F474005

General Info

Members Datasets Scaffolds Average Seq Length
669 396 650 96

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10024937|Ga0163163_100249371
Length 108
Sequence MSEQPETTEVTADAAATENAAPAVKARGERKTRQGYVVSDKMDKTVVVAVEDRFKHALYGKVLRQTARLKAHDEQNECGTGDRVLIMETRPLSATKRWRVSQILEKAK

Samples

Sample ID Description Type Environment
1 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
2 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
3 2643221711 Terrabacter sp. Root85 Isolate Unclassified
4 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
5 2739367653 Kocuria sp. OV113 Isolate Unclassified
6 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
7 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
8 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
9 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
10 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
11 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
12 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
13 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
14 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
15 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
16 2857727296 Kocuria sp. R-72562 Isolate Unclassified
17 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
18 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
19 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
20 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
107 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
162 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
169 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
170 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
183 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
184 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
185 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
191 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
199 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
200 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
211 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
220 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
221 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
222 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
223 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
224 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
225 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
226 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
227 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
228 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
229 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
230 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
231 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
232 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
233 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
236 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
237 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
238 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
239 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
240 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
241 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
242 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
243 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
244 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
245 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
246 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
249 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
250 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
251 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
252 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
253 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
254 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
255 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
256 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
257 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
277 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
280 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
286 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
290 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
317 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
341 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
345 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
346 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
347 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
348 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
349 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
350 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
351 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
352 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
353 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
354 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
357 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
358 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
359 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
362 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
363 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
364 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
365 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
366 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
367 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
368 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
369 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
370 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
371 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
372 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
395 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
396 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.96
Metatranscriptomes 14.2
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.43
Nodule 0
Rhizoplane 7.17
Rhizosphere 82.81
Stem 0
Stem Tuber 0
Unclassified 3.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1022013 3300001915 Bacteria 991
2 JGI24739J22299_10252701 3300001989 Bacteria 516
3 JGI24735J21928_10032301 3300002067 Bacteria 1550
4 Ga0058863_10060076 3300004799 Bacteria 2020
5 Ga0058861_11933151 3300004800 Bacteria 1064
6 Ga0058862_10086705 3300004803 Bacteria 980
7 Ga0070683_100273207 3300005329 Bacteria 1608
8 Ga0070683_100311672 3300005329 Bacteria 1497
9 Ga0070683_100451471 3300005329 Bacteria 1226
10 Ga0070683_101183110 3300005329 Bacteria 735
11 Ga0070683_101632912 3300005329 Bacteria 620
12 Ga0070690_101235759 3300005330 Bacteria 597
13 Ga0070670_100811020 3300005331 Bacteria 845
14 Ga0070677_10116410 3300005333 Bacteria 1201
15 Ga0070677_10731688 3300005333 Bacteria 560
16 Ga0070680_100758217 3300005336 Bacteria 836
17 Ga0070682_100065239 3300005337 Bacteria 2313
18 Ga0070682_100107395 3300005337 Bacteria 1854
19 Ga0070682_100846756 3300005337 Bacteria 747
20 Ga0070682_101106103 3300005337 Bacteria 664
21 Ga0068868_101052770 3300005338 Bacteria 747
22 Ga0070660_100432332 3300005339 Bacteria 1091
23 Ga0070689_100962810 3300005340 Bacteria 758
24 Ga0070689_101297147 3300005340 Bacteria 656
25 Ga0070661_100889375 3300005344 Bacteria 735
26 Ga0070661_101223654 3300005344 Bacteria 628
27 Ga0070661_101373986 3300005344 Bacteria 594
28 Ga0070692_10120656 3300005345 Bacteria 1462
29 Ga0070668_100319542 3300005347 Bacteria 1307
30 Ga0070668_100519866 3300005347 Bacteria 1033
31 Ga0070675_100105721 3300005354 Bacteria 2375
32 Ga0070675_101528454 3300005354 Bacteria 616
33 Ga0070675_102236886 3300005354 Bacteria 504
34 Ga0070671_100384485 3300005355 Bacteria 1200
35 Ga0070671_101118933 3300005355 Bacteria 692
36 Ga0070674_100270107 3300005356 Bacteria 1343
37 Ga0070674_100330570 3300005356 Bacteria 1225
38 Ga0070673_100310990 3300005364 Bacteria 1390
39 Ga0070673_101664321 3300005364 Bacteria 603
40 Ga0070659_101219955 3300005366 Bacteria 665
41 Ga0070667_100079087 3300005367 Bacteria 2810
42 Ga0070667_102132150 3300005367 Bacteria 528
43 Ga0070709_10124124 3300005434 Bacteria 1754
44 Ga0070710_10073724 3300005437 Bacteria 1974
45 Ga0070711_100020873 3300005439 Bacteria 4228
46 Ga0070700_100958072 3300005441 Bacteria 701
47 Ga0070700_101107743 3300005441 Bacteria 657
48 Ga0070663_100177359 3300005455 Bacteria 1650
49 Ga0070663_101058255 3300005455 Bacteria 708
50 Ga0070678_100066368 3300005456 Bacteria 2682
51 Ga0070678_100382263 3300005456 Bacteria 1218
52 Ga0070678_100666381 3300005456 Bacteria 934
53 Ga0070678_102161360 3300005456 Bacteria 528
54 Ga0070662_100759619 3300005457 Bacteria 823
55 Ga0070681_11656726 3300005458 Bacteria 565
56 Ga0068867_100154927 3300005459 Bacteria 1803
57 Ga0070707_100017376 3300005468 Bacteria 6762
58 Ga0070698_100006774 3300005471 Bacteria 12422
59 Ga0070699_101433024 3300005518 Bacteria 633
60 Ga0070679_100651974 3300005530 Bacteria 995
61 Ga0070684_100210157 3300005535 Bacteria 1773
62 Ga0070684_100305772 3300005535 Bacteria 1459
63 Ga0070684_100499327 3300005535 Bacteria 1127
64 Ga0070693_101242679 3300005547 Bacteria 574
65 Ga0070665_100422486 3300005548 Bacteria 1342
66 Ga0068857_100214101 3300005577 Bacteria 1759
67 Ga0068857_100227036 3300005577 Bacteria 1707
68 Ga0068856_101964677 3300005614 Bacteria 596
69 Ga0070702_100229424 3300005615 Bacteria 1246
70 Ga0070702_101213015 3300005615 Bacteria 609
71 Ga0068852_101084856 3300005616 Bacteria 821
72 Ga0068852_102641118 3300005616 Bacteria 522
73 Ga0068859_102796048 3300005617 Bacteria 536
74 Ga0068864_100762876 3300005618 Bacteria 949
75 Ga0068861_100802120 3300005719 Bacteria 884
76 Ga0068861_101387784 3300005719 Bacteria 686
77 Ga0068870_10016699 3300005840 Bacteria 3514
78 Ga0068858_100795276 3300005842 Bacteria 923
79 Ga0081540_1060450 3300005983 Bacteria 1812
80 Ga0070717_10207041 3300006028 Bacteria 1720
81 Ga0075365_10596167 3300006038 Bacteria 781
82 Ga0075365_10858253 3300006038 Bacteria 640
83 Ga0075365_11061651 3300006038 Bacteria 570
84 Ga0075365_11130317 3300006038 Bacteria 551
85 Ga0075368_10025723 3300006042 Bacteria 2259
86 Ga0075368_10123757 3300006042 Bacteria 1072
87 Ga0075363_100019633 3300006048 Bacteria 3380
88 Ga0075363_100060635 3300006048 Bacteria 2037
89 Ga0075363_100591250 3300006048 Bacteria 664
90 Ga0075364_10828663 3300006051 Bacteria 630
91 Ga0075364_11074626 3300006051 Bacteria 546
92 Ga0070715_10006159 3300006163 Bacteria 4059
93 Ga0070715_10433980 3300006163 Bacteria 738
94 Ga0070716_100037140 3300006173 Bacteria 2690
95 Ga0070712_100035731 3300006175 Bacteria 3374
96 Ga0075362_10573466 3300006177 Bacteria 581
97 Ga0075366_11053888 3300006195 Bacteria 508
98 Ga0097621_100501219 3300006237 Bacteria 1100
99 Ga0075370_10078009 3300006353 Bacteria 1901
100 Ga0075370_10285066 3300006353 Bacteria 981
101 Ga0075370_10336572 3300006353 Bacteria 900
102 Ga0075430_101373158 3300006846 Bacteria 581
103 Ga0068865_101114283 3300006881 Bacteria 696
104 Ga0068865_101262236 3300006881 Bacteria 656
105 Ga0097620_102796255 3300006931 Bacteria 536
106 Ga0105243_10146698 3300009148 Bacteria 2019
107 Ga0105243_10360349 3300009148 Bacteria 1338
108 Ga0105242_10074568 3300009176 Bacteria 2823
109 Ga0105242_11021495 3300009176 Bacteria 836
110 Ga0105248_12578970 3300009177 Bacteria 579
111 Ga0105237_11345211 3300009545 Bacteria 720
112 Ga0105238_11714173 3300009551 Bacteria 659
113 Ga0105249_10187575 3300009553 Bacteria 2016
114 Ga0105249_10189951 3300009553 Bacteria 2004
115 Ga0105249_11192357 3300009553 Bacteria 832
116 Ga0105239_10343319 3300010375 Bacteria 1685
117 Ga0105246_10158771 3300011119 Bacteria 1720
118 Ga0105246_10167003 3300011119 Bacteria 1682
119 Ga0157373_11033076 3300013100 Bacteria 614
120 Ga0157371_10611080 3300013102 Bacteria 811
121 Ga0157371_10738373 3300013102 Bacteria 739
122 Ga0157371_11117769 3300013102 Bacteria 605
123 Ga0157374_10428838 3300013296 Bacteria 1322
124 Ga0157378_10010737 3300013297 Bacteria 8006
125 Ga0157378_11089778 3300013297 Bacteria 835
126 Ga0163162_10081947 3300013306 Bacteria 3298
127 Ga0163162_10293331 3300013306 Bacteria 1758
128 Ga0163162_10472890 3300013306 Bacteria 1385
129 Ga0163162_11491256 3300013306 Bacteria 770
130 Ga0157372_10787012 3300013307 Bacteria 1105
131 Ga0157372_10922008 3300013307 Bacteria 1013
132 Ga0157375_10008009 3300013308 Bacteria 9253
133 Ga0157375_11289503 3300013308 Bacteria 858
134 Ga0163163_10024937 3300014325 Bacteria 5694
135 Ga0163163_10901979 3300014325 Bacteria 947
136 Ga0157380_10036717 3300014326 Bacteria 3793
137 Ga0157380_10108855 3300014326 Bacteria 2324
138 Ga0157380_10391403 3300014326 Bacteria 1315
139 Ga0157380_13422903 3300014326 Bacteria 508
140 Ga0157376_11728478 3300014969 Bacteria 661
141 Ga0197907_10647083 3300020069 Bacteria 1819
142 Ga0197907_11170858 3300020069 Bacteria 989
143 Ga0206356_11565064 3300020070 Bacteria 1219
144 Ga0206349_1141404 3300020075 Bacteria 767
145 Ga0206349_1354096 3300020075 Bacteria 949
146 Ga0206349_1934290 3300020075 Bacteria 627
147 Ga0206355_1069744 3300020076 Bacteria 1016
148 Ga0206355_1090915 3300020076 Bacteria 1652
149 Ga0206355_1407428 3300020076 Bacteria 589
150 Ga0206350_10745375 3300020080 Bacteria 1033
151 Ga0206354_10057345 3300020081 Bacteria 535
152 Ga0206354_11411084 3300020081 Bacteria 869
153 Ga0206353_10414422 3300020082 Bacteria 1658
154 Ga0154015_1147349 3300020610 Bacteria 1747
155 Ga0213875_10088929 3300021388 Bacteria 1441
156 Ga0224712_10293475 3300022467 Bacteria 759
157 Ga0224712_10419276 3300022467 Bacteria 640
158 Ga0228600_1006526 3300024123 Bacteria 870
159 Ga0207656_10096111 3300025321 Bacteria 1352
160 Ga0207692_10005017 3300025898 Bacteria 5270
161 Ga0207692_10380793 3300025898 Bacteria 876
162 Ga0207688_10036973 3300025901 Bacteria 2707
163 Ga0207688_10555246 3300025901 Bacteria 722
164 Ga0207647_10670051 3300025904 Bacteria 567
165 Ga0207685_10077352 3300025905 Bacteria 1367
166 Ga0207699_10012149 3300025906 Bacteria 4373
167 Ga0207645_10674583 3300025907 Bacteria 702
168 Ga0207643_10024696 3300025908 Bacteria 3316
169 Ga0207705_10847246 3300025909 Bacteria 709
170 Ga0207684_10697678 3300025910 Bacteria 863
171 Ga0207707_10503279 3300025912 Bacteria 1033
172 Ga0207707_11430485 3300025912 Bacteria 550
173 Ga0207693_10073798 3300025915 Bacteria 2671
174 Ga0207663_10196153 3300025916 Bacteria 1453
175 Ga0207657_10059474 3300025919 Bacteria 3283
176 Ga0207657_10194651 3300025919 Bacteria 1634
177 Ga0207649_10512263 3300025920 Bacteria 914
178 Ga0207649_11010700 3300025920 Bacteria 654
179 Ga0207652_10239587 3300025921 Bacteria 1635
180 Ga0207646_10080136 3300025922 Bacteria 2919
181 Ga0207694_10456750 3300025924 Bacteria 1067
182 Ga0207650_11047429 3300025925 Bacteria 694
183 Ga0207664_10038812 3300025929 Bacteria 3694
184 Ga0207644_10467299 3300025931 Bacteria 1038
185 Ga0207690_10961151 3300025932 Bacteria 710
186 Ga0207686_11652325 3300025934 Bacteria 529
187 Ga0207709_10060849 3300025935 Bacteria 2357
188 Ga0207670_11295421 3300025936 Bacteria 618
189 Ga0207669_10201528 3300025937 Bacteria 1445
190 Ga0207704_10878510 3300025938 Bacteria 753
191 Ga0207665_10014926 3300025939 Bacteria 5103
192 Ga0207691_10584926 3300025940 Bacteria 945
193 Ga0207711_10809600 3300025941 Bacteria 872
194 Ga0207661_10030802 3300025944 Bacteria 4136
195 Ga0207712_10245420 3300025961 Bacteria 1445
196 Ga0207712_10516564 3300025961 Bacteria 1023
197 Ga0207658_10023394 3300025986 Bacteria 4312
198 Ga0207677_10808731 3300026023 Bacteria 840
199 Ga0207703_12206410 3300026035 Bacteria 527
200 Ga0207678_10392021 3300026067 Bacteria 1201
201 Ga0207708_10381432 3300026075 Bacteria 1162
202 Ga0207702_10845417 3300026078 Bacteria 906
203 Ga0207641_10703894 3300026088 Bacteria 995
204 Ga0207641_11767956 3300026088 Bacteria 620
205 Ga0207641_12252105 3300026088 Bacteria 545
206 Ga0207648_10161787 3300026089 Bacteria 1977
207 Ga0207676_10320409 3300026095 Bacteria 1423
208 Ga0207676_10381580 3300026095 Bacteria 1312
209 Ga0207674_10026320 3300026116 Bacteria 6181
210 Ga0207674_10225152 3300026116 Bacteria 1824
211 Ga0207675_100145970 3300026118 Bacteria 2250
212 Ga0207675_100928854 3300026118 Bacteria 887
213 Ga0207683_10191528 3300026121 Bacteria 1857
214 Ga0207683_10491198 3300026121 Bacteria 1133
215 Ga0209813_10001880 3300027866 Bacteria 4739
216 Ga0268266_10111658 3300028379 Bacteria 2422
217 Ga0268264_10000792 3300028381 Bacteria 34282
218 Ga0316176_1044392 3300030732 Bacteria 723
219 Ga0265763_1001461 3300030763 Bacteria 1691
220 Ga0265766_1005347 3300030863 Bacteria 812
221 Ga0265769_106022 3300030888 Bacteria 752
222 Ga0265768_102109 3300030963 Bacteria 994
223 Ga0265773_1011144 3300031018 Bacteria 769
224 Ga0307408_100025858 3300031548 Bacteria 4024
225 Ga0316579_10005517 3300031691 Bacteria 5115
226 Ga0316579_10119546 3300031691 Bacteria 1266
227 Ga0316579_10228583 3300031691 Bacteria 900
228 Ga0316576_10006920 3300031727 Bacteria 7091
229 Ga0316576_10009973 3300031727 Bacteria 6151
230 Ga0316576_10049104 3300031727 Bacteria 3063
231 Ga0316576_10164950 3300031727 Bacteria 1671
232 Ga0316578_10012098 3300031728 Bacteria 4541
233 Ga0316578_10017124 3300031728 Bacteria 3939
234 Ga0316578_10039413 3300031728 Bacteria 2729
235 Ga0316578_10228139 3300031728 Bacteria 1119
236 Ga0307405_10408320 3300031731 Bacteria 1065
237 Ga0307405_10696624 3300031731 Bacteria 841
238 Ga0307413_10152007 3300031824 Bacteria 1614
239 Ga0307410_10008640 3300031852 Bacteria 5660
240 Ga0307410_10242712 3300031852 Bacteria 1397
241 Ga0307410_10335247 3300031852 Bacteria 1204
242 Ga0307406_11075700 3300031901 Bacteria 693
243 Ga0307407_10091249 3300031903 Bacteria 1867
244 Ga0307412_11195920 3300031911 Bacteria 680
245 Ga0307409_100001225 3300031995 Bacteria 12356
246 Ga0307409_100253869 3300031995 Bacteria 1609
247 Ga0307409_100592740 3300031995 Bacteria 1094
248 Ga0307409_101218585 3300031995 Bacteria 776
249 Ga0307416_100003637 3300032002 Bacteria 9109
250 Ga0307414_11037266 3300032004 Bacteria 756
251 Ga0307411_10568504 3300032005 Bacteria 970
252 Ga0307411_10860531 3300032005 Bacteria 803
253 Ga0307411_11813352 3300032005 Bacteria 566
254 Ga0307415_100317652 3300032126 Bacteria 1297
255 Ga0316583_10012326 3300032133 Bacteria 3084
256 Ga0316583_10189270 3300032133 Bacteria 715
257 Ga0316585_10043899 3300032137 Bacteria 1428
258 Ga0316585_10186517 3300032137 Bacteria 685
259 Ga0316580_10064417 3300032139 Bacteria 1124
260 Ga0316580_10088221 3300032139 Bacteria 949
261 Ga0316593_10000304 3300032168 Bacteria 8362
262 Ga0316593_10002456 3300032168 Bacteria 4406
263 Ga0316593_10006052 3300032168 Bacteria 3241
264 Ga0316593_10071625 3300032168 Bacteria 1199
265 Ga0316593_10292263 3300032168 Bacteria 616
266 Ga0316592_1004568 3300033524 Bacteria 2580
267 Ga0316592_1006305 3300033524 Bacteria 2281
268 Ga0316592_1022884 3300033524 Bacteria 1338
269 Ga0316592_1039236 3300033524 Bacteria 1046
270 Ga0316592_1088949 3300033524 Bacteria 706
271 Ga0316586_1007512 3300033527 Bacteria 1591
272 Ga0316586_1062448 3300033527 Bacteria 679
273 Ga0316588_1046325 3300033528 Bacteria 1048
274 Ga0316596_1000140 3300033541 Bacteria 9866
275 Ga0316596_1007697 3300033541 Bacteria 2552
276 Ga0316596_1014012 3300033541 Bacteria 1983
277 Ga0373950_0017391 3300034818 Bacteria 1239
278 Ga0373959_0025753 3300034820 Bacteria 1158
279 Ga0373934_0001665 3300035086 Bacteria 8157
280 Ga0373923_0007458 3300035111 Bacteria 3846
281 Ga0373936_0070564 3300035113 Bacteria 1439
282 Ga0373936_0288709 3300035113 Bacteria 738
283 Ga0373945_0066209 3300035116 Bacteria 1358
284 Ga0373953_0004941 3300035117 Bacteria 4291
285 Ga0373954_0006014 3300035118 Bacteria 5280
286 Ga0373956_0008114 3300035119 Bacteria 4249
287 Ga0373957_0001036 3300035120 Bacteria 7312
288 Ga0373960_0064490 3300035121 Bacteria 1119
289 Ga0373946_0310502 3300035171 Bacteria 781
290 Ga0373962_0223850 3300035242 Bacteria 645
291 Ga0316574_0000119 3300035398 Bacteria 24097
292 Ga0316574_0003558 3300035398 Bacteria 8051
293 Ga0316574_0022365 3300035398 Bacteria 3763
294 Ga0316574_0023256 3300035398 Bacteria 3699
295 Ga0316574_0034195 3300035398 Bacteria 3097
296 Ga0316574_0049174 3300035398 Bacteria 2621
297 Ga0373924_0044587 3300035410 Bacteria 1822
298 Ga0373931_0637880 3300035691 Bacteria 699
299 Ga0373935_0071970 3300035692 Bacteria 2231
300 Ga0373935_0969695 3300035692 Bacteria 631
301 Ga0373935_1072142 3300035692 Bacteria 599
302 Ga0373933_0002959 3300035724 Bacteria 9478
303 Ga0373937_0068251 3300036401 Bacteria 3277
304 Ga0373937_0644479 3300036401 Bacteria 1005
305 Ga0265778_016495 3300036457 Bacteria 886
306 Ga0316582_0031807 3300036647 Bacteria 3228
307 Ga0316582_0117570 3300036647 Bacteria 1776
308 Ga0316582_0331808 3300036647 Bacteria 1046
309 Ga0316584_0005394 3300036712 Bacteria 8579
310 Ga0316584_0009403 3300036712 Bacteria 6785
311 Ga0316584_0055102 3300036712 Bacteria 2977
312 Ga0316584_0099111 3300036712 Bacteria 2182
313 Ga0316584_0360323 3300036712 Bacteria 1043
314 Ga0373925_0092377 3300037068 Bacteria 2315
315 Ga0395899_0886126 3300037312 Bacteria 545
316 Ga0395900_0068181 3300037418 Bacteria 3655
317 Ga0395900_0205946 3300037418 Bacteria 1988
318 Ga0395900_0278590 3300037418 Bacteria 1665
319 Ga0395898_0039180 3300037466 Bacteria 4691
320 Ga0395898_0353407 3300037466 Bacteria 1401
321 Ga0395898_0613993 3300037466 Bacteria 1030
322 Ga0436364_0124034 3300037853 Bacteria 626
323 Ga0395901_0018326 3300038443 Bacteria 7147
324 Ga0395901_0154973 3300038443 Bacteria 2406
325 Ga0395901_0370453 3300038443 Bacteria 1475
326 Ga0395901_0482913 3300038443 Bacteria 1263
327 Ga0395901_0601842 3300038443 Bacteria 1108
328 Ga0436360_0626054 3300039438 Bacteria 1532
329 Ga0436360_0821879 3300039438 Bacteria 752
330 Ga0436362_0361172 3300039453 Bacteria 975
331 Ga0439466_0219435 3300041411 Bacteria 577
332 Ga0439465_0309839 3300041413 Bacteria 592
333 Ga0451793_1462454 3300041452 Bacteria 732
334 Ga0451797_1542332 3300041453 Bacteria 615
335 Ga0451795_1488462 3300041456 Bacteria 516
336 Ga0451800_0021290 3300041459 Bacteria 898
337 Ga0451800_0225272 3300041459 Bacteria 1325
338 Ga0451802_1939573 3300041460 Bacteria 860
339 Ga0451807_2386134 3300041486 Bacteria 548
340 Ga0451835_0634236 3300041492 Bacteria 710
341 Ga0451847_0859504 3300041503 Bacteria 516
342 Ga0451849_0617100 3300041505 Bacteria 797
343 Ga0451851_0191684 3300041507 Bacteria 704
344 Ga0451843_0895626 3300041509 Bacteria 1168
345 Ga0451843_1048037 3300041509 Bacteria 746
346 Ga0451855_0317925 3300041511 Bacteria 622
347 Ga0451853_2531387 3300041512 Bacteria 632
348 Ga0439433_0119062 3300041999 Bacteria 665
349 Ga0439442_034482 3300042002 Bacteria 1058
350 Ga0439442_085984 3300042002 Bacteria 675
351 Ga0439449_0227513 3300042007 Bacteria 700
352 Ga0439456_157332 3300042013 Bacteria 531
353 Ga0439457_017658 3300042014 Bacteria 1584
354 Ga0450923_030640 3300042125 Bacteria 1095
355 Ga0450906_019906 3300042145 Bacteria 1202
356 Ga0439446_0219087 3300042156 Bacteria 648
357 Ga0439464_0113399 3300042439 Bacteria 831
358 Ga0450918_094996 3300042531 Bacteria 579
359 Ga0466972_0030280 3300044658 Bacteria 2664
360 Ga0466972_0129038 3300044658 Bacteria 1191
361 Ga0466972_0189232 3300044658 Bacteria 965
362 Ga0466965_0045066 3300044683 Bacteria 2181
363 Ga0466965_0170635 3300044683 Bacteria 1144
364 Ga0466965_0214365 3300044683 Bacteria 1024
365 Ga0466965_0380417 3300044683 Bacteria 777
366 Ga0466966_0021458 3300044684 Bacteria 4241
367 Ga0466961_0044759 3300044693 Bacteria 2832
368 Ga0466963_0009270 3300044694 Bacteria 5926
369 Ga0466963_0082336 3300044694 Bacteria 2181
370 Ga0466963_0127964 3300044694 Bacteria 1752
371 Ga0466964_0067090 3300044706 Bacteria 1507
372 Ga0466964_0225089 3300044706 Bacteria 913
373 Ga0453684_0153453 3300044712 Bacteria 2734
374 Ga0466971_0096897 3300044719 Bacteria 1353
375 Ga0466971_0126774 3300044719 Bacteria 1183
376 Ga0466968_0047855 3300044735 Bacteria 1819
377 Ga0466970_0308726 3300044765 Bacteria 893
378 Ga0466957_0002716 3300044842 Bacteria 9569
379 Ga0466957_0005571 3300044842 Bacteria 7075
380 Ga0466960_0036578 3300044901 Bacteria 2299
381 Ga0466958_0016958 3300045836 Bacteria 4201
382 Ga0466958_0064232 3300045836 Bacteria 2238
383 Ga0466967_0039429 3300045976 Bacteria 4061
384 Ga0466967_0068905 3300045976 Bacteria 3160
385 Ga0466967_0102456 3300045976 Bacteria 2619
386 Ga0466967_0166934 3300045976 Bacteria 2069
387 Ga0466967_1284717 3300045976 Bacteria 729
388 Ga0466967_1515293 3300045976 Bacteria 668
389 Ga0495592_0036318 3300046454 Bacteria 3711
390 Ga0495592_0827598 3300046454 Bacteria 548
391 Ga0495629_0168375 3300046459 Bacteria 1521
392 Ga0495629_0253751 3300046459 Bacteria 1210
393 Ga0495629_1151731 3300046459 Bacteria 500
394 Ga0495641_0071039 3300046461 Bacteria 1563
395 Ga0495641_0090096 3300046461 Bacteria 1370
396 Ga0495641_0179949 3300046461 Bacteria 946
397 Ga0495651_0058206 3300046462 Bacteria 2965
398 Ga0495651_0948140 3300046462 Bacteria 524
399 Ga0495653_0009908 3300046463 Bacteria 7793
400 Ga0495653_0051203 3300046463 Bacteria 3171
401 Ga0495582_0244773 3300046473 Bacteria 1028
402 Ga0495662_0008003 3300046476 Bacteria 5206
403 Ga0495662_0581790 3300046476 Bacteria 548
404 Ga0495664_0010379 3300046477 Bacteria 5222
405 Ga0495664_0367311 3300046477 Bacteria 866
406 Ga0495608_0009099 3300046511 Bacteria 6942
407 Ga0495608_0180175 3300046511 Bacteria 1337
408 Ga0495608_0808726 3300046511 Bacteria 553
409 Ga0495618_0019818 3300046514 Bacteria 4140
410 Ga0495620_0204517 3300046515 Bacteria 759
411 Ga0495628_0018735 3300046516 Bacteria 5729
412 Ga0495630_0792944 3300046517 Bacteria 723
413 Ga0495652_0028241 3300046529 Bacteria 4938
414 Ga0495652_1032869 3300046529 Bacteria 536
415 Ga0495640_0013782 3300046533 Bacteria 6143
416 Ga0495640_0490699 3300046533 Bacteria 748
417 Ga0495640_0551081 3300046533 Bacteria 699
418 Ga0495586_0007029 3300046535 Bacteria 6000
419 Ga0495586_0246526 3300046535 Bacteria 1019
420 Ga0495586_0354487 3300046535 Bacteria 843
421 Ga0495587_0252404 3300046536 Bacteria 991
422 Ga0495645_0015924 3300046543 Bacteria 5357
423 Ga0495667_0032466 3300046559 Bacteria 3498
424 Ga0495656_0429651 3300046615 Bacteria 694
425 Ga0495668_0627638 3300046616 Bacteria 594
426 Ga0495634_0018243 3300046642 Bacteria 4997
427 Ga0495635_0008577 3300046663 Bacteria 7137
428 Ga0495635_0125252 3300046663 Bacteria 1752
429 Ga0495635_0452902 3300046663 Bacteria 848
430 Ga0495588_0268103 3300046674 Bacteria 900
431 Ga0495657_0007738 3300046675 Bacteria 8264
432 Ga0495657_0195688 3300046675 Bacteria 1234
433 Ga0495599_0006925 3300046678 Bacteria 6853
434 Ga0495599_0762367 3300046678 Bacteria 555
435 Ga0495623_0093050 3300046679 Bacteria 1846
436 Ga0495623_0520155 3300046679 Bacteria 626
437 Ga0495646_0011402 3300046680 Bacteria 5644
438 Ga0495646_0463265 3300046680 Bacteria 654
439 Ga0495613_1091854 3300046689 Bacteria 510
440 Ga0495624_0268209 3300046690 Bacteria 1031
441 Ga0495649_0622847 3300046694 Bacteria 532
442 Ga0495600_0005775 3300046809 Bacteria 7475
443 Ga0495600_0209912 3300046809 Bacteria 1248
444 Ga0495600_0260765 3300046809 Bacteria 1101
445 Ga0495600_0366695 3300046809 Bacteria 900
446 Ga0495581_0335935 3300047315 Bacteria 882
447 Ga0495581_0764312 3300047315 Bacteria 555
448 Ga0495604_0087106 3300047317 Bacteria 2327
449 Ga0495604_0218905 3300047317 Bacteria 1312
450 Ga0495674_0032123 3300047319 Bacteria 4764
451 Ga0495674_0179954 3300047319 Bacteria 1761
452 Ga0495676_0143826 3300047321 Bacteria 1706
453 Ga0495680_0027683 3300047322 Bacteria 4652
454 Ga0495684_0004161 3300047471 Bacteria 11297
455 Ga0495684_1035324 3300047471 Bacteria 519
456 Ga0495593_0254314 3300047673 Bacteria 879
457 Ga0495593_0423997 3300047673 Bacteria 665
458 Ga0495602_0013833 3300048088 Bacteria 8227
459 Ga0495602_0389883 3300048088 Bacteria 996
460 Ga0495614_0275477 3300048089 Bacteria 774
461 Ga0495614_0297387 3300048089 Bacteria 745
462 Ga0496100_0908799 3300048903 Bacteria 691
463 Ga0496101_0705386 3300048904 Bacteria 796
464 Ga0496101_1035508 3300048904 Bacteria 645
465 Ga0496101_1290546 3300048904 Bacteria 571
466 Ga0496102_0030623 3300048905 Bacteria 4816
467 Ga0496102_0120753 3300048905 Bacteria 2447
468 Ga0496102_0337211 3300048905 Bacteria 1420
469 Ga0496102_0407622 3300048905 Bacteria 1277
470 Ga0496102_1208511 3300048905 Bacteria 675
471 Ga0496103_0005052 3300048906 Bacteria 7958
472 Ga0496103_0279531 3300048906 Bacteria 1074
473 Ga0496104_0129439 3300048907 Bacteria 2424
474 Ga0496104_0255136 3300048907 Bacteria 1666
475 Ga0496104_1107408 3300048907 Bacteria 695
476 Ga0496104_1338060 3300048907 Bacteria 619
477 Ga0496104_1348153 3300048907 Bacteria 616
478 Ga0496105_0288907 3300048908 Bacteria 1320
479 Ga0496105_1018781 3300048908 Bacteria 618
480 Ga0496106_0798608 3300048909 Bacteria 749
481 Ga0496107_0699555 3300048910 Bacteria 745
482 Ga0496107_0962012 3300048910 Bacteria 621
483 Ga0496108_0401780 3300048911 Bacteria 1196
484 Ga0496108_0671955 3300048911 Bacteria 899
485 Ga0496109_0008096 3300048912 Bacteria 8910
486 Ga0496109_1287039 3300048912 Bacteria 667
487 Ga0496110_0300304 3300048913 Bacteria 1462
488 Ga0496110_0906500 3300048913 Bacteria 788
489 Ga0496111_0014401 3300048914 Bacteria 5401
490 Ga0496111_0421053 3300048914 Bacteria 986
491 Ga0496111_1208826 3300048914 Bacteria 535
492 Ga0496112_0112019 3300048915 Bacteria 2698
493 Ga0496112_0430170 3300048915 Bacteria 1258
494 Ga0496113_0070533 3300048916 Bacteria 2656
495 Ga0496113_0352038 3300048916 Bacteria 1181
496 Ga0496114_0016801 3300048917 Bacteria 5901
497 Ga0496114_0232886 3300048917 Bacteria 1618
498 Ga0496114_0379960 3300048917 Bacteria 1250
499 Ga0496114_0422358 3300048917 Bacteria 1181
500 Ga0496115_0262751 3300048918 Bacteria 1419
501 Ga0496115_0276667 3300048918 Bacteria 1378
502 Ga0496115_0327839 3300048918 Bacteria 1251
503 Ga0496119_0064873 3300048922 Bacteria 2166
504 Ga0496119_0195410 3300048922 Bacteria 1051
505 Ga0501306_005147 3300049127 Bacteria 1489
506 Ga0501306_041755 3300049127 Bacteria 713
507 Ga0501308_016907 3300049128 Bacteria 878
508 Ga0501310_019548 3300049130 Bacteria 835
509 Ga0501310_025008 3300049130 Bacteria 767
510 Ga0501305_003692 3300049161 Bacteria 1750
511 Ga0501307_003412 3300049162 Bacteria 1556
512 Ga0501307_037304 3300049162 Bacteria 695
513 Ga0501316_029094 3300049532 Bacteria 732
514 Ga0501317_000571 3300049533 Bacteria 2698
515 Ga0501317_007376 3300049533 Bacteria 1239
516 Ga0501318_000382 3300049534 Bacteria 2728
517 Ga0501318_009260 3300049534 Bacteria 1070
518 Ga0501320_047908 3300049536 Bacteria 576
519 Ga0501320_050847 3300049536 Bacteria 564
520 Ga0501321_033787 3300049537 Bacteria 694
521 Ga0501322_006423 3300049538 Bacteria 837
522 Ga0501324_023152 3300049540 Bacteria 646
523 Ga0501325_001001 3300049541 Bacteria 1607
524 Ga0501325_007828 3300049541 Bacteria 914
525 Ga0501325_019830 3300049541 Bacteria 700
526 Ga0501032_0025353 3300049569 Bacteria 4088
527 Ga0501032_0388183 3300049569 Bacteria 897
528 Ga0501032_0635794 3300049569 Bacteria 678
529 Ga0501033_0176599 3300049570 Bacteria 1532
530 Ga0501034_0378229 3300049571 Bacteria 1341
531 Ga0501034_0517840 3300049571 Bacteria 1105
532 Ga0501036_0177346 3300049572 Bacteria 1794
533 Ga0501039_0068572 3300049575 Bacteria 2753
534 Ga0501039_0113661 3300049575 Bacteria 2117
535 Ga0501039_0765756 3300049575 Bacteria 754
536 Ga0501039_1119976 3300049575 Bacteria 610
537 Ga0501040_0206605 3300049576 Bacteria 1395
538 Ga0501041_0296712 3300049577 Bacteria 1018
539 Ga0501043_0277890 3300049579 Bacteria 1284
540 Ga0501043_0426685 3300049579 Bacteria 999
541 Ga0501043_0529730 3300049579 Bacteria 877
542 Ga0501046_0146996 3300049580 Bacteria 1780
543 Ga0501048_0029778 3300049582 Bacteria 3954
544 Ga0501067_0135302 3300049583 Bacteria 1372
545 Ga0501068_1039765 3300049584 Bacteria 541
546 Ga0501069_0005427 3300049585 Bacteria 6629
547 Ga0501069_0178944 3300049585 Bacteria 1225
548 Ga0501069_0941489 3300049585 Bacteria 526
549 Ga0501070_0006873 3300049586 Bacteria 9678
550 Ga0501070_0013575 3300049586 Bacteria 6866
551 Ga0501070_0099196 3300049586 Bacteria 2409
552 Ga0501070_0206820 3300049586 Bacteria 1611
553 Ga0501071_0039375 3300049587 Bacteria 3381
554 Ga0501071_0354349 3300049587 Bacteria 1117
555 Ga0501072_0047842 3300049588 Bacteria 3368
556 Ga0501072_0087547 3300049588 Bacteria 2471
557 Ga0501072_1565234 3300049588 Bacteria 508
558 Ga0501073_0297204 3300049589 Bacteria 1114
559 Ga0501075_0136382 3300049591 Bacteria 1869
560 Ga0501075_0198760 3300049591 Bacteria 1529
561 Ga0501075_0844784 3300049591 Bacteria 696
562 Ga0501076_0003905 3300049592 Bacteria 10504
563 Ga0501076_0413544 3300049592 Bacteria 1109
564 Ga0501077_0264462 3300049593 Bacteria 1094
565 Ga0501079_0328170 3300049741 Bacteria 1198
566 Ga0501079_1672699 3300049741 Bacteria 500
567 Ga0501080_0004134 3300049742 Bacteria 12866
568 Ga0501080_0259013 3300049742 Bacteria 1585
569 Ga0501080_1132297 3300049742 Bacteria 675
570 Ga0501081_0020597 3300049743 Bacteria 4395
571 Ga0501081_0509230 3300049743 Bacteria 897
572 Ga0501083_0856737 3300049744 Bacteria 591
573 Ga0501035_1076064 3300049822 Bacteria 629
574 Ga0501044_0008850 3300049823 Bacteria 11009
575 Ga0501044_0748542 3300049823 Bacteria 860
576 Ga0501044_1268146 3300049823 Bacteria 604
577 Ga0501045_0215113 3300049824 Bacteria 1431
578 Ga0501045_0638090 3300049824 Bacteria 787
579 nmdc:mga03683_573088_c1 3300050489 Bacteria 551
580 nmdc:mga03n38_349267_c1 3300050490 Bacteria 805
581 nmdc:mga03n38_6080_c1 3300050490 Bacteria 4168
582 nmdc:mga03n38_6768_c1 3300050490 Bacteria 4010
583 nmdc:mga00v17_3224_c1 3300050491 Bacteria 8405
584 nmdc:mga00v17_33777_c1 3300050491 Bacteria 3034
585 nmdc:mga00v17_404833_c1 3300050491 Bacteria 887
586 nmdc:mga00v17_701231_c1 3300050491 Bacteria 649
587 nmdc:mga00v17_932492_c1 3300050491 Bacteria 549
588 nmdc:mga0yw44_12755_c1 3300050492 Bacteria 4395
589 nmdc:mga0yw44_173021_c1 3300050492 Bacteria 1419
590 nmdc:mga0yw44_299857_c1 3300050492 Bacteria 1077
591 nmdc:mga0yw44_544996_c1 3300050492 Bacteria 788
592 nmdc:mga0yw44_77900_c1 3300050492 Bacteria 2072
593 nmdc:mga0yw44_803735_c1 3300050492 Bacteria 639
594 nmdc:mga06z11_1560_c1 3300050494 Bacteria 8521
595 nmdc:mga04h51_4651_c1 3300050495 Bacteria 3433
596 nmdc:mga04h51_6700_c1 3300050495 Bacteria 3003
597 nmdc:mga07m45_362760_c1 3300050496 Bacteria 842
598 nmdc:mga07m45_406968_c1 3300050496 Bacteria 790
599 nmdc:mga07m45_715152_c1 3300050496 Bacteria 576
600 nmdc:mga0sz30_589827_c1 3300050516 Bacteria 503
601 Ga0495612_0090722 3300053078 Bacteria 1293
602 Ga0495595_0072157 3300053084 Bacteria 1633
603 Ga0495595_0469064 3300053084 Bacteria 640
604 Ga0495619_0005374 3300053085 Bacteria 8112
605 Ga0495619_0063850 3300053085 Bacteria 2454
606 Ga0495619_0138558 3300053085 Bacteria 1674
607 Ga0495619_0232043 3300053085 Bacteria 1279
608 Ga0500641_0016659 3300053096 Bacteria 2739
609 Ga0500641_0091319 3300053096 Bacteria 1300
610 Ga0500554_010844 3300053102 Bacteria 2237
611 Ga0500633_0070375 3300053160 Bacteria 1248
612 Ga0501084_0305167 3300054114 Bacteria 1344
613 Ga0587066_067399 3300059490 Bacteria 745
614 Ga0587066_096158 3300059490 Bacteria 666
615 Ga0587070_036856 3300059491 Bacteria 917
616 Ga0587073_0040403 3300059492 Bacteria 1013
617 Ga0587073_0079602 3300059492 Bacteria 810
618 Ga0587077_012193 3300059493 Bacteria 1369
619 Ga0587077_027098 3300059493 Bacteria 1063
620 Ga0587077_243425 3300059493 Bacteria 517
621 Ga0587080_056879 3300059503 Bacteria 753
622 Ga0587083_0038089 3300059505 Bacteria 993
623 Ga0587083_0116209 3300059505 Bacteria 686
624 Ga0587086_002882 3300059507 Bacteria 1681
625 Ga0587090_014925 3300059510 Bacteria 1142
626 Ga0587094_044014 3300059513 Bacteria 736
627 Ga0587098_063711 3300059604 Bacteria 584
628 Ga0587106_005262 3300059605 Bacteria 1471
629 Ga0587101_002171 3300059623 Bacteria 1832
630 Ga0587101_018095 3300059623 Bacteria 984
631 Ga0587101_033249 3300059623 Bacteria 816
632 Ga0587113_031239 3300059625 Bacteria 605
633 Ga0587068_025290 3300059641 Bacteria 999
634 Ga0587068_036272 3300059641 Bacteria 877
635 Ga0587072_002939 3300059643 Bacteria 2345
636 Ga0587072_025288 3300059643 Bacteria 1079
637 Ga0587075_065525 3300059644 Bacteria 664
638 Ga0587076_007466 3300059645 Bacteria 1495
639 Ga0587076_022215 3300059645 Bacteria 1058
640 Ga0587079_044922 3300059647 Bacteria 906
641 Ga0587105_028639 3300059651 Bacteria 523
642 Ga0587107_031393 3300059652 Bacteria 810
643 Ga0587124_027662 3300059660 Bacteria 612
644 Ga0587071_008453 3300060344 Bacteria 1670
645 Ga0587071_059618 3300060344 Bacteria 808
646 Ga0501082_0082024 3300060353 Bacteria 2782
647 Ga0501082_0085561 3300060353 Bacteria 2719
648 Ga0466962_0004292 3300061719 Bacteria 6831
649 Ga0466962_0061905 3300061719 Bacteria 1786
650 Ga0530510_0063999 3300061734 Bacteria 2663

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0153453 Ga0453684_0153453_454_723 84
2 3300044658 Ga0466972_0129038 Ga0466972_0129038_743_1012 86
3 3300044694 Ga0466963_0009270 Ga0466963_0009270_37_306 86
4 3300044694 Ga0466963_0082336 Ga0466963_0082336_1126_1395 86
5 3300044706 Ga0466964_0225089 Ga0466964_0225089_372_641 86
6 3300044719 Ga0466971_0126774 Ga0466971_0126774_17_286 86
7 3300044842 Ga0466957_0002716 Ga0466957_0002716_4332_4601 86
8 3300045836 Ga0466958_0064232 Ga0466958_0064232_946_1215 86
9 3300045976 Ga0466967_0068905 Ga0466967_0068905_2704_2973 86
10 3300045976 Ga0466967_1284717 Ga0466967_1284717_10_276 86
11 3300045976 Ga0466967_1515293 Ga0466967_1515293_70_420 86
12 3300061719 Ga0466962_0061905 Ga0466962_0061905_1072_1341 86
13 3300011119 Ga0105246_10158771 Ga0105246_101587712 87
14 3300044658 Ga0466972_0030280 Ga0466972_0030280_122_397 87
15 3300044684 Ga0466966_0021458 Ga0466966_0021458_3679_3954 87
16 iso_pu_bacteria 2868088558 2868090554 87
17 3300005330 Ga0070690_101235759 Ga0070690_1012357591 88
18 3300005333 Ga0070677_10731688 Ga0070677_107316882 88
19 3300005344 Ga0070661_101373986 Ga0070661_1013739861 88
20 3300005354 Ga0070675_102236886 Ga0070675_1022368862 88
21 3300005356 Ga0070674_100270107 Ga0070674_1002701071 88
22 3300005364 Ga0070673_101664321 Ga0070673_1016643212 88
23 3300005441 Ga0070700_100958072 Ga0070700_1009580722 88
24 3300005455 Ga0070663_100177359 Ga0070663_1001773591 88
25 3300005456 Ga0070678_100382263 Ga0070678_1003822633 88
26 3300005459 Ga0068867_100154927 Ga0068867_1001549274 88
27 3300005535 Ga0070684_100305772 Ga0070684_1003057722 88
28 3300005547 Ga0070693_101242679 Ga0070693_1012426791 88
29 3300025937 Ga0207669_10201528 Ga0207669_102015282 88
30 3300025940 Ga0207691_10584926 Ga0207691_105849262 88
31 3300026089 Ga0207648_10161787 Ga0207648_101617874 88
32 3300026095 Ga0207676_10381580 Ga0207676_103815801 88
33 3300041459 Ga0451800_0021290 Ga0451800_0021290_511_777 88
34 3300041505 Ga0451849_0617100 Ga0451849_0617100_457_723 88
35 3300042439 Ga0439464_0113399 Ga0439464_0113399_75_344 88
36 3300042531 Ga0450918_094996 Ga0450918_094996_48_317 88
37 3300046515 Ga0495620_0204517 Ga0495620_0204517_284_550 88
38 3300049571 Ga0501034_0378229 Ga0501034_0378229_141_413 88
39 3300049584 Ga0501068_1039765 Ga0501068_1039765_53_325 88
40 3300049586 Ga0501070_0206820 Ga0501070_0206820_505_777 88
41 3300049588 Ga0501072_0087547 Ga0501072_0087547_989_1261 88
42 3300049742 Ga0501080_0259013 Ga0501080_0259013_442_714 88
43 iso_pu_bacteria 2799112218 2799184994 88
44 iso_pu_bacteria 2837268691 2837269022 88
45 3300031727 Ga0316576_10009973 Ga0316576_100099734 89
46 3300031728 Ga0316578_10228139 Ga0316578_102281392 89
47 3300035398 Ga0316574_0049174 Ga0316574_0049174_2282_2554 89
48 3300041511 Ga0451855_0317925 Ga0451855_0317925_53_328 89
49 3300049569 Ga0501032_0025353 Ga0501032_0025353_2396_2668 89
50 3300049571 Ga0501034_0517840 Ga0501034_0517840_611_883 89
51 3300049579 Ga0501043_0277890 Ga0501043_0277890_811_1083 89
52 3300049586 Ga0501070_0006873 Ga0501070_0006873_5981_6253 89
53 3300049823 Ga0501044_0008850 Ga0501044_0008850_5130_5402 89
54 3300050496 nmdc:mga07m45_362760_c1 nmdc:mga07m45_362760_c1_474_749 89
55 3300053085 Ga0495619_0005374 Ga0495619_0005374_4519_4788 89
56 3300004800 Ga0058861_11933151 Ga0058861_119331512 90
57 3300005340 Ga0070689_100962810 Ga0070689_1009628102 90
58 3300005344 Ga0070661_101223654 Ga0070661_1012236542 90
59 3300005354 Ga0070675_101528454 Ga0070675_1015284541 90
60 3300005441 Ga0070700_101107743 Ga0070700_1011077431 90
61 3300005456 Ga0070678_100666381 Ga0070678_1006663812 90
62 3300005618 Ga0068864_100762876 Ga0068864_1007628762 90
63 3300006846 Ga0075430_101373158 Ga0075430_1013731581 90
64 3300009553 Ga0105249_11192357 Ga0105249_111923572 90
65 3300014326 Ga0157380_13422903 Ga0157380_134229032 90
66 3300020081 Ga0206354_10057345 Ga0206354_100573452 90
67 3300025934 Ga0207686_11652325 Ga0207686_116523252 90
68 3300025961 Ga0207712_10516564 Ga0207712_105165643 90
69 3300026075 Ga0207708_10381432 Ga0207708_103814323 90
70 3300031995 Ga0307409_101218585 Ga0307409_1012185852 90
71 3300036457 Ga0265778_016495 Ga0265778_016495_129_401 90
72 3300039438 Ga0436360_0626054 Ga0436360_0626054_1148_1465 90
73 3300046616 Ga0495668_0627638 Ga0495668_0627638_96_374 90
74 3300047471 Ga0495684_1035324 Ga0495684_1035324_15_287 90
75 3300049536 Ga0501320_050847 Ga0501320_050847_45_317 90
76 3300049585 Ga0501069_0005427 Ga0501069_0005427_5766_6041 90
77 3300049586 Ga0501070_0099196 Ga0501070_0099196_205_480 90
78 3300049742 Ga0501080_0004134 Ga0501080_0004134_10790_11065 90
79 3300049744 Ga0501083_0856737 Ga0501083_0856737_66_341 90
80 3300049823 Ga0501044_0748542 Ga0501044_0748542_538_813 90
81 iso_pu_bacteria 2643221711 2644607519 90
82 iso_pu_bacteria 2739367653 2739602969 90
83 iso_pu_bacteria 2811994882 2812373716 90
84 iso_pu_bacteria 2816332305 2817508517 90
85 iso_pu_bacteria 2818991458 2819665367 90
86 iso_pu_bacteria 2818991462 2819691424 90
87 iso_pu_bacteria 2818991469 2819727540 90
88 iso_pu_bacteria 2857727296 2857727953 90
89 3300005329 Ga0070683_100273207 Ga0070683_1002732074 91
90 3300005347 Ga0070668_100319542 Ga0070668_1003195423 91
91 3300005535 Ga0070684_100499327 Ga0070684_1004993271 91
92 3300005577 Ga0068857_100214101 Ga0068857_1002141014 91
93 3300013102 Ga0157371_11117769 Ga0157371_111177692 91
94 3300013297 Ga0157378_11089778 Ga0157378_110897781 91
95 3300025944 Ga0207661_10030802 Ga0207661_100308024 91
96 3300026088 Ga0207641_12252105 Ga0207641_122521051 91
97 3300026116 Ga0207674_10225152 Ga0207674_102251524 91
98 3300045976 Ga0466967_0102456 Ga0466967_0102456_635_913 91
99 3300048913 Ga0496110_0906500 Ga0496110_0906500_39_317 91
100 3300049583 Ga0501067_0135302 Ga0501067_0135302_312_602 91
101 iso_pu_bacteria 2818991318 2819426330 91
102 3300005355 Ga0070671_101118933 Ga0070671_1011189332 92
103 3300005983 Ga0081540_1060450 Ga0081540_10604502 92
104 3300006177 Ga0075362_10573466 Ga0075362_105734662 92
105 3300022467 Ga0224712_10293475 Ga0224712_102934751 92
106 3300030732 Ga0316176_1044392 Ga0316176_10443922 92
107 3300044694 Ga0466963_0127964 Ga0466963_0127964_1022_1303 92
108 3300045976 Ga0466967_0039429 Ga0466967_0039429_2399_2680 92
109 3300050491 nmdc:mga00v17_33777_c1 nmdc:mga00v17_33777_c1_201_479 92
110 3300050492 nmdc:mga0yw44_12755_c1 nmdc:mga0yw44_12755_c1_3981_4259 92
111 iso_pu_bacteria 2643221567 2643851177 92
112 iso_pu_bacteria 2643221624 2644134966 92
113 iso_pu_bacteria 2731639228 2731908933 92
114 iso_pu_bacteria 2784132109 2784471475 92
115 iso_pu_bacteria 2919446982 2919449328 92
116 3300005329 Ga0070683_101632912 Ga0070683_1016329121 93
117 3300005367 Ga0070667_100079087 Ga0070667_1000790874 93
118 3300006038 Ga0075365_11061651 Ga0075365_110616512 93
119 3300006042 Ga0075368_10025723 Ga0075368_100257234 93
120 3300006042 Ga0075368_10123757 Ga0075368_101237573 93
121 3300006048 Ga0075363_100060635 Ga0075363_1000606355 93
122 3300006051 Ga0075364_11074626 Ga0075364_110746262 93
123 3300006163 Ga0070715_10433980 Ga0070715_104339801 93
124 3300006195 Ga0075366_11053888 Ga0075366_110538882 93
125 3300006353 Ga0075370_10078009 Ga0075370_100780094 93
126 3300006353 Ga0075370_10336572 Ga0075370_103365722 93
127 3300009177 Ga0105248_12578970 Ga0105248_125789701 93
128 3300020610 Ga0154015_1147349 Ga0154015_11473493 93
129 3300025909 Ga0207705_10847246 Ga0207705_108472461 93
130 3300025931 Ga0207644_10467299 Ga0207644_104672993 93
131 3300025986 Ga0207658_10023394 Ga0207658_100233945 93
132 3300026088 Ga0207641_10703894 Ga0207641_107038943 93
133 3300027866 Ga0209813_10001880 Ga0209813_100018805 93
134 3300031691 Ga0316579_10119546 Ga0316579_101195462 93
135 3300031727 Ga0316576_10006920 Ga0316576_100069207 93
136 3300031727 Ga0316576_10049104 Ga0316576_100491043 93
137 3300031728 Ga0316578_10012098 Ga0316578_100120987 93
138 3300032133 Ga0316583_10189270 Ga0316583_101892702 93
139 3300032137 Ga0316585_10186517 Ga0316585_101865172 93
140 3300032139 Ga0316580_10064417 Ga0316580_100644172 93
141 3300032139 Ga0316580_10088221 Ga0316580_100882212 93
142 3300032168 Ga0316593_10000304 Ga0316593_1000030410 93
143 3300033524 Ga0316592_1039236 Ga0316592_10392363 93
144 3300033524 Ga0316592_1088949 Ga0316592_10889492 93
145 3300033528 Ga0316588_1046325 Ga0316588_10463252 93
146 3300033541 Ga0316596_1014012 Ga0316596_10140124 93
147 3300035398 Ga0316574_0000119 Ga0316574_0000119_7662_7949 93
148 3300035398 Ga0316574_0003558 Ga0316574_0003558_1343_1627 93
149 3300036647 Ga0316582_0331808 Ga0316582_0331808_486_773 93
150 3300036712 Ga0316584_0055102 Ga0316584_0055102_1996_2283 93
151 3300036712 Ga0316584_0360323 Ga0316584_0360323_367_651 93
152 3300039438 Ga0436360_0821879 Ga0436360_0821879_57_362 93
153 3300041453 Ga0451797_1542332 Ga0451797_1542332_189_473 93
154 3300041509 Ga0451843_0895626 Ga0451843_0895626_837_1118 93
155 3300049575 Ga0501039_0765756 Ga0501039_0765756_380_670 93
156 3300049587 Ga0501071_0354349 Ga0501071_0354349_513_803 93
157 3300050489 nmdc:mga03683_573088_c1 nmdc:mga03683_573088_c1_190_471 93
158 3300050490 nmdc:mga03n38_6080_c1 nmdc:mga03n38_6080_c1_2629_2910 93
159 3300050490 nmdc:mga03n38_6768_c1 nmdc:mga03n38_6768_c1_475_759 93
160 3300050491 nmdc:mga00v17_932492_c1 nmdc:mga00v17_932492_c1_163_444 93
161 3300050494 nmdc:mga06z11_1560_c1 nmdc:mga06z11_1560_c1_1664_1948 93
162 3300050495 nmdc:mga04h51_6700_c1 nmdc:mga04h51_6700_c1_820_1104 93
163 3300050496 nmdc:mga07m45_406968_c1 nmdc:mga07m45_406968_c1_168_449 93
164 3300050516 nmdc:mga0sz30_589827_c1 nmdc:mga0sz30_589827_c1_179_460 93
165 3300059644 Ga0587075_065525 Ga0587075_065525_217_501 93
166 iso_pu_bacteria 2808606365 2808872985 93
167 3300005329 Ga0070683_100311672 Ga0070683_1003116724 94
168 3300005329 Ga0070683_101183110 Ga0070683_1011831102 94
169 3300005337 Ga0070682_101106103 Ga0070682_1011061032 94
170 3300005338 Ga0068868_101052770 Ga0068868_1010527702 94
171 3300005456 Ga0070678_102161360 Ga0070678_1021613602 94
172 3300005616 Ga0068852_102641118 Ga0068852_1026411182 94
173 3300013102 Ga0157371_10611080 Ga0157371_106110802 94
174 3300013306 Ga0163162_10081947 Ga0163162_100819476 94
175 3300013306 Ga0163162_11491256 Ga0163162_114912561 94
176 3300013307 Ga0157372_10787012 Ga0157372_107870122 94
177 3300013308 Ga0157375_11289503 Ga0157375_112895032 94
178 3300020076 Ga0206355_1069744 Ga0206355_10697442 94
179 3300025898 Ga0207692_10380793 Ga0207692_103807932 94
180 3300025932 Ga0207690_10961151 Ga0207690_109611512 94
181 3300026023 Ga0207677_10808731 Ga0207677_108087312 94
182 3300026121 Ga0207683_10491198 Ga0207683_104911983 94
183 3300031731 Ga0307405_10696624 Ga0307405_106966242 94
184 3300031852 Ga0307410_10335247 Ga0307410_103352472 94
185 3300031995 Ga0307409_100592740 Ga0307409_1005927402 94
186 3300037466 Ga0395898_0353407 Ga0395898_0353407_886_1176 94
187 3300041413 Ga0439465_0309839 Ga0439465_0309839_29_319 94
188 3300041452 Ga0451793_1462454 Ga0451793_1462454_51_335 94
189 3300042002 Ga0439442_034482 Ga0439442_034482_117_407 94
190 3300042156 Ga0439446_0219087 Ga0439446_0219087_297_587 94
191 3300044683 Ga0466965_0170635 Ga0466965_0170635_442_729 94
192 3300044683 Ga0466965_0214365 Ga0466965_0214365_141_428 94
193 3300044693 Ga0466961_0044759 Ga0466961_0044759_1806_2093 94
194 3300044706 Ga0466964_0067090 Ga0466964_0067090_1120_1407 94
195 3300044719 Ga0466971_0096897 Ga0466971_0096897_257_544 94
196 3300044735 Ga0466968_0047855 Ga0466968_0047855_1129_1416 94
197 3300044842 Ga0466957_0005571 Ga0466957_0005571_3850_4137 94
198 3300045836 Ga0466958_0016958 Ga0466958_0016958_3279_3566 94
199 3300046459 Ga0495629_0253751 Ga0495629_0253751_577_867 94
200 3300046535 Ga0495586_0246526 Ga0495586_0246526_349_639 94
201 3300046678 Ga0495599_0762367 Ga0495599_0762367_141_428 94
202 3300046809 Ga0495600_0209912 Ga0495600_0209912_749_1039 94
203 3300048903 Ga0496100_0908799 Ga0496100_0908799_43_333 94
204 3300048904 Ga0496101_0705386 Ga0496101_0705386_62_352 94
205 3300048905 Ga0496102_0120753 Ga0496102_0120753_908_1198 94
206 3300048905 Ga0496102_1208511 Ga0496102_1208511_325_615 94
207 3300048906 Ga0496103_0005052 Ga0496103_0005052_4269_4559 94
208 3300048907 Ga0496104_0129439 Ga0496104_0129439_2017_2316 94
209 3300048907 Ga0496104_1348153 Ga0496104_1348153_135_425 94
210 3300048908 Ga0496105_0288907 Ga0496105_0288907_354_644 94
211 3300048908 Ga0496105_1018781 Ga0496105_1018781_147_446 94
212 3300048910 Ga0496107_0699555 Ga0496107_0699555_151_441 94
213 3300048912 Ga0496109_0008096 Ga0496109_0008096_7882_8172 94
214 3300048913 Ga0496110_0300304 Ga0496110_0300304_607_897 94
215 3300048914 Ga0496111_0014401 Ga0496111_0014401_3035_3325 94
216 3300048914 Ga0496111_0421053 Ga0496111_0421053_659_958 94
217 3300048915 Ga0496112_0112019 Ga0496112_0112019_1023_1313 94
218 3300048916 Ga0496113_0352038 Ga0496113_0352038_334_624 94
219 3300048917 Ga0496114_0232886 Ga0496114_0232886_1179_1469 94
220 3300048917 Ga0496114_0422358 Ga0496114_0422358_440_727 94
221 3300048918 Ga0496115_0276667 Ga0496115_0276667_547_837 94
222 3300048922 Ga0496119_0064873 Ga0496119_0064873_636_926 94
223 3300048922 Ga0496119_0195410 Ga0496119_0195410_296_580 94
224 3300049128 Ga0501308_016907 Ga0501308_016907_69_359 94
225 3300049161 Ga0501305_003692 Ga0501305_003692_219_509 94
226 3300049162 Ga0501307_003412 Ga0501307_003412_418_708 94
227 3300049532 Ga0501316_029094 Ga0501316_029094_346_636 94
228 3300049533 Ga0501317_000571 Ga0501317_000571_213_503 94
229 3300049534 Ga0501318_000382 Ga0501318_000382_2072_2362 94
230 3300049541 Ga0501325_007828 Ga0501325_007828_279_569 94
231 3300049541 Ga0501325_019830 Ga0501325_019830_287_577 94
232 3300049585 Ga0501069_0178944 Ga0501069_0178944_899_1195 94
233 3300059507 Ga0587086_002882 Ga0587086_002882_524_814 94
234 3300059623 Ga0587101_002171 Ga0587101_002171_562_852 94
235 3300059641 Ga0587068_036272 Ga0587068_036272_562_852 94
236 3300059643 Ga0587072_002939 Ga0587072_002939_898_1188 94
237 3300060344 Ga0587071_008453 Ga0587071_008453_887_1177 94
238 3300061719 Ga0466962_0004292 Ga0466962_0004292_5541_5828 94
239 iso_pu_bacteria 3001889506 3001890597 94
240 3300001989 JGI24739J22299_10252701 JGI24739J22299_102527012 95
241 3300005331 Ga0070670_100811020 Ga0070670_1008110202 95
242 3300005333 Ga0070677_10116410 Ga0070677_101164103 95
243 3300005337 Ga0070682_100107395 Ga0070682_1001073955 95
244 3300005339 Ga0070660_100432332 Ga0070660_1004323323 95
245 3300005340 Ga0070689_101297147 Ga0070689_1012971472 95
246 3300005345 Ga0070692_10120656 Ga0070692_101206563 95
247 3300005347 Ga0070668_100519866 Ga0070668_1005198663 95
248 3300005354 Ga0070675_100105721 Ga0070675_1001057215 95
249 3300005355 Ga0070671_100384485 Ga0070671_1003844853 95
250 3300005356 Ga0070674_100330570 Ga0070674_1003305702 95
251 3300005364 Ga0070673_100310990 Ga0070673_1003109901 95
252 3300005367 Ga0070667_102132150 Ga0070667_1021321501 95
253 3300005455 Ga0070663_101058255 Ga0070663_1010582552 95
254 3300005456 Ga0070678_100066368 Ga0070678_1000663684 95
255 3300005535 Ga0070684_100210157 Ga0070684_1002101574 95
256 3300005548 Ga0070665_100422486 Ga0070665_1004224862 95
257 3300005614 Ga0068856_101964677 Ga0068856_1019646771 95
258 3300005615 Ga0070702_101213015 Ga0070702_1012130152 95
259 3300005616 Ga0068852_101084856 Ga0068852_1010848563 95
260 3300005617 Ga0068859_102796048 Ga0068859_1027960481 95
261 3300005719 Ga0068861_100802120 Ga0068861_1008021203 95
262 3300005840 Ga0068870_10016699 Ga0068870_100166996 95
263 3300005842 Ga0068858_100795276 Ga0068858_1007952762 95
264 3300006038 Ga0075365_10596167 Ga0075365_105961672 95
265 3300006038 Ga0075365_11130317 Ga0075365_111303172 95
266 3300006048 Ga0075363_100591250 Ga0075363_1005912502 95
267 3300006237 Ga0097621_100501219 Ga0097621_1005012192 95
268 3300006881 Ga0068865_101114283 Ga0068865_1011142832 95
269 3300006931 Ga0097620_102796255 Ga0097620_1027962551 95
270 3300009148 Ga0105243_10146698 Ga0105243_101466984 95
271 3300009176 Ga0105242_11021495 Ga0105242_110214952 95
272 3300009551 Ga0105238_11714173 Ga0105238_117141732 95
273 3300009553 Ga0105249_10187575 Ga0105249_101875752 95
274 3300010375 Ga0105239_10343319 Ga0105239_103433194 95
275 3300013100 Ga0157373_11033076 Ga0157373_110330762 95
276 3300013296 Ga0157374_10428838 Ga0157374_104288383 95
277 3300013306 Ga0163162_10472890 Ga0163162_104728903 95
278 3300013307 Ga0157372_10922008 Ga0157372_109220082 95
279 3300014325 Ga0163163_10901979 Ga0163163_109019792 95
280 3300014326 Ga0157380_10036717 Ga0157380_100367179 95
281 3300025321 Ga0207656_10096111 Ga0207656_100961113 95
282 3300025901 Ga0207688_10036973 Ga0207688_100369736 95
283 3300025901 Ga0207688_10555246 Ga0207688_105552462 95
284 3300025904 Ga0207647_10670051 Ga0207647_106700512 95
285 3300025907 Ga0207645_10674583 Ga0207645_106745832 95
286 3300025908 Ga0207643_10024696 Ga0207643_100246967 95
287 3300025919 Ga0207657_10194651 Ga0207657_101946513 95
288 3300025920 Ga0207649_10512263 Ga0207649_105122632 95
289 3300025924 Ga0207694_10456750 Ga0207694_104567503 95
290 3300025925 Ga0207650_11047429 Ga0207650_110474292 95
291 3300025935 Ga0207709_10060849 Ga0207709_100608492 95
292 3300025936 Ga0207670_11295421 Ga0207670_112954212 95
293 3300025941 Ga0207711_10809600 Ga0207711_108096003 95
294 3300025961 Ga0207712_10245420 Ga0207712_102454204 95
295 3300026035 Ga0207703_12206410 Ga0207703_122064102 95
296 3300026067 Ga0207678_10392021 Ga0207678_103920212 95
297 3300026078 Ga0207702_10845417 Ga0207702_108454171 95
298 3300026088 Ga0207641_11767956 Ga0207641_117679562 95
299 3300026095 Ga0207676_10320409 Ga0207676_103204093 95
300 3300026118 Ga0207675_100928854 Ga0207675_1009288542 95
301 3300026121 Ga0207683_10191528 Ga0207683_101915282 95
302 3300028379 Ga0268266_10111658 Ga0268266_101116583 95
303 3300031852 Ga0307410_10242712 Ga0307410_102427122 95
304 3300031995 Ga0307409_100253869 Ga0307409_1002538691 95
305 3300032005 Ga0307411_10568504 Ga0307411_105685041 95
306 3300034818 Ga0373950_0017391 Ga0373950_0017391_506_793 95
307 3300034820 Ga0373959_0025753 Ga0373959_0025753_458_745 95
308 3300035113 Ga0373936_0288709 Ga0373936_0288709_367_654 95
309 3300035691 Ga0373931_0637880 Ga0373931_0637880_143_430 95
310 3300035692 Ga0373935_0969695 Ga0373935_0969695_23_310 95
311 3300035692 Ga0373935_1072142 Ga0373935_1072142_223_510 95
312 3300036401 Ga0373937_0644479 Ga0373937_0644479_357_644 95
313 3300041456 Ga0451795_1488462 Ga0451795_1488462_154_447 95
314 3300041460 Ga0451802_1939573 Ga0451802_1939573_375_662 95
315 3300041492 Ga0451835_0634236 Ga0451835_0634236_241_528 95
316 3300044658 Ga0466972_0189232 Ga0466972_0189232_201_491 95
317 3300044683 Ga0466965_0045066 Ga0466965_0045066_1449_1739 95
318 3300044765 Ga0466970_0308726 Ga0466970_0308726_541_831 95
319 3300044901 Ga0466960_0036578 Ga0466960_0036578_1057_1347 95
320 3300046454 Ga0495592_0827598 Ga0495592_0827598_76_363 95
321 3300046459 Ga0495629_0168375 Ga0495629_0168375_692_979 95
322 3300046461 Ga0495641_0071039 Ga0495641_0071039_569_856 95
323 3300046462 Ga0495651_0948140 Ga0495651_0948140_142_429 95
324 3300046463 Ga0495653_0051203 Ga0495653_0051203_165_452 95
325 3300046473 Ga0495582_0244773 Ga0495582_0244773_466_753 95
326 3300046477 Ga0495664_0367311 Ga0495664_0367311_236_523 95
327 3300046511 Ga0495608_0808726 Ga0495608_0808726_154_441 95
328 3300046517 Ga0495630_0792944 Ga0495630_0792944_126_413 95
329 3300046529 Ga0495652_1032869 Ga0495652_1032869_192_479 95
330 3300046533 Ga0495640_0490699 Ga0495640_0490699_417_704 95
331 3300046533 Ga0495640_0551081 Ga0495640_0551081_90_377 95
332 3300046535 Ga0495586_0354487 Ga0495586_0354487_112_399 95
333 3300046663 Ga0495635_0125252 Ga0495635_0125252_670_957 95
334 3300046674 Ga0495588_0268103 Ga0495588_0268103_59_346 95
335 3300046675 Ga0495657_0195688 Ga0495657_0195688_28_315 95
336 3300046679 Ga0495623_0520155 Ga0495623_0520155_20_307 95
337 3300046680 Ga0495646_0463265 Ga0495646_0463265_149_436 95
338 3300046689 Ga0495613_1091854 Ga0495613_1091854_34_321 95
339 3300046690 Ga0495624_0268209 Ga0495624_0268209_498_785 95
340 3300046694 Ga0495649_0622847 Ga0495649_0622847_211_498 95
341 3300046809 Ga0495600_0260765 Ga0495600_0260765_538_825 95
342 3300047315 Ga0495581_0335935 Ga0495581_0335935_519_806 95
343 3300047317 Ga0495604_0218905 Ga0495604_0218905_163_450 95
344 3300047319 Ga0495674_0179954 Ga0495674_0179954_60_347 95
345 3300047673 Ga0495593_0423997 Ga0495593_0423997_267_554 95
346 3300048088 Ga0495602_0389883 Ga0495602_0389883_150_437 95
347 3300048089 Ga0495614_0275477 Ga0495614_0275477_448_735 95
348 3300048904 Ga0496101_1290546 Ga0496101_1290546_90_377 95
349 3300048905 Ga0496102_0337211 Ga0496102_0337211_296_583 95
350 3300048906 Ga0496103_0279531 Ga0496103_0279531_484_771 95
351 3300048907 Ga0496104_0255136 Ga0496104_0255136_1294_1581 95
352 3300048907 Ga0496104_1107408 Ga0496104_1107408_188_475 95
353 3300048911 Ga0496108_0401780 Ga0496108_0401780_614_901 95
354 3300048912 Ga0496109_1287039 Ga0496109_1287039_313_600 95
355 3300048914 Ga0496111_1208826 Ga0496111_1208826_124_411 95
356 3300048917 Ga0496114_0016801 Ga0496114_0016801_5417_5704 95
357 3300048918 Ga0496115_0327839 Ga0496115_0327839_678_965 95
358 3300049127 Ga0501306_041755 Ga0501306_041755_76_366 95
359 3300049130 Ga0501310_019548 Ga0501310_019548_73_363 95
360 3300049162 Ga0501307_037304 Ga0501307_037304_383_673 95
361 3300049534 Ga0501318_009260 Ga0501318_009260_609_899 95
362 3300049536 Ga0501320_047908 Ga0501320_047908_14_304 95
363 3300049569 Ga0501032_0388183 Ga0501032_0388183_263_550 95
364 3300049569 Ga0501032_0635794 Ga0501032_0635794_169_459 95
365 3300049570 Ga0501033_0176599 Ga0501033_0176599_96_383 95
366 3300049575 Ga0501039_0068572 Ga0501039_0068572_63_350 95
367 3300049579 Ga0501043_0426685 Ga0501043_0426685_84_371 95
368 3300049582 Ga0501048_0029778 Ga0501048_0029778_3571_3858 95
369 3300049585 Ga0501069_0941489 Ga0501069_0941489_87_374 95
370 3300049587 Ga0501071_0039375 Ga0501071_0039375_963_1250 95
371 3300049588 Ga0501072_0047842 Ga0501072_0047842_447_734 95
372 3300049589 Ga0501073_0297204 Ga0501073_0297204_82_369 95
373 3300049591 Ga0501075_0136382 Ga0501075_0136382_21_308 95
374 3300049592 Ga0501076_0003905 Ga0501076_0003905_8831_9118 95
375 3300049743 Ga0501081_0020597 Ga0501081_0020597_2279_2566 95
376 3300050492 nmdc:mga0yw44_299857_c1 nmdc:mga0yw44_299857_c1_164_454 95
377 3300050492 nmdc:mga0yw44_77900_c1 nmdc:mga0yw44_77900_c1_1409_1702 95
378 3300050496 nmdc:mga07m45_715152_c1 nmdc:mga07m45_715152_c1_83_376 95
379 3300053084 Ga0495595_0469064 Ga0495595_0469064_293_580 95
380 3300053085 Ga0495619_0138558 Ga0495619_0138558_339_626 95
381 3300053085 Ga0495619_0232043 Ga0495619_0232043_347_634 95
382 3300060353 Ga0501082_0082024 Ga0501082_0082024_1941_2228 95
383 3300061734 Ga0530510_0063999 Ga0530510_0063999_553_840 95
384 3300005344 Ga0070661_100889375 Ga0070661_1008893752 96
385 3300005434 Ga0070709_10124124 Ga0070709_101241242 96
386 3300005437 Ga0070710_10073724 Ga0070710_100737244 96
387 3300005439 Ga0070711_100020873 Ga0070711_1000208738 96
388 3300005457 Ga0070662_100759619 Ga0070662_1007596191 96
389 3300005468 Ga0070707_100017376 Ga0070707_10001737612 96
390 3300005471 Ga0070698_100006774 Ga0070698_10000677414 96
391 3300005518 Ga0070699_101433024 Ga0070699_1014330241 96
392 3300005615 Ga0070702_100229424 Ga0070702_1002294243 96
393 3300005719 Ga0068861_101387784 Ga0068861_1013877842 96
394 3300006028 Ga0070717_10207041 Ga0070717_102070413 96
395 3300006038 Ga0075365_10858253 Ga0075365_108582532 96
396 3300006048 Ga0075363_100019633 Ga0075363_1000196337 96
397 3300006051 Ga0075364_10828663 Ga0075364_108286632 96
398 3300006163 Ga0070715_10006159 Ga0070715_100061596 96
399 3300006173 Ga0070716_100037140 Ga0070716_1000371406 96
400 3300006175 Ga0070712_100035731 Ga0070712_1000357314 96
401 3300006353 Ga0075370_10285066 Ga0075370_102850663 96
402 3300006881 Ga0068865_101262236 Ga0068865_1012622362 96
403 3300009148 Ga0105243_10360349 Ga0105243_103603493 96
404 3300009176 Ga0105242_10074568 Ga0105242_100745685 96
405 3300009553 Ga0105249_10189951 Ga0105249_101899513 96
406 3300011119 Ga0105246_10167003 Ga0105246_101670034 96
407 3300013102 Ga0157371_10738373 Ga0157371_107383732 96
408 3300013297 Ga0157378_10010737 Ga0157378_100107374 96
409 3300013306 Ga0163162_10293331 Ga0163162_102933313 96
410 3300013308 Ga0157375_10008009 Ga0157375_1000800912 96
411 3300014326 Ga0157380_10108855 Ga0157380_101088554 96
412 3300020075 Ga0206349_1141404 Ga0206349_11414041 96
413 3300020080 Ga0206350_10745375 Ga0206350_107453753 96
414 3300021388 Ga0213875_10088929 Ga0213875_100889294 96
415 3300024123 Ga0228600_1006526 Ga0228600_10065262 96
416 3300025898 Ga0207692_10005017 Ga0207692_1000501710 96
417 3300025905 Ga0207685_10077352 Ga0207685_100773522 96
418 3300025906 Ga0207699_10012149 Ga0207699_100121497 96
419 3300025910 Ga0207684_10697678 Ga0207684_106976783 96
420 3300025915 Ga0207693_10073798 Ga0207693_100737986 96
421 3300025916 Ga0207663_10196153 Ga0207663_101961531 96
422 3300025922 Ga0207646_10080136 Ga0207646_100801367 96
423 3300025929 Ga0207664_10038812 Ga0207664_100388123 96
424 3300025938 Ga0207704_10878510 Ga0207704_108785102 96
425 3300025939 Ga0207665_10014926 Ga0207665_100149264 96
426 3300026118 Ga0207675_100145970 Ga0207675_1001459703 96
427 3300028381 Ga0268264_10000792 Ga0268264_1000079228 96
428 3300030763 Ga0265763_1001461 Ga0265763_10014614 96
429 3300030863 Ga0265766_1005347 Ga0265766_10053472 96
430 3300030888 Ga0265769_106022 Ga0265769_1060222 96
431 3300030963 Ga0265768_102109 Ga0265768_1021093 96
432 3300031018 Ga0265773_1011144 Ga0265773_10111443 96
433 3300031691 Ga0316579_10005517 Ga0316579_100055179 96
434 3300031691 Ga0316579_10228583 Ga0316579_102285831 96
435 3300031727 Ga0316576_10164950 Ga0316576_101649503 96
436 3300031728 Ga0316578_10017124 Ga0316578_100171249 96
437 3300031728 Ga0316578_10039413 Ga0316578_100394134 96
438 3300031731 Ga0307405_10408320 Ga0307405_104083202 96
439 3300032004 Ga0307414_11037266 Ga0307414_110372662 96
440 3300032005 Ga0307411_10860531 Ga0307411_108605312 96
441 3300032133 Ga0316583_10012326 Ga0316583_100123267 96
442 3300032137 Ga0316585_10043899 Ga0316585_100438993 96
443 3300032168 Ga0316593_10006052 Ga0316593_100060525 96
444 3300032168 Ga0316593_10071625 Ga0316593_100716252 96
445 3300033524 Ga0316592_1004568 Ga0316592_10045684 96
446 3300033524 Ga0316592_1022884 Ga0316592_10228843 96
447 3300033527 Ga0316586_1062448 Ga0316586_10624482 96
448 3300035086 Ga0373934_0001665 Ga0373934_0001665_1446_1745 96
449 3300035111 Ga0373923_0007458 Ga0373923_0007458_2156_2455 96
450 3300035113 Ga0373936_0070564 Ga0373936_0070564_349_648 96
451 3300035116 Ga0373945_0066209 Ga0373945_0066209_291_590 96
452 3300035117 Ga0373953_0004941 Ga0373953_0004941_308_607 96
453 3300035118 Ga0373954_0006014 Ga0373954_0006014_1662_1961 96
454 3300035119 Ga0373956_0008114 Ga0373956_0008114_481_780 96
455 3300035120 Ga0373957_0001036 Ga0373957_0001036_3222_3521 96
456 3300035171 Ga0373946_0310502 Ga0373946_0310502_91_390 96
457 3300035398 Ga0316574_0022365 Ga0316574_0022365_991_1293 96
458 3300035398 Ga0316574_0023256 Ga0316574_0023256_3389_3682 96
459 3300035410 Ga0373924_0044587 Ga0373924_0044587_696_995 96
460 3300035692 Ga0373935_0071970 Ga0373935_0071970_644_943 96
461 3300035724 Ga0373933_0002959 Ga0373933_0002959_6391_6690 96
462 3300036401 Ga0373937_0068251 Ga0373937_0068251_2865_3164 96
463 3300036647 Ga0316582_0031807 Ga0316582_0031807_26_319 96
464 3300036647 Ga0316582_0117570 Ga0316582_0117570_444_746 96
465 3300036712 Ga0316584_0005394 Ga0316584_0005394_8027_8320 96
466 3300037068 Ga0373925_0092377 Ga0373925_0092377_296_595 96
467 3300037418 Ga0395900_0068181 Ga0395900_0068181_1932_2231 96
468 3300037418 Ga0395900_0205946 Ga0395900_0205946_1633_1938 96
469 3300037466 Ga0395898_0613993 Ga0395898_0613993_495_800 96
470 3300037853 Ga0436364_0124034 Ga0436364_0124034_108_407 96
471 3300038443 Ga0395901_0018326 Ga0395901_0018326_5598_5888 96
472 3300038443 Ga0395901_0370453 Ga0395901_0370453_120_425 96
473 3300038443 Ga0395901_0482913 Ga0395901_0482913_313_612 96
474 3300039453 Ga0436362_0361172 Ga0436362_0361172_501_800 96
475 3300041486 Ga0451807_2386134 Ga0451807_2386134_61_357 96
476 3300044683 Ga0466965_0380417 Ga0466965_0380417_311_601 96
477 3300046454 Ga0495592_0036318 Ga0495592_0036318_1392_1691 96
478 3300046459 Ga0495629_1151731 Ga0495629_1151731_107_406 96
479 3300046462 Ga0495651_0058206 Ga0495651_0058206_54_353 96
480 3300046463 Ga0495653_0009908 Ga0495653_0009908_2623_2922 96
481 3300046476 Ga0495662_0008003 Ga0495662_0008003_1229_1528 96
482 3300046477 Ga0495664_0010379 Ga0495664_0010379_881_1180 96
483 3300046511 Ga0495608_0009099 Ga0495608_0009099_3055_3354 96
484 3300046514 Ga0495618_0019818 Ga0495618_0019818_3478_3777 96
485 3300046516 Ga0495628_0018735 Ga0495628_0018735_3222_3521 96
486 3300046529 Ga0495652_0028241 Ga0495652_0028241_4319_4618 96
487 3300046533 Ga0495640_0013782 Ga0495640_0013782_2951_3250 96
488 3300046535 Ga0495586_0007029 Ga0495586_0007029_3828_4127 96
489 3300046536 Ga0495587_0252404 Ga0495587_0252404_639_938 96
490 3300046543 Ga0495645_0015924 Ga0495645_0015924_2933_3232 96
491 3300046559 Ga0495667_0032466 Ga0495667_0032466_356_655 96
492 3300046642 Ga0495634_0018243 Ga0495634_0018243_2583_2882 96
493 3300046663 Ga0495635_0008577 Ga0495635_0008577_1557_1856 96
494 3300046675 Ga0495657_0007738 Ga0495657_0007738_6586_6885 96
495 3300046678 Ga0495599_0006925 Ga0495599_0006925_1988_2287 96
496 3300046679 Ga0495623_0093050 Ga0495623_0093050_376_675 96
497 3300046680 Ga0495646_0011402 Ga0495646_0011402_5292_5591 96
498 3300046809 Ga0495600_0005775 Ga0495600_0005775_6357_6656 96
499 3300047317 Ga0495604_0087106 Ga0495604_0087106_651_950 96
500 3300047319 Ga0495674_0032123 Ga0495674_0032123_4006_4305 96
501 3300047321 Ga0495676_0143826 Ga0495676_0143826_173_472 96
502 3300047322 Ga0495680_0027683 Ga0495680_0027683_3828_4127 96
503 3300047471 Ga0495684_0004161 Ga0495684_0004161_6807_7106 96
504 3300048088 Ga0495602_0013833 Ga0495602_0013833_3525_3824 96
505 3300048907 Ga0496104_1338060 Ga0496104_1338060_226_525 96
506 3300048909 Ga0496106_0798608 Ga0496106_0798608_300_596 96
507 3300048911 Ga0496108_0671955 Ga0496108_0671955_436_732 96
508 3300048915 Ga0496112_0430170 Ga0496112_0430170_678_980 96
509 3300048916 Ga0496113_0070533 Ga0496113_0070533_648_950 96
510 3300049127 Ga0501306_005147 Ga0501306_005147_989_1279 96
511 3300049130 Ga0501310_025008 Ga0501310_025008_340_630 96
512 3300049533 Ga0501317_007376 Ga0501317_007376_867_1160 96
513 3300049537 Ga0501321_033787 Ga0501321_033787_189_479 96
514 3300049538 Ga0501322_006423 Ga0501322_006423_370_660 96
515 3300049541 Ga0501325_001001 Ga0501325_001001_768_1058 96
516 3300049575 Ga0501039_0113661 Ga0501039_0113661_1192_1488 96
517 3300049576 Ga0501040_0206605 Ga0501040_0206605_603_899 96
518 3300049577 Ga0501041_0296712 Ga0501041_0296712_339_635 96
519 3300049588 Ga0501072_1565234 Ga0501072_1565234_104_400 96
520 3300049591 Ga0501075_0198760 Ga0501075_0198760_307_603 96
521 3300049592 Ga0501076_0413544 Ga0501076_0413544_25_321 96
522 3300049593 Ga0501077_0264462 Ga0501077_0264462_652_948 96
523 3300049741 Ga0501079_0328170 Ga0501079_0328170_682_978 96
524 3300049743 Ga0501081_0509230 Ga0501081_0509230_115_411 96
525 3300049822 Ga0501035_1076064 Ga0501035_1076064_147_443 96
526 3300049824 Ga0501045_0215113 Ga0501045_0215113_217_513 96
527 3300050490 nmdc:mga03n38_349267_c1 nmdc:mga03n38_349267_c1_490_792 96
528 3300050491 nmdc:mga00v17_3224_c1 nmdc:mga00v17_3224_c1_1639_1941 96
529 3300050491 nmdc:mga00v17_404833_c1 nmdc:mga00v17_404833_c1_176_472 96
530 3300050491 nmdc:mga00v17_701231_c1 nmdc:mga00v17_701231_c1_179_478 96
531 3300050492 nmdc:mga0yw44_173021_c1 nmdc:mga0yw44_173021_c1_891_1193 96
532 3300050492 nmdc:mga0yw44_544996_c1 nmdc:mga0yw44_544996_c1_170_469 96
533 3300050492 nmdc:mga0yw44_803735_c1 nmdc:mga0yw44_803735_c1_243_545 96
534 3300050495 nmdc:mga04h51_4651_c1 nmdc:mga04h51_4651_c1_85_387 96
535 3300053078 Ga0495612_0090722 Ga0495612_0090722_684_983 96
536 3300053084 Ga0495595_0072157 Ga0495595_0072157_226_525 96
537 3300053096 Ga0500641_0016659 Ga0500641_0016659_288_590 96
538 3300053102 Ga0500554_010844 Ga0500554_010844_1315_1617 96
539 3300059490 Ga0587066_067399 Ga0587066_067399_422_724 96
540 3300059491 Ga0587070_036856 Ga0587070_036856_548_850 96
541 3300059492 Ga0587073_0040403 Ga0587073_0040403_449_751 96
542 3300059493 Ga0587077_012193 Ga0587077_012193_898_1197 96
543 3300059493 Ga0587077_027098 Ga0587077_027098_412_714 96
544 3300059503 Ga0587080_056879 Ga0587080_056879_361_663 96
545 3300059505 Ga0587083_0038089 Ga0587083_0038089_657_959 96
546 3300059505 Ga0587083_0116209 Ga0587083_0116209_35_334 96
547 3300059510 Ga0587090_014925 Ga0587090_014925_441_743 96
548 3300059513 Ga0587094_044014 Ga0587094_044014_80_382 96
549 3300059604 Ga0587098_063711 Ga0587098_063711_213_503 96
550 3300059605 Ga0587106_005262 Ga0587106_005262_655_957 96
551 3300059623 Ga0587101_018095 Ga0587101_018095_252_554 96
552 3300059641 Ga0587068_025290 Ga0587068_025290_176_478 96
553 3300059643 Ga0587072_025288 Ga0587072_025288_464_766 96
554 3300059645 Ga0587076_007466 Ga0587076_007466_848_1150 96
555 3300059647 Ga0587079_044922 Ga0587079_044922_517_819 96
556 3300059651 Ga0587105_028639 Ga0587105_028639_109_411 96
557 3300059652 Ga0587107_031393 Ga0587107_031393_200_502 96
558 3300059660 Ga0587124_027662 Ga0587124_027662_47_349 96
559 3300060344 Ga0587071_059618 Ga0587071_059618_422_721 96
560 3300060353 Ga0501082_0085561 Ga0501082_0085561_2369_2665 96
561 3300014325 Ga0163163_10024937 Ga0163163_100249371 97
562 3300014326 Ga0157380_10391403 Ga0157380_103914034 97
563 3300014969 Ga0157376_11728478 Ga0157376_117284782 97
564 3300031548 Ga0307408_100025858 Ga0307408_1000258587 97
565 3300031824 Ga0307413_10152007 Ga0307413_101520073 97
566 3300031852 Ga0307410_10008640 Ga0307410_100086404 97
567 3300031901 Ga0307406_11075700 Ga0307406_110757003 97
568 3300031903 Ga0307407_10091249 Ga0307407_100912492 97
569 3300031911 Ga0307412_11195920 Ga0307412_111959202 97
570 3300031995 Ga0307409_100001225 Ga0307409_10000122514 97
571 3300032002 Ga0307416_100003637 Ga0307416_10000363715 97
572 3300032005 Ga0307411_11813352 Ga0307411_118133522 97
573 3300032126 Ga0307415_100317652 Ga0307415_1003176522 97
574 3300032168 Ga0316593_10002456 Ga0316593_100024569 97
575 3300032168 Ga0316593_10292263 Ga0316593_102922631 97
576 3300033524 Ga0316592_1006305 Ga0316592_10063055 97
577 3300033527 Ga0316586_1007512 Ga0316586_10075124 97
578 3300033541 Ga0316596_1000140 Ga0316596_100014011 97
579 3300033541 Ga0316596_1007697 Ga0316596_10076976 97
580 3300035121 Ga0373960_0064490 Ga0373960_0064490_611_904 97
581 3300035242 Ga0373962_0223850 Ga0373962_0223850_250_543 97
582 3300035398 Ga0316574_0034195 Ga0316574_0034195_1952_2257 97
583 3300036712 Ga0316584_0009403 Ga0316584_0009403_4496_4801 97
584 3300036712 Ga0316584_0099111 Ga0316584_0099111_925_1230 97
585 3300037312 Ga0395899_0886126 Ga0395899_0886126_85_378 97
586 3300037418 Ga0395900_0278590 Ga0395900_0278590_962_1255 97
587 3300037466 Ga0395898_0039180 Ga0395898_0039180_707_1000 97
588 3300038443 Ga0395901_0154973 Ga0395901_0154973_1599_1892 97
589 3300041411 Ga0439466_0219435 Ga0439466_0219435_136_435 97
590 3300041459 Ga0451800_0225272 Ga0451800_0225272_284_586 97
591 3300041503 Ga0451847_0859504 Ga0451847_0859504_151_453 97
592 3300041509 Ga0451843_1048037 Ga0451843_1048037_260_553 97
593 3300041512 Ga0451853_2531387 Ga0451853_2531387_114_419 97
594 3300041999 Ga0439433_0119062 Ga0439433_0119062_202_501 97
595 3300042002 Ga0439442_085984 Ga0439442_085984_177_476 97
596 3300042007 Ga0439449_0227513 Ga0439449_0227513_373_672 97
597 3300042013 Ga0439456_157332 Ga0439456_157332_13_312 97
598 3300042014 Ga0439457_017658 Ga0439457_017658_1151_1450 97
599 3300042125 Ga0450923_030640 Ga0450923_030640_511_810 97
600 3300042145 Ga0450906_019906 Ga0450906_019906_228_527 97
601 3300045976 Ga0466967_0166934 Ga0466967_0166934_240_551 97
602 3300049572 Ga0501036_0177346 Ga0501036_0177346_136_429 97
603 3300049575 Ga0501039_1119976 Ga0501039_1119976_231_524 97
604 3300049579 Ga0501043_0529730 Ga0501043_0529730_66_359 97
605 3300049580 Ga0501046_0146996 Ga0501046_0146996_829_1122 97
606 3300049591 Ga0501075_0844784 Ga0501075_0844784_307_600 97
607 3300049742 Ga0501080_1132297 Ga0501080_1132297_90_383 97
608 3300049823 Ga0501044_1268146 Ga0501044_1268146_92_385 97
609 3300049824 Ga0501045_0638090 Ga0501045_0638090_202_495 97
610 3300053096 Ga0500641_0091319 Ga0500641_0091319_309_635 97
611 3300053160 Ga0500633_0070375 Ga0500633_0070375_462_788 97
612 3300054114 Ga0501084_0305167 Ga0501084_0305167_1021_1314 97
613 3300059490 Ga0587066_096158 Ga0587066_096158_44_337 97
614 3300059492 Ga0587073_0079602 Ga0587073_0079602_352_645 97
615 3300059493 Ga0587077_243425 Ga0587077_243425_38_331 97
616 3300059623 Ga0587101_033249 Ga0587101_033249_84_377 97
617 3300059625 Ga0587113_031239 Ga0587113_031239_276_569 97
618 3300059645 Ga0587076_022215 Ga0587076_022215_656_949 97
619 3300025912 Ga0207707_11430485 Ga0207707_114304851 98
620 3300041507 Ga0451851_0191684 Ga0451851_0191684_227_535 98
621 3300046615 Ga0495656_0429651 Ga0495656_0429651_174_473 98
622 3300049540 Ga0501324_023152 Ga0501324_023152_14_319 98
623 3300049586 Ga0501070_0013575 Ga0501070_0013575_5964_6266 98
624 3300049741 Ga0501079_1672699 Ga0501079_1672699_39_341 98
625 3300001915 JGI24741J21665_1022013 JGI24741J21665_10220133 99
626 3300002067 JGI24735J21928_10032301 JGI24735J21928_100323013 99
627 3300004799 Ga0058863_10060076 Ga0058863_100600764 99
628 3300004803 Ga0058862_10086705 Ga0058862_100867052 99
629 3300005329 Ga0070683_100451471 Ga0070683_1004514713 99
630 3300005336 Ga0070680_100758217 Ga0070680_1007582172 99
631 3300005337 Ga0070682_100065239 Ga0070682_1000652395 99
632 3300005337 Ga0070682_100846756 Ga0070682_1008467562 99
633 3300005366 Ga0070659_101219955 Ga0070659_1012199552 99
634 3300005458 Ga0070681_11656726 Ga0070681_116567261 99
635 3300005530 Ga0070679_100651974 Ga0070679_1006519743 99
636 3300005577 Ga0068857_100227036 Ga0068857_1002270364 99
637 3300009545 Ga0105237_11345211 Ga0105237_113452113 99
638 3300020069 Ga0197907_10647083 Ga0197907_106470834 99
639 3300020069 Ga0197907_11170858 Ga0197907_111708581 99
640 3300020070 Ga0206356_11565064 Ga0206356_115650643 99
641 3300020075 Ga0206349_1354096 Ga0206349_13540962 99
642 3300020075 Ga0206349_1934290 Ga0206349_19342901 99
643 3300020076 Ga0206355_1090915 Ga0206355_10909153 99
644 3300020076 Ga0206355_1407428 Ga0206355_14074281 99
645 3300020081 Ga0206354_11411084 Ga0206354_114110842 99
646 3300020082 Ga0206353_10414422 Ga0206353_104144223 99
647 3300022467 Ga0224712_10419276 Ga0224712_104192761 99
648 3300025912 Ga0207707_10503279 Ga0207707_105032793 99
649 3300025919 Ga0207657_10059474 Ga0207657_100594745 99
650 3300025920 Ga0207649_11010700 Ga0207649_110107002 99
651 3300025921 Ga0207652_10239587 Ga0207652_102395871 99
652 3300026116 Ga0207674_10026320 Ga0207674_100263204 99
653 3300038443 Ga0395901_0601842 Ga0395901_0601842_346_651 99
654 3300046461 Ga0495641_0090096 Ga0495641_0090096_861_1160 99
655 3300046461 Ga0495641_0179949 Ga0495641_0179949_546_845 99
656 3300046476 Ga0495662_0581790 Ga0495662_0581790_92_391 99
657 3300046511 Ga0495608_0180175 Ga0495608_0180175_34_333 99
658 3300046663 Ga0495635_0452902 Ga0495635_0452902_533_832 99
659 3300046809 Ga0495600_0366695 Ga0495600_0366695_439_738 99
660 3300047315 Ga0495581_0764312 Ga0495581_0764312_21_320 99
661 3300047673 Ga0495593_0254314 Ga0495593_0254314_501_800 99
662 3300048089 Ga0495614_0297387 Ga0495614_0297387_249_548 99
663 3300048904 Ga0496101_1035508 Ga0496101_1035508_167_466 99
664 3300048905 Ga0496102_0030623 Ga0496102_0030623_658_957 99
665 3300048905 Ga0496102_0407622 Ga0496102_0407622_309_608 99
666 3300048910 Ga0496107_0962012 Ga0496107_0962012_165_464 99
667 3300048917 Ga0496114_0379960 Ga0496114_0379960_819_1118 99
668 3300048918 Ga0496115_0262751 Ga0496115_0262751_154_453 99
669 3300053085 Ga0495619_0063850 Ga0495619_0063850_1591_1890 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00366

Ribosomal_S17

Ribosomal protein S17

35

102

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v4b-assembly1.cif.gz_AQ structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for rna and protein components into a 11.7 a cryo-em map. 0.8925 22 95
7ane-assembly1.cif.gz_k leishmania major mitochondrial ribosome 0.8833 23 96
8d8k-assembly1.cif.gz_Q yeast mitochondrial small subunit assembly intermediate (state 2) 0.8821 21 96
5mrc-assembly1.cif.gz_QQ structure of the yeast mitochondrial ribosome - class a 0.882 21 98
7pkq-assembly1.cif.gz_q small subunit of the chlamydomonas reinhardtii mitoribosome 0.8772 24 99
ID Description Score Start End Superfamily
af_Q8ID56_26_114_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9096 23 99 2.40.50.140
af_C6T0V9_1_79_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8753 22 99 2.40.50.140
af_Q4E4R7_93_168_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8654 24 98 2.40.50.140
af_Q03246_1_107_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8636 19 95 2.40.50.140
af_Q9LHN1_1_100_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8582 22 99 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7W0K6H0-F1-model_v4 Small ribosomal subunit protein uS17 0.8972 19 99 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A3D5CDP2-F1-model_v4 30S ribosomal protein S17 0.8947 18 99 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A496RHA2-F1-model_v4 Small ribosomal subunit protein uS17 0.8911 18 99 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A1Q3T7P4-F1-model_v4 Small ribosomal subunit protein uS17 0.8881 18 99 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A7J9VS08-F1-model_v4 Small ribosomal subunit protein uS17 0.8873 17 99 GO:0003735
GO:0006412
GO:0019843
GO:0022627

Feature Viewer

pLDDT pTM Quality
81.33 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map