652 | Ga0587107_031393 | Ga0587107_031393_200_502 | 96 |
| 558 | 3300059660 | Ga0587124_027662 | Ga0587124_027662_47_349 | 96 |
| 559 | 3300060344 | Ga0587071_059618 | Ga0587071_059618_422_721 | 96 |
| 560 | 3300060353 | Ga0501082_0085561 | Ga0501082_0085561_2369_2665 | 96 |
| 561 | 3300014325 | Ga0163163_10024937 | Ga0163163_100249371 | 97 |
| 562 | 3300014326 | Ga0157380_10391403 | Ga0157380_103914034 | 97 |
| 563 | 3300014969 | Ga0157376_11728478 | Ga0157376_117284782 | 97 |
| 564 | 3300031548 | Ga0307408_100025858 | Ga0307408_1000258587 | 97 |
| 565 | 3300031824 | Ga0307413_10152007 | Ga0307413_101520073 | 97 |
| 566 | 3300031852 | Ga0307410_10008640 | Ga0307410_100086404 | 97 |
| 567 | 3300031901 | Ga0307406_11075700 | Ga0307406_110757003 | 97 |
| 568 | 3300031903 | Ga0307407_10091249 | Ga0307407_100912492 | 97 |
| 569 | 3300031911 | Ga0307412_11195920 | Ga0307412_111959202 | 97 |
| 570 | 3300031995 | Ga0307409_100001225 | Ga0307409_10000122514 | 97 |
| 571 | 3300032002 | Ga0307416_100003637 | Ga0307416_10000363715 | 97 |
| 572 | 3300032005 | Ga0307411_11813352 | Ga0307411_118133522 | 97 |
| 573 | 3300032126 | Ga0307415_100317652 | Ga0307415_1003176522 | 97 |
| 574 | 3300032168 | Ga0316593_10002456 | Ga0316593_100024569 | 97 |
| 575 | 3300032168 | Ga0316593_10292263 | Ga0316593_102922631 | 97 |
| 576 | 3300033524 | Ga0316592_1006305 | Ga0316592_10063055 | 97 |
| 577 | 3300033527 | Ga0316586_1007512 | Ga0316586_10075124 | 97 |
| 578 | 3300033541 | Ga0316596_1000140 | Ga0316596_100014011 | 97 |
| 579 | 3300033541 | Ga0316596_1007697 | Ga0316596_10076976 | 97 |
| 580 | 3300035121 | Ga0373960_0064490 | Ga0373960_0064490_611_904 | 97 |
| 581 | 3300035242 | Ga0373962_0223850 | Ga0373962_0223850_250_543 | 97 |
| 582 | 3300035398 | Ga0316574_0034195 | Ga0316574_0034195_1952_2257 | 97 |
| 583 | 3300036712 | Ga0316584_0009403 | Ga0316584_0009403_4496_4801 | 97 |
| 584 | 3300036712 | Ga0316584_0099111 | Ga0316584_0099111_925_1230 | 97 |
| 585 | 3300037312 | Ga0395899_0886126 | Ga0395899_0886126_85_378 | 97 |
| 586 | 3300037418 | Ga0395900_0278590 | Ga0395900_0278590_962_1255 | 97 |
| 587 | 3300037466 | Ga0395898_0039180 | Ga0395898_0039180_707_1000 | 97 |
| 588 | 3300038443 | Ga0395901_0154973 | Ga0395901_0154973_1599_1892 | 97 |
| 589 | 3300041411 | Ga0439466_0219435 | Ga0439466_0219435_136_435 | 97 |
| 590 | 3300041459 | Ga0451800_0225272 | Ga0451800_0225272_284_586 | 97 |
| 591 | 3300041503 | Ga0451847_0859504 | Ga0451847_0859504_151_453 | 97 |
| 592 | 3300041509 | Ga0451843_1048037 | Ga0451843_1048037_260_553 | 97 |
| 593 | 3300041512 | Ga0451853_2531387 | Ga0451853_2531387_114_419 | 97 |
| 594 | 3300041999 | Ga0439433_0119062 | Ga0439433_0119062_202_501 | 97 |
| 595 | 3300042002 | Ga0439442_085984 | Ga0439442_085984_177_476 | 97 |
| 596 | 3300042007 | Ga0439449_0227513 | Ga0439449_0227513_373_672 | 97 |
| 597 | 3300042013 | Ga0439456_157332 | Ga0439456_157332_13_312 | 97 |
| 598 | 3300042014 | Ga0439457_017658 | Ga0439457_017658_1151_1450 | 97 |
| 599 | 3300042125 | Ga0450923_030640 | Ga0450923_030640_511_810 | 97 |
| 600 | 3300042145 | Ga0450906_019906 | Ga0450906_019906_228_527 | 97 |
| 601 | 3300045976 | Ga0466967_0166934 | Ga0466967_0166934_240_551 | 97 |
| 602 | 3300049572 | Ga0501036_0177346 | Ga0501036_0177346_136_429 | 97 |
| 603 | 3300049575 | Ga0501039_1119976 | Ga0501039_1119976_231_524 | 97 |
| 604 | 3300049579 | Ga0501043_0529730 | Ga0501043_0529730_66_359 | 97 |
| 605 | 3300049580 | Ga0501046_0146996 | Ga0501046_0146996_829_1122 | 97 |
| 606 | 3300049591 | Ga0501075_0844784 | Ga0501075_0844784_307_600 | 97 |
| 607 | 3300049742 | Ga0501080_1132297 | Ga0501080_1132297_90_383 | 97 |
| 608 | 3300049823 | Ga0501044_1268146 | Ga0501044_1268146_92_385 | 97 |
| 609 | 3300049824 | Ga0501045_0638090 | Ga0501045_0638090_202_495 | 97 |
| 610 | 3300053096 | Ga0500641_0091319 | Ga0500641_0091319_309_635 | 97 |
| 611 | 3300053160 | Ga0500633_0070375 | Ga0500633_0070375_462_788 | 97 |
| 612 | 3300054114 | Ga0501084_0305167 | Ga0501084_0305167_1021_1314 | 97 |
| 613 | 3300059490 | Ga0587066_096158 | Ga0587066_096158_44_337 | 97 |
| 614 | 3300059492 | Ga0587073_0079602 | Ga0587073_0079602_352_645 | 97 |
| 615 | 3300059493 | Ga0587077_243425 | Ga0587077_243425_38_331 | 97 |
| 616 | 3300059623 | Ga0587101_033249 | Ga0587101_033249_84_377 | 97 |
| 617 | 3300059625 | Ga0587113_031239 | Ga0587113_031239_276_569 | 97 |
| 618 | 3300059645 | Ga0587076_022215 | Ga0587076_022215_656_949 | 97 |
| 619 | 3300025912 | Ga0207707_11430485 | Ga0207707_114304851 | 98 |
| 620 | 3300041507 | Ga0451851_0191684 | Ga0451851_0191684_227_535 | 98 |
| 621 | 3300046615 | Ga0495656_0429651 | Ga0495656_0429651_174_473 | 98 |
| 622 | 3300049540 | Ga0501324_023152 | Ga0501324_023152_14_319 | 98 |
| 623 | 3300049586 | Ga0501070_0013575 | Ga0501070_0013575_5964_6266 | 98 |
| 624 | 3300049741 | Ga0501079_1672699 | Ga0501079_1672699_39_341 | 98 |
| 625 | 3300001915 | JGI24741J21665_1022013 | JGI24741J21665_10220133 | 99 |
| 626 | 3300002067 | JGI24735J21928_10032301 | JGI24735J21928_100323013 | 99 |
| 627 | 3300004799 | Ga0058863_10060076 | Ga0058863_100600764 | 99 |
| 628 | 3300004803 | Ga0058862_10086705 | Ga0058862_100867052 | 99 |
| 629 | 3300005329 | Ga0070683_100451471 | Ga0070683_1004514713 | 99 |
| 630 | 3300005336 | Ga0070680_100758217 | Ga0070680_1007582172 | 99 |
| 631 | 3300005337 | Ga0070682_100065239 | Ga0070682_1000652395 | 99 |
| 632 | 3300005337 | Ga0070682_100846756 | Ga0070682_1008467562 | 99 |
| 633 | 3300005366 | Ga0070659_101219955 | Ga0070659_1012199552 | 99 |
| 634 | 3300005458 | Ga0070681_11656726 | Ga0070681_116567261 | 99 |
| 635 | 3300005530 | Ga0070679_100651974 | Ga0070679_1006519743 | 99 |
| 636 | 3300005577 | Ga0068857_100227036 | Ga0068857_1002270364 | 99 |
| 637 | 3300009545 | Ga0105237_11345211 | Ga0105237_113452113 | 99 |
| 638 | 3300020069 | Ga0197907_10647083 | Ga0197907_106470834 | 99 |
| 639 | 3300020069 | Ga0197907_11170858 | Ga0197907_111708581 | 99 |
| 640 | 3300020070 | Ga0206356_11565064 | Ga0206356_115650643 | 99 |
| 641 | 3300020075 | Ga0206349_1354096 | Ga0206349_13540962 | 99 |
| 642 | 3300020075 | Ga0206349_1934290 | Ga0206349_19342901 | 99 |
| 643 | 3300020076 | Ga0206355_1090915 | Ga0206355_10909153 | 99 |
| 644 | 3300020076 | Ga0206355_1407428 | Ga0206355_14074281 | 99 |
| 645 | 3300020081 | Ga0206354_11411084 | Ga0206354_114110842 | 99 |
| 646 | 3300020082 | Ga0206353_10414422 | Ga0206353_104144223 | 99 |
| 647 | 3300022467 | Ga0224712_10419276 | Ga0224712_104192761 | 99 |
| 648 | 3300025912 | Ga0207707_10503279 | Ga0207707_105032793 | 99 |
| 649 | 3300025919 | Ga0207657_10059474 | Ga0207657_100594745 | 99 |
| 650 | 3300025920 | Ga0207649_11010700 | Ga0207649_110107002 | 99 |
| 651 | 3300025921 | Ga0207652_10239587 | Ga0207652_102395871 | 99 |
| 652 | 3300026116 | Ga0207674_10026320 | Ga0207674_100263204 | 99 |
| 653 | 3300038443 | Ga0395901_0601842 | Ga0395901_0601842_346_651 | 99 |
| 654 | 3300046461 | Ga0495641_0090096 | Ga0495641_0090096_861_1160 | 99 |
| 655 | 3300046461 | Ga0495641_0179949 | Ga0495641_0179949_546_845 | 99 |
| 656 | 3300046476 | Ga0495662_0581790 | Ga0495662_0581790_92_391 | 99 |
| 657 | 3300046511 | Ga0495608_0180175 | Ga0495608_0180175_34_333 | 99 |
| 658 | 3300046663 | Ga0495635_0452902 | Ga0495635_0452902_533_832 | 99 |
| 659 | 3300046809 | Ga0495600_0366695 | Ga0495600_0366695_439_738 | 99 |
| 660 | 3300047315 | Ga0495581_0764312 | Ga0495581_0764312_21_320 | 99 |
| 661 | 3300047673 | Ga0495593_0254314 | Ga0495593_0254314_501_800 | 99 |
| 662 | 3300048089 | Ga0495614_0297387 | Ga0495614_0297387_249_548 | 99 |
| 663 | 3300048904 | Ga0496101_1035508 | Ga0496101_1035508_167_466 | 99 |
| 664 | 3300048905 | Ga0496102_0030623 | Ga0496102_0030623_658_957 | 99 |
| 665 | 3300048905 | Ga0496102_0407622 | Ga0496102_0407622_309_608 | 99 |
| 666 | 3300048910 | Ga0496107_0962012 | Ga0496107_0962012_165_464 | 99 |
| 667 | 3300048917 | Ga0496114_0379960 | Ga0496114_0379960_819_1118 | 99 |
| 668 | 3300048918 | Ga0496115_0262751 | Ga0496115_0262751_154_453 | 99 |
| 669 | 3300053085 | Ga0495619_0063850 | Ga0495619_0063850_1591_1890 | 99 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v4b-assembly1.cif.gz_AQ | structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for rna and protein components into a 11.7 a cryo-em map. | 0.8925 | 22 | 95 |
| 7ane-assembly1.cif.gz_k | leishmania major mitochondrial ribosome | 0.8833 | 23 | 96 |
| 8d8k-assembly1.cif.gz_Q | yeast mitochondrial small subunit assembly intermediate (state 2) | 0.8821 | 21 | 96 |
| 5mrc-assembly1.cif.gz_QQ | structure of the yeast mitochondrial ribosome - class a | 0.882 | 21 | 98 |
| 7pkq-assembly1.cif.gz_q | small subunit of the chlamydomonas reinhardtii mitoribosome | 0.8772 | 24 | 99 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8ID56_26_114_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9096 | 23 | 99 | 2.40.50.140 |
| af_C6T0V9_1_79_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8753 | 22 | 99 | 2.40.50.140 |
| af_Q4E4R7_93_168_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8654 | 24 | 98 | 2.40.50.140 |
| af_Q03246_1_107_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8636 | 19 | 95 | 2.40.50.140 |
| af_Q9LHN1_1_100_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8582 | 22 | 99 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0K6H0-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.8972 | 19 | 99 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A3D5CDP2-F1-model_v4 | 30S ribosomal protein S17 | 0.8947 | 18 | 99 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A496RHA2-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.8911 | 18 | 99 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A1Q3T7P4-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.8881 | 18 | 99 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A7J9VS08-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.8873 | 17 | 99 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar