F473982

General Info

Members Datasets Scaffolds Average Seq Length
669 245 1338 97

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100973943|Ga0070695_1009739432
Length 95
Sequence MATYITLMRWTGQGIAKVKDSPKRLDAGRKAFKKMGVEIKDTWLTMGEYDLVCVIEGPDDAVAKALLSLGSQGNVQTETMRAWNEDEYRKITKSV

Samples

Sample ID Description Type Environment
1 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
185 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
186 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
187 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
188 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
189 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
204 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
205 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
208 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
209 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
210 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
211 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
212 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
213 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
214 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
215 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
216 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
217 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
218 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
219 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
220 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
221 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
222 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
223 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
226 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
229 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
230 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
231 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
232 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
233 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
234 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 1.2
Rhizosphere 97.91
Stem 0
Stem Tuber 0
Unclassified 39.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070695_100973943 3300005545 Bacteria 689
2 MRS1b_contig_6095528 2162886011 Unclassified 1303
3 LJNas_1021038 3300000546 Unclassified 696
4 Ga0065704_10048221 3300005289 Unclassified 896
5 Ga0065704_10251950 3300005289 Unclassified 955
6 Ga0065704_10417359 3300005289 Bacteria 735
7 Ga0065712_10067947 3300005290 Bacteria 19700
8 Ga0065712_10159477 3300005290 Unclassified 1312
9 Ga0065712_10529358 3300005290 Bacteria 630
10 Ga0065715_10006097 3300005293 Bacteria 3352
11 Ga0065715_10013876 3300005293 Bacteria 2591
12 Ga0065715_10092943 3300005293 Bacteria 4854
13 Ga0065715_10214194 3300005293 Bacteria 1300
14 Ga0065715_10227354 3300005293 Unclassified 1247
15 Ga0065715_10697396 3300005293 Bacteria 655
16 Ga0065707_10032016 3300005295 Bacteria 1178
17 Ga0065707_10138965 3300005295 Bacteria 1799
18 Ga0065707_10157569 3300005295 Bacteria 1591
19 Ga0070676_10027144 3300005328 Bacteria 3245
20 Ga0070676_10581371 3300005328 Unclassified 805
21 Ga0070690_100032754 3300005330 Unclassified 3248
22 Ga0070690_100363806 3300005330 Bacteria 1053
23 Ga0070670_101256457 3300005331 Unclassified 677
24 Ga0068869_100020643 3300005334 Bacteria 4520
25 Ga0068869_100271910 3300005334 Bacteria 1360
26 Ga0068869_100869402 3300005334 Unclassified 779
27 Ga0068869_100967272 3300005334 Unclassified 740
28 Ga0070666_10107465 3300005335 Bacteria 1928
29 Ga0070666_10158188 3300005335 Bacteria 1583
30 Ga0070680_100005389 3300005336 Bacteria 9683
31 Ga0070680_100890784 3300005336 Bacteria 768
32 Ga0070682_100031271 3300005337 Unclassified 3218
33 Ga0070682_101412783 3300005337 Unclassified 595
34 Ga0068868_100036214 3300005338 Bacteria 3818
35 Ga0068868_100090157 3300005338 Unclassified 2469
36 Ga0068868_100482328 3300005338 Bacteria 1083
37 Ga0070689_100293569 3300005340 Bacteria 1351
38 Ga0070689_102156624 3300005340 Unclassified 510
39 Ga0070687_100031951 3300005343 Bacteria 2586
40 Ga0070687_100195607 3300005343 Bacteria 1222
41 Ga0070687_100226456 3300005343 Unclassified 1148
42 Ga0070687_100630090 3300005343 Unclassified 740
43 Ga0070692_10026437 3300005345 Bacteria 2869
44 Ga0070692_10037035 3300005345 Bacteria 2478
45 Ga0070692_10052731 3300005345 Unclassified 2119
46 Ga0070692_10097148 3300005345 Bacteria 1610
47 Ga0070692_10184891 3300005345 Bacteria 1210
48 Ga0070692_10259316 3300005345 Bacteria 1044
49 Ga0070692_10481523 3300005345 Unclassified 800
50 Ga0070692_10654462 3300005345 Unclassified 702
51 Ga0070692_11333761 3300005345 Unclassified 516
52 Ga0070668_100001301 3300005347 Bacteria 17841
53 Ga0070669_100004174 3300005353 Bacteria 10465
54 Ga0070669_100090124 3300005353 Unclassified 2298
55 Ga0070669_100499039 3300005353 Unclassified 1009
56 Ga0070669_101164882 3300005353 Unclassified 665
57 Ga0070669_101623142 3300005353 Bacteria 563
58 Ga0070669_101862409 3300005353 Bacteria 525
59 Ga0070675_100036971 3300005354 Bacteria 3975
60 Ga0070671_100078129 3300005355 Bacteria 2766
61 Ga0070671_100303817 3300005355 Bacteria 1359
62 Ga0070674_100100519 3300005356 Bacteria 2106
63 Ga0070673_100080509 3300005364 Bacteria 2639
64 Ga0070673_100219957 3300005364 Unclassified 1643
65 Ga0070688_101608331 3300005365 Unclassified 531
66 Ga0070667_100163513 3300005367 Unclassified 1962
67 Ga0070667_101096185 3300005367 Bacteria 744
68 Ga0070703_10029008 3300005406 Unclassified 1657
69 Ga0070709_10890742 3300005434 Unclassified 703
70 Ga0070710_10568285 3300005437 Unclassified 785
71 Ga0070701_10054571 3300005438 Bacteria 2084
72 Ga0070701_10218314 3300005438 Unclassified 1136
73 Ga0070701_10304546 3300005438 Unclassified 981
74 Ga0070701_10361770 3300005438 Unclassified 909
75 Ga0070701_11121699 3300005438 Unclassified 554
76 Ga0070705_100007164 3300005440 Bacteria 5488
77 Ga0070705_100014893 3300005440 Unclassified 4010
78 Ga0070705_100209768 3300005440 Bacteria 1342
79 Ga0070705_100329493 3300005440 Unclassified 1105
80 Ga0070705_100363848 3300005440 Bacteria 1059
81 Ga0070705_100985201 3300005440 Unclassified 683
82 Ga0070700_100124804 3300005441 Bacteria 1730
83 Ga0070700_100816696 3300005441 Bacteria 752
84 Ga0070700_101816988 3300005441 Unclassified 525
85 Ga0070694_100025250 3300005444 Bacteria 3843
86 Ga0070694_100038300 3300005444 Bacteria 3186
87 Ga0070694_100060926 3300005444 Bacteria 2575
88 Ga0070694_100146045 3300005444 Unclassified 1723
89 Ga0070694_100385453 3300005444 Unclassified 1094
90 Ga0070694_100516034 3300005444 Unclassified 953
91 Ga0070694_100682228 3300005444 Bacteria 834
92 Ga0070694_100914384 3300005444 Unclassified 725
93 Ga0070694_101864763 3300005444 Unclassified 513
94 Ga0070708_100266165 3300005445 Bacteria 1612
95 Ga0070708_100473195 3300005445 Bacteria 1182
96 Ga0070708_100886988 3300005445 Unclassified 838
97 Ga0070708_101009571 3300005445 Unclassified 780
98 Ga0070708_102150926 3300005445 Unclassified 516
99 Ga0070678_100099244 3300005456 Bacteria 2253
100 Ga0070678_101031640 3300005456 Bacteria 757
101 Ga0070662_100332343 3300005457 Bacteria 1242
102 Ga0070662_100491196 3300005457 Bacteria 1023
103 Ga0070662_100609543 3300005457 Unclassified 919
104 Ga0070662_101600632 3300005457 Unclassified 562
105 Ga0070662_101833181 3300005457 Unclassified 524
106 Ga0070681_10000108 3300005458 Bacteria 61616
107 Ga0070681_10139707 3300005458 Bacteria 2352
108 Ga0070681_10553509 3300005458 Unclassified 1064
109 Ga0070681_11836403 3300005458 Unclassified 533
110 Ga0068867_100007343 3300005459 Bacteria 7796
111 Ga0068867_100041375 3300005459 Bacteria 3368
112 Ga0068867_100532795 3300005459 Bacteria 1014
113 Ga0068867_100546394 3300005459 Bacteria 1003
114 Ga0068867_101318019 3300005459 Bacteria 667
115 Ga0068867_101881403 3300005459 Unclassified 564
116 Ga0070685_10265319 3300005466 Bacteria 1144
117 Ga0070685_10422865 3300005466 Unclassified 927
118 Ga0070706_100000216 3300005467 Bacteria 71047
119 Ga0070706_100004103 3300005467 Bacteria 14169
120 Ga0070706_100032535 3300005467 Bacteria 4810
121 Ga0070706_100330665 3300005467 Unclassified 1421
122 Ga0070706_101807576 3300005467 Unclassified 555
123 Ga0070706_101822791 3300005467 Unclassified 553
124 Ga0070707_100382763 3300005468 Unclassified 1367
125 Ga0070707_100476995 3300005468 Unclassified 1209
126 Ga0070707_100533228 3300005468 Bacteria 1136
127 Ga0070698_100044816 3300005471 Bacteria 4527
128 Ga0070698_100310915 3300005471 Unclassified 1506
129 Ga0070698_100449839 3300005471 Bacteria 1224
130 Ga0070698_100856995 3300005471 Bacteria 854
131 Ga0070698_101168345 3300005471 Unclassified 719
132 Ga0070698_101325488 3300005471 Unclassified 670
133 Ga0070699_100093478 3300005518 Bacteria 2631
134 Ga0070699_100112459 3300005518 Unclassified 2392
135 Ga0070699_100392765 3300005518 Unclassified 1253
136 Ga0070699_101845648 3300005518 Unclassified 553
137 Ga0070679_100000130 3300005530 Bacteria 60396
138 Ga0070684_100430672 3300005535 Bacteria 1218
139 Ga0070684_101488701 3300005535 Bacteria 638
140 Ga0070697_100000086 3300005536 Bacteria 76908
141 Ga0070697_100000118 3300005536 Bacteria 62151
142 Ga0070697_100481416 3300005536 Unclassified 1084
143 Ga0070697_100767185 3300005536 Bacteria 852
144 Ga0070697_100822616 3300005536 Bacteria 822
145 Ga0070697_101309921 3300005536 Unclassified 646
146 Ga0068853_101437103 3300005539 Unclassified 667
147 Ga0068853_101940570 3300005539 Bacteria 571
148 Ga0070672_100049693 3300005543 Bacteria 3264
149 Ga0070672_100719740 3300005543 Unclassified 875
150 Ga0070686_100001031 3300005544 Bacteria 16025
151 Ga0070686_100008719 3300005544 Bacteria 5683
152 Ga0070686_100075772 3300005544 Bacteria 2214
153 Ga0070686_100399020 3300005544 Bacteria 1045
154 Ga0070686_101218249 3300005544 Unclassified 626
155 Ga0070695_100071825 3300005545 Bacteria 2268
156 Ga0070695_100218619 3300005545 Bacteria 1371
157 Ga0070695_100263989 3300005545 Unclassified 1258
158 Ga0070695_100310277 3300005545 Bacteria 1169
159 Ga0070695_100521828 3300005545 Unclassified 922
160 Ga0070695_100555760 3300005545 Bacteria 895
161 Ga0070695_101379621 3300005545 Unclassified 584
162 Ga0070695_101500257 3300005545 Unclassified 561
163 Ga0070696_100146905 3300005546 Bacteria 1727
164 Ga0070696_100149154 3300005546 Bacteria 1715
165 Ga0070696_100153020 3300005546 Unclassified 1694
166 Ga0070696_100202296 3300005546 Bacteria 1483
167 Ga0070696_100235001 3300005546 Bacteria 1380
168 Ga0070696_100419198 3300005546 Unclassified 1051
169 Ga0070696_100457222 3300005546 Bacteria 1008
170 Ga0070696_100502689 3300005546 Unclassified 965
171 Ga0070696_100539611 3300005546 Unclassified 933
172 Ga0070696_101007274 3300005546 Bacteria 696
173 Ga0070696_101243264 3300005546 Bacteria 630
174 Ga0070693_100159098 3300005547 Bacteria 1437
175 Ga0070693_100179600 3300005547 Unclassified 1362
176 Ga0070693_100518836 3300005547 Unclassified 848
177 Ga0070665_102160193 3300005548 Bacteria 561
178 Ga0070704_100082820 3300005549 Bacteria 2367
179 Ga0070704_100106694 3300005549 Unclassified 2123
180 Ga0070704_100236563 3300005549 Bacteria 1493
181 Ga0070704_100279563 3300005549 Bacteria 1382
182 Ga0070704_100330755 3300005549 Unclassified 1280
183 Ga0070704_100379381 3300005549 Unclassified 1201
184 Ga0070704_100574175 3300005549 Unclassified 988
185 Ga0070704_100690554 3300005549 Bacteria 904
186 Ga0070704_100945436 3300005549 Unclassified 777
187 Ga0070664_100221950 3300005564 Bacteria 1691
188 Ga0070664_100503163 3300005564 Bacteria 1117
189 Ga0068857_100035000 3300005577 Bacteria 4445
190 Ga0068857_100627076 3300005577 Bacteria 1017
191 Ga0068857_100789456 3300005577 Bacteria 906
192 Ga0068857_101619978 3300005577 Bacteria 632
193 Ga0068854_100418480 3300005578 Unclassified 1112
194 Ga0068854_100492843 3300005578 Bacteria 1031
195 Ga0068854_100504607 3300005578 Unclassified 1019
196 Ga0068854_100793663 3300005578 Bacteria 825
197 Ga0068854_100975520 3300005578 Unclassified 749
198 Ga0068856_100237661 3300005614 Unclassified 1837
199 Ga0068856_100285590 3300005614 Bacteria 1667
200 Ga0070702_100067537 3300005615 Bacteria 2101
201 Ga0070702_100184546 3300005615 Bacteria 1368
202 Ga0070702_100414124 3300005615 Unclassified 968
203 Ga0068852_100420520 3300005616 Bacteria 1318
204 Ga0068852_100471626 3300005616 Bacteria 1246
205 Ga0068852_100640984 3300005616 Bacteria 1069
206 Ga0068859_100031382 3300005617 Bacteria 5335
207 Ga0068859_100061273 3300005617 Bacteria 3791
208 Ga0068859_100065848 3300005617 Bacteria 3657
209 Ga0068859_100090596 3300005617 Unclassified 3109
210 Ga0068859_100120058 3300005617 Bacteria 2695
211 Ga0068859_100121083 3300005617 Bacteria 2683
212 Ga0068859_100173081 3300005617 Bacteria 2241
213 Ga0068859_100943875 3300005617 Bacteria 946
214 Ga0068859_102901621 3300005617 Unclassified 525
215 Ga0068864_100001928 3300005618 Bacteria 17037
216 Ga0068864_100024571 3300005618 Bacteria 5070
217 Ga0068864_100028411 3300005618 Bacteria 4727
218 Ga0068864_100380489 3300005618 Bacteria 1337
219 Ga0068864_101561843 3300005618 Bacteria 663
220 Ga0068864_102481936 3300005618 Unclassified 524
221 Ga0068866_10421172 3300005718 Unclassified 866
222 Ga0068866_10615426 3300005718 Bacteria 735
223 Ga0068861_100002132 3300005719 Bacteria 12804
224 Ga0068861_100026721 3300005719 Bacteria 4199
225 Ga0068861_100197160 3300005719 Bacteria 1687
226 Ga0068861_100781765 3300005719 Bacteria 894
227 Ga0068851_10012886 3300005834 Unclassified 3950
228 Ga0068870_10025400 3300005840 Unclassified 2940
229 Ga0068870_11063211 3300005840 Unclassified 580
230 Ga0068863_100238677 3300005841 Unclassified 1754
231 Ga0068863_100247125 3300005841 Bacteria 1723
232 Ga0068863_100346182 3300005841 Bacteria 1447
233 Ga0068863_100572360 3300005841 Bacteria 1116
234 Ga0068863_102169592 3300005841 Unclassified 565
235 Ga0068858_100171746 3300005842 Unclassified 2044
236 Ga0068858_100737201 3300005842 Bacteria 959
237 Ga0068858_101289280 3300005842 Bacteria 719
238 Ga0068858_101636342 3300005842 Unclassified 635
239 Ga0068860_100103151 3300005843 Bacteria 2722
240 Ga0068860_100280735 3300005843 Bacteria 1627
241 Ga0068860_100608500 3300005843 Bacteria 1098
242 Ga0068860_100814245 3300005843 Unclassified 947
243 Ga0068860_100925819 3300005843 Bacteria 888
244 Ga0068862_100133975 3300005844 Bacteria 2194
245 Ga0068862_100296842 3300005844 Bacteria 1485
246 Ga0068862_100525029 3300005844 Unclassified 1127
247 Ga0068862_102666068 3300005844 Unclassified 511
248 Ga0081455_10957745 3300005937 Unclassified 531
249 Ga0075432_10549534 3300006058 Unclassified 521
250 Ga0070716_100259081 3300006173 Bacteria 1189
251 Ga0070716_100678879 3300006173 Unclassified 784
252 Ga0075367_10294670 3300006178 Bacteria 1021
253 Ga0097621_100043486 3300006237 Bacteria 3621
254 Ga0097621_100156119 3300006237 Bacteria 1958
255 Ga0097621_100716053 3300006237 Bacteria 922
256 Ga0075370_10074493 3300006353 Bacteria 1946
257 Ga0068871_100050127 3300006358 Bacteria 3377
258 Ga0068871_100116201 3300006358 Bacteria 2255
259 Ga0068871_100856015 3300006358 Bacteria 841
260 Ga0075428_100212654 3300006844 Bacteria 2090
261 Ga0075428_100655884 3300006844 Bacteria 1119
262 Ga0075428_100683461 3300006844 Unclassified 1094
263 Ga0075428_101035683 3300006844 Bacteria 868
264 Ga0075428_101505299 3300006844 Bacteria 705
265 Ga0075430_100039051 3300006846 Bacteria 4020
266 Ga0075430_101650549 3300006846 Unclassified 526
267 Ga0075431_100285559 3300006847 Bacteria 1670
268 Ga0075431_100537585 3300006847 Bacteria 1157
269 Ga0075431_101425513 3300006847 Bacteria 652
270 Ga0075433_10042458 3300006852 Bacteria 3945
271 Ga0075433_10049868 3300006852 Unclassified 3642
272 Ga0075433_10080344 3300006852 Bacteria 2874
273 Ga0075433_10093851 3300006852 Bacteria 2655
274 Ga0075433_10112190 3300006852 Bacteria 2418
275 Ga0075433_10151040 3300006852 Unclassified 2066
276 Ga0075433_10223919 3300006852 Bacteria 1671
277 Ga0075433_10370591 3300006852 Unclassified 1265
278 Ga0075433_10377360 3300006852 Unclassified 1252
279 Ga0075433_10561817 3300006852 Bacteria 1003
280 Ga0075433_10688495 3300006852 Unclassified 896
281 Ga0075433_11290899 3300006852 Bacteria 633
282 Ga0075434_100039335 3300006871 Bacteria 4686
283 Ga0075434_100092149 3300006871 Unclassified 3032
284 Ga0075434_100786982 3300006871 Unclassified 968
285 Ga0075434_101507399 3300006871 Unclassified 682
286 Ga0075429_100394816 3300006880 Bacteria 1211
287 Ga0075429_100506868 3300006880 Bacteria 1057
288 Ga0068865_100018299 3300006881 Bacteria 4519
289 Ga0068865_100185198 3300006881 Bacteria 1606
290 Ga0097620_100031382 3300006931 Bacteria 5335
291 Ga0097620_100061270 3300006931 Bacteria 3791
292 Ga0097620_100065848 3300006931 Bacteria 3657
293 Ga0097620_100090595 3300006931 Unclassified 3109
294 Ga0097620_100120047 3300006931 Bacteria 2695
295 Ga0097620_100121089 3300006931 Bacteria 2683
296 Ga0097620_100173082 3300006931 Bacteria 2241
297 Ga0097620_100943961 3300006931 Bacteria 946
298 Ga0097620_102902383 3300006931 Unclassified 525
299 Ga0075435_100073954 3300007076 Bacteria 2787
300 Ga0075435_100578337 3300007076 Unclassified 973
301 Ga0099794_10148384 3300007265 Unclassified 1190
302 Ga0105251_10097285 3300009011 Bacteria 1347
303 Ga0105251_10231362 3300009011 Unclassified 832
304 Ga0105240_10044355 3300009093 Bacteria 5651
305 Ga0111539_10078483 3300009094 Unclassified 3884
306 Ga0111539_10291615 3300009094 Bacteria 1898
307 Ga0111539_10616740 3300009094 Unclassified 1263
308 Ga0111539_10763025 3300009094 Bacteria 1126
309 Ga0111539_11639135 3300009094 Bacteria 746
310 Ga0105245_11197391 3300009098 Bacteria 807
311 Ga0105245_11332801 3300009098 Unclassified 767
312 Ga0105247_10090522 3300009101 Unclassified 1941
313 Ga0105247_11297514 3300009101 Unclassified 584
314 Ga0114129_10008450 3300009147 Bacteria 14670
315 Ga0114129_10008912 3300009147 Bacteria 14306
316 Ga0114129_10013659 3300009147 Bacteria 11570
317 Ga0114129_10021800 3300009147 Bacteria 9095
318 Ga0114129_10238444 3300009147 Bacteria 2446
319 Ga0114129_10464299 3300009147 Bacteria 1659
320 Ga0114129_10721809 3300009147 Bacteria 1279
321 Ga0114129_10875043 3300009147 Unclassified 1140
322 Ga0114129_11959575 3300009147 Unclassified 709
323 Ga0114129_11961647 3300009147 Bacteria 709
324 Ga0114129_12326639 3300009147 Unclassified 643
325 Ga0105243_10006488 3300009148 Bacteria 9047
326 Ga0105243_10845099 3300009148 Unclassified 906
327 Ga0105243_13021298 3300009148 Bacteria 510
328 Ga0105241_10065736 3300009174 Bacteria 2803
329 Ga0105241_10093244 3300009174 Bacteria 2379
330 Ga0105241_10122736 3300009174 Bacteria 2094
331 Ga0105241_10319937 3300009174 Bacteria 1337
332 Ga0105241_10348266 3300009174 Bacteria 1285
333 Ga0105241_10668006 3300009174 Unclassified 945
334 Ga0105241_11252852 3300009174 Bacteria 704
335 Ga0105241_11360157 3300009174 Bacteria 678
336 Ga0105241_11733366 3300009174 Unclassified 608
337 Ga0105241_12610935 3300009174 Unclassified 507
338 Ga0105241_12670027 3300009174 Bacteria 502
339 Ga0105242_10141890 3300009176 Bacteria 2085
340 Ga0105242_10227622 3300009176 Unclassified 1669
341 Ga0105242_10614266 3300009176 Bacteria 1052
342 Ga0105242_10990431 3300009176 Unclassified 847
343 Ga0105242_11373617 3300009176 Bacteria 733
344 Ga0105248_10013728 3300009177 Bacteria 8916
345 Ga0105248_10124156 3300009177 Bacteria 2912
346 Ga0105248_10467076 3300009177 Bacteria 1422
347 Ga0105248_11529466 3300009177 Bacteria 756
348 Ga0105237_10009403 3300009545 Bacteria 10469
349 Ga0105237_10036125 3300009545 Bacteria 4999
350 Ga0105237_10138610 3300009545 Bacteria 2427
351 Ga0105249_10000107 3300009553 Bacteria 114573
352 Ga0105249_10098441 3300009553 Bacteria 2747
353 Ga0105249_11872809 3300009553 Unclassified 672
354 Ga0105239_10269080 3300010375 Bacteria 1916
355 Ga0105239_10515442 3300010375 Bacteria 1360
356 Ga0105239_11071461 3300010375 Unclassified 927
357 Ga0105246_10149491 3300011119 Bacteria 1766
358 Ga0105246_10181191 3300011119 Bacteria 1622
359 Ga0105246_10205432 3300011119 Bacteria 1534
360 Ga0105246_10837966 3300011119 Unclassified 819
361 Ga0105246_11080007 3300011119 Bacteria 732
362 Ga0105246_11189085 3300011119 Bacteria 701
363 Ga0105246_11411166 3300011119 Unclassified 650
364 Ga0105246_12062267 3300011119 Bacteria 552
365 Ga0157325_1007819 3300012485 Bacteria 727
366 Ga0157373_10000857 3300013100 Bacteria 23644
367 Ga0157371_10607041 3300013102 Unclassified 814
368 Ga0157371_10725762 3300013102 Unclassified 745
369 Ga0157374_10943458 3300013296 Bacteria 881
370 Ga0157374_11790901 3300013296 Unclassified 639
371 Ga0157378_10017159 3300013297 Bacteria 6346
372 Ga0157378_10042359 3300013297 Bacteria 4041
373 Ga0157378_10075554 3300013297 Bacteria 3034
374 Ga0157378_10111385 3300013297 Bacteria 2510
375 Ga0157378_10214472 3300013297 Bacteria 1827
376 Ga0157378_10392245 3300013297 Bacteria 1366
377 Ga0157378_11577890 3300013297 Bacteria 702
378 Ga0157378_11817956 3300013297 Unclassified 657
379 Ga0157378_12183188 3300013297 Bacteria 605
380 Ga0163162_10000006 3300013306 Bacteria 410012
381 Ga0163162_10010167 3300013306 Bacteria 9141
382 Ga0163162_10023261 3300013306 Bacteria 6114
383 Ga0163162_10036443 3300013306 Bacteria 4903
384 Ga0163162_10083466 3300013306 Bacteria 3269
385 Ga0163162_10173021 3300013306 Bacteria 2284
386 Ga0163162_10758170 3300013306 Unclassified 1089
387 Ga0163162_11068456 3300013306 Unclassified 914
388 Ga0163162_11091694 3300013306 Bacteria 904
389 Ga0157372_10051237 3300013307 Bacteria 4594
390 Ga0157372_10200224 3300013307 Bacteria 2313
391 Ga0157372_10627483 3300013307 Bacteria 1252
392 Ga0157372_11258379 3300013307 Unclassified 854
393 Ga0157372_11854135 3300013307 Unclassified 693
394 Ga0157375_10091717 3300013308 Bacteria 3100
395 Ga0157375_10164115 3300013308 Bacteria 2365
396 Ga0157375_10420570 3300013308 Bacteria 1502
397 Ga0157375_10827384 3300013308 Bacteria 1074
398 Ga0157375_12407651 3300013308 Unclassified 628
399 Ga0157375_12642345 3300013308 Unclassified 600
400 Ga0163163_10010593 3300014325 Bacteria 8305
401 Ga0163163_10021611 3300014325 Bacteria 6076
402 Ga0163163_10022356 3300014325 Bacteria 5986
403 Ga0163163_10309494 3300014325 Bacteria 1632
404 Ga0163163_10508867 3300014325 Bacteria 1266
405 Ga0163163_10548441 3300014325 Unclassified 1219
406 Ga0163163_12347633 3300014325 Bacteria 592
407 Ga0157380_10000397 3300014326 Bacteria 26233
408 Ga0157380_10002310 3300014326 Bacteria 12805
409 Ga0157380_10003547 3300014326 Bacteria 10723
410 Ga0157380_10058612 3300014326 Bacteria 3070
411 Ga0157380_10137974 3300014326 Unclassified 2090
412 Ga0157380_10624039 3300014326 Bacteria 1071
413 Ga0157380_11482782 3300014326 Bacteria 731
414 Ga0157377_10023625 3300014745 Bacteria 3261
415 Ga0157377_10540117 3300014745 Bacteria 822
416 Ga0157379_10217561 3300014968 Bacteria 1730
417 Ga0157379_10250799 3300014968 Unclassified 1607
418 Ga0157379_10425834 3300014968 Bacteria 1223
419 Ga0157379_10888075 3300014968 Bacteria 845
420 Ga0157379_11891580 3300014968 Unclassified 588
421 Ga0157376_10065170 3300014969 Bacteria 3075
422 Ga0157376_10066499 3300014969 Bacteria 3047
423 Ga0157376_10803103 3300014969 Bacteria 954
424 Ga0163161_10063404 3300017792 Unclassified 2693
425 Ga0163161_10103650 3300017792 Bacteria 2120
426 Ga0163161_10307925 3300017792 Unclassified 1249
427 Ga0207656_10007804 3300025321 Unclassified 3917
428 Ga0207713_1219891 3300025735 Bacteria 573
429 Ga0207653_10005072 3300025885 Bacteria 4114
430 Ga0207642_10721550 3300025899 Unclassified 629
431 Ga0207642_11016456 3300025899 Unclassified 534
432 Ga0207710_10071936 3300025900 Unclassified 1587
433 Ga0207688_10402406 3300025901 Bacteria 849
434 Ga0207680_10124322 3300025903 Bacteria 1691
435 Ga0207647_10556043 3300025904 Unclassified 636
436 Ga0207645_10200990 3300025907 Bacteria 1311
437 Ga0207645_10344927 3300025907 Bacteria 996
438 Ga0207643_10007411 3300025908 Bacteria 5886
439 Ga0207684_10000117 3300025910 Bacteria 148207
440 Ga0207684_10048355 3300025910 Unclassified 3608
441 Ga0207684_10321212 3300025910 Bacteria 1334
442 Ga0207684_10487929 3300025910 Bacteria 1056
443 Ga0207684_10889611 3300025910 Bacteria 749
444 Ga0207684_11303448 3300025910 Unclassified 598
445 Ga0207684_11423170 3300025910 Unclassified 567
446 Ga0207654_10313853 3300025911 Unclassified 1070
447 Ga0207654_10765609 3300025911 Unclassified 696
448 Ga0207654_10998631 3300025911 Unclassified 608
449 Ga0207654_11273911 3300025911 Unclassified 536
450 Ga0207707_10000013 3300025912 Bacteria 264517
451 Ga0207707_10014344 3300025912 Bacteria 6901
452 Ga0207707_10679519 3300025912 Unclassified 866
453 Ga0207695_10066615 3300025913 Bacteria 3698
454 Ga0207671_10002628 3300025914 Bacteria 18914
455 Ga0207671_10051976 3300025914 Bacteria 3036
456 Ga0207671_11122357 3300025914 Bacteria 617
457 Ga0207663_10535433 3300025916 Bacteria 914
458 Ga0207660_10001456 3300025917 Bacteria 15892
459 Ga0207660_11389217 3300025917 Unclassified 569
460 Ga0207662_10023207 3300025918 Bacteria 3563
461 Ga0207662_10313443 3300025918 Unclassified 1046
462 Ga0207652_10000071 3300025921 Bacteria 109636
463 Ga0207646_10220898 3300025922 Bacteria 1712
464 Ga0207646_11275651 3300025922 Bacteria 642
465 Ga0207681_10019237 3300025923 Unclassified 4313
466 Ga0207681_10583876 3300025923 Bacteria 922
467 Ga0207681_11755125 3300025923 Bacteria 518
468 Ga0207650_10059196 3300025925 Bacteria 2855
469 Ga0207659_10531447 3300025926 Bacteria 998
470 Ga0207644_10036336 3300025931 Bacteria 3457
471 Ga0207644_10296270 3300025931 Unclassified 1302
472 Ga0207706_10184055 3300025933 Bacteria 1834
473 Ga0207706_10327664 3300025933 Bacteria 1332
474 Ga0207706_10437332 3300025933 Unclassified 1132
475 Ga0207706_10496418 3300025933 Bacteria 1054
476 Ga0207706_11620779 3300025933 Unclassified 524
477 Ga0207686_11702310 3300025934 Bacteria 521
478 Ga0207709_10004094 3300025935 Bacteria 8486
479 Ga0207709_10219084 3300025935 Bacteria 1371
480 Ga0207709_11640130 3300025935 Unclassified 534
481 Ga0207670_10797564 3300025936 Unclassified 787
482 Ga0207669_10705012 3300025937 Unclassified 830
483 Ga0207704_10852181 3300025938 Unclassified 764
484 Ga0207704_11016466 3300025938 Bacteria 702
485 Ga0207665_10285216 3300025939 Bacteria 1230
486 Ga0207665_10630290 3300025939 Unclassified 839
487 Ga0207691_10002161 3300025940 Bacteria 19232
488 Ga0207691_10323514 3300025940 Bacteria 1322
489 Ga0207711_10021621 3300025941 Bacteria 5374
490 Ga0207711_10565569 3300025941 Unclassified 1061
491 Ga0207689_10014491 3300025942 Bacteria 6708
492 Ga0207689_10063830 3300025942 Bacteria 3030
493 Ga0207689_10083318 3300025942 Unclassified 2629
494 Ga0207689_10119622 3300025942 Bacteria 2167
495 Ga0207689_10308978 3300025942 Bacteria 1311
496 Ga0207689_10552653 3300025942 Unclassified 967
497 Ga0207689_10565877 3300025942 Unclassified 955
498 Ga0207679_10496830 3300025945 Bacteria 1088
499 Ga0207651_10623247 3300025960 Unclassified 945
500 Ga0207651_12131488 3300025960 Bacteria 503
501 Ga0207712_10001712 3300025961 Bacteria 14729
502 Ga0207712_10065692 3300025961 Unclassified 2590
503 Ga0207668_10085161 3300025972 Bacteria 2305
504 Ga0207640_10112809 3300025981 Bacteria 1931
505 Ga0207640_10399056 3300025981 Unclassified 1119
506 Ga0207640_10420771 3300025981 Bacteria 1093
507 Ga0207640_10692952 3300025981 Unclassified 872
508 Ga0207658_11360783 3300025986 Bacteria 649
509 Ga0207658_11755842 3300025986 Bacteria 566
510 Ga0207677_10201212 3300026023 Unclassified 1583
511 Ga0207677_10454094 3300026023 Bacteria 1099
512 Ga0207677_10488730 3300026023 Unclassified 1062
513 Ga0207703_10433675 3300026035 Bacteria 1225
514 Ga0207703_10623606 3300026035 Unclassified 1021
515 Ga0207703_10634888 3300026035 Unclassified 1012
516 Ga0207703_11213691 3300026035 Bacteria 725
517 Ga0207703_12164511 3300026035 Bacteria 532
518 Ga0207708_10005204 3300026075 Bacteria 9593
519 Ga0207708_10093451 3300026075 Unclassified 2321
520 Ga0207708_10623734 3300026075 Bacteria 915
521 Ga0207702_10228734 3300026078 Bacteria 1737
522 Ga0207702_11083045 3300026078 Bacteria 795
523 Ga0207641_10146743 3300026088 Bacteria 2134
524 Ga0207641_10191628 3300026088 Bacteria 1879
525 Ga0207641_10322589 3300026088 Bacteria 1465
526 Ga0207641_10624927 3300026088 Bacteria 1056
527 Ga0207641_10802986 3300026088 Unclassified 931
528 Ga0207641_10893537 3300026088 Unclassified 882
529 Ga0207641_12304961 3300026088 Bacteria 538
530 Ga0207648_10084437 3300026089 Bacteria 2770
531 Ga0207648_10086349 3300026089 Bacteria 2737
532 Ga0207648_10274597 3300026089 Bacteria 1506
533 Ga0207648_10277758 3300026089 Bacteria 1498
534 Ga0207648_10610627 3300026089 Bacteria 1006
535 Ga0207648_11622570 3300026089 Bacteria 608
536 Ga0207676_10010554 3300026095 Bacteria 6583
537 Ga0207676_10028814 3300026095 Bacteria 4152
538 Ga0207676_10153463 3300026095 Bacteria 1986
539 Ga0207676_10405354 3300026095 Unclassified 1275
540 Ga0207676_10532617 3300026095 Unclassified 1120
541 Ga0207676_10915958 3300026095 Bacteria 860
542 Ga0207676_11752206 3300026095 Bacteria 620
543 Ga0207674_10035682 3300026116 Bacteria 5189
544 Ga0207674_10051209 3300026116 Bacteria 4214
545 Ga0207674_10479573 3300026116 Bacteria 1202
546 Ga0207674_10856714 3300026116 Bacteria 876
547 Ga0207674_10992198 3300026116 Unclassified 809
548 Ga0207674_11407502 3300026116 Bacteria 667
549 Ga0207675_100003593 3300026118 Bacteria 15111
550 Ga0207675_100021302 3300026118 Bacteria 6038
551 Ga0207675_100086612 3300026118 Bacteria 2941
552 Ga0207675_100165154 3300026118 Bacteria 2114
553 Ga0207675_100249745 3300026118 Unclassified 1717
554 Ga0207683_10103216 3300026121 Bacteria 2547
555 Ga0207683_10919914 3300026121 Bacteria 812
556 Ga0207698_11509349 3300026142 Bacteria 687
557 Ga0209974_10084843 3300027876 Bacteria 1093
558 Ga0207428_10139028 3300027907 Bacteria 1855
559 Ga0268266_11617954 3300028379 Bacteria 623
560 Ga0268264_10837865 3300028381 Unclassified 920
561 Ga0268264_11040076 3300028381 Bacteria 826
562 Ga0268264_11161499 3300028381 Unclassified 781
563 Ga0307513_10443487 3300031456 Bacteria 1024
564 Ga0307513_10776099 3300031456 Unclassified 664
565 Ga0307408_100604889 3300031548 Unclassified 975
566 Ga0307408_101649758 3300031548 Unclassified 610
567 Ga0307405_10669352 3300031731 Unclassified 856
568 Ga0307405_11326834 3300031731 Unclassified 627
569 Ga0307413_10286412 3300031824 Bacteria 1242
570 Ga0307406_11070978 3300031901 Unclassified 695
571 Ga0307416_100037962 3300032002 Bacteria 3712
572 Ga0307411_11534603 3300032005 Unclassified 613
573 Ga0373957_0238689 3300035120 Bacteria 763
574 Ga0373937_1876672 3300036401 Bacteria 545
575 Ga0395900_0442445 3300037418 Bacteria 1257
576 Ga0395900_1022321 3300037418 Unclassified 746
577 Ga0395900_1273194 3300037418 Unclassified 650
578 Ga0395900_1449918 3300037418 Unclassified 599
579 Ga0395898_0043307 3300037466 Bacteria 4436
580 Ga0395901_0181742 3300038443 Unclassified 2206
581 Ga0395901_0308301 3300038443 Unclassified 1640
582 Ga0395901_0335988 3300038443 Bacteria 1561
583 Ga0242420_094377 3300038996 Unclassified 631
584 Ga0439465_0059568 3300041413 Bacteria 1264
585 Ga0439449_0129027 3300042007 Bacteria 940
586 Ga0439455_0009879 3300042012 Bacteria 2083
587 Ga0439446_0277391 3300042156 Unclassified 584
588 Ga0439458_0004588 3300042157 Unclassified 3160
589 Ga0439434_0025594 3300042435 Bacteria 1781
590 Ga0450893_0046286 3300042532 Unclassified 807
591 Ga0453683_1194342 3300044673 Unclassified 509
592 Ga0451576_0382759 3300045051 Unclassified 1475
593 Ga0466967_1151466 3300045976 Bacteria 773
594 Ga0495629_0383229 3300046459 Bacteria 957
595 Ga0495636_0068698 3300047318 Unclassified 1509
596 Ga0495672_0180577 3300047320 Bacteria 1069
597 Ga0496102_0139592 3300048905 Unclassified 2272
598 Ga0496104_0234692 3300048907 Bacteria 1746
599 Ga0496106_0072648 3300048909 Bacteria 2631
600 Ga0496106_1198707 3300048909 Bacteria 592
601 Ga0496109_0673733 3300048912 Bacteria 972
602 Ga0496110_0160317 3300048913 Bacteria 2039
603 Ga0496112_1631816 3300048915 Unclassified 558
604 Ga0496114_1319549 3300048917 Unclassified 608
605 Ga0501296_029349 3300049519 Unclassified 735
606 Ga0501298_011585 3300049521 Unclassified 1534
607 Ga0501299_041768 3300049522 Unclassified 922
608 Ga0501077_0679995 3300049593 Unclassified 661
609 Ga0501198_052199 3300049649 Unclassified 731
610 Ga0501202_240309 3300049652 Unclassified 506
611 Ga0501206_031191 3300049653 Unclassified 793
612 Ga0501207_003273 3300049654 Unclassified 2151
613 Ga0501216_039430 3300049660 Unclassified 899
614 Ga0501217_005553 3300049661 Unclassified 2643
615 Ga0501223_033909 3300049663 Unclassified 992
616 Ga0501224_012286 3300049664 Unclassified 1261
617 Ga0501230_162543 3300049667 Unclassified 510
618 Ga0501235_096332 3300049669 Unclassified 719
619 Ga0501236_004164 3300049670 Unclassified 1707
620 Ga0501249_056517 3300049679 Unclassified 906
621 Ga0501252_093575 3300049682 Unclassified 512
622 Ga0501253_181847 3300049683 Unclassified 547
623 Ga0501256_001626 3300049685 Unclassified 1692
624 Ga0501256_045747 3300049685 Unclassified 530
625 Ga0501259_079016 3300049688 Unclassified 719
626 Ga0501221_083919 3300049704 Unclassified 770
627 Ga0501225_0034819 3300049705 Bacteria 1386
628 Ga0501229_017482 3300049706 Unclassified 936
629 Ga0501245_049520 3300049708 Unclassified 741
630 Ga0501081_0631826 3300049743 Bacteria 802
631 Ga0501241_010067 3300049758 Unclassified 1720
632 Ga0501264_023408 3300049761 Unclassified 670
633 Ga0501267_021642 3300049764 Unclassified 713
634 Ga0501273_014945 3300049770 Unclassified 1004
635 Ga0501281_20606 3300049777 Unclassified 511
636 Ga0501283_017085 3300049779 Unclassified 1132
637 Ga0501212_051860 3300049851 Unclassified 696
638 nmdc:mga05p37_1238125_c1 3300050507 Unclassified 767
639 nmdc:mga05p37_12471_c1 3300050507 Bacteria 10151
640 nmdc:mga05p37_1745640_c1 3300050507 Unclassified 604
641 nmdc:mga05p37_285747_c1 3300050507 Bacteria 1965
642 nmdc:mga05p37_42181_c1 3300050507 Unclassified 3664
643 nmdc:mga05p37_53374_c1 3300050507 Unclassified 4971
644 nmdc:mga05p37_54108_c1 3300050507 Bacteria 4938
645 nmdc:mga05p37_819857_c1 3300050507 Bacteria 1015
646 nmdc:mga09592_333140_c1 3300050508 Unclassified 1314
647 nmdc:mga09592_683195_c1 3300050508 Bacteria 875
648 nmdc:mga06r32_263844_c1 3300050510 Bacteria 1710
649 nmdc:mga08y16_133348_c1 3300050511 Bacteria 2582
650 nmdc:mga08y16_1598432_c1 3300050511 Unclassified 610
651 nmdc:mga08y16_38564_c1 3300050511 Bacteria 5017
652 nmdc:mga08y16_616146_c1 3300050511 Bacteria 1093
653 nmdc:mga0n895_2063760_c1 3300050512 Unclassified 527
654 nmdc:mga0n895_216998_c1 3300050512 Bacteria 1942
655 nmdc:mga0n895_217052_c1 3300050512 Bacteria 1942
656 nmdc:mga0n895_258003_c1 3300050512 Bacteria 1769
657 nmdc:mga0rr50_78848_c1 3300050513 Bacteria 2535
658 nmdc:mga0rr50_88415_c1 3300050513 Unclassified 2407
659 nmdc:mga08x19_825318_c1 3300050514 Bacteria 658
660 nmdc:mga0a205_117095_c1 3300050515 Bacteria 2563
661 nmdc:mga0a205_1171085_c1 3300050515 Bacteria 616
662 nmdc:mga0a205_121533_c1 3300050515 Unclassified 2511
663 nmdc:mga0a205_123306_c1 3300050515 Bacteria 2491
664 nmdc:mga0a205_210473_c1 3300050515 Bacteria 1833
665 nmdc:mga0a205_834723_c1 3300050515 Bacteria 769
666 nmdc:mga0a205_95673_c1 3300050515 Bacteria 2869
667 nmdc:mga0sz30_519166_c1 3300050516 Unclassified 536
668 Ga0495619_0682718 3300053085 Bacteria 699
669 Ga0500562_035012 3300053108 Bacteria 1330
670 Ga0070695_100973943
671 MRS1b_contig_6095528
672 LJNas_1021038
673 Ga0065704_10048221
674 Ga0065704_10251950
675 Ga0065704_10417359
676 Ga0065712_10067947
677 Ga0065712_10159477
678 Ga0065712_10529358
679 Ga0065715_10006097
680 Ga0065715_10013876
681 Ga0065715_10092943
682 Ga0065715_10214194
683 Ga0065715_10227354
684 Ga0065715_10697396
685 Ga0065707_10032016
686 Ga0065707_10138965
687 Ga0065707_10157569
688 Ga0070676_10027144
689 Ga0070676_10581371
690 Ga0070690_100032754
691 Ga0070690_100363806
692 Ga0070670_101256457
693 Ga0068869_100020643
694 Ga0068869_100271910
695 Ga0068869_100869402
696 Ga0068869_100967272
697 Ga0070666_10107465
698 Ga0070666_10158188
699 Ga0070680_100005389
700 Ga0070680_100890784
701 Ga0070682_100031271
702 Ga0070682_101412783
703 Ga0068868_100036214
704 Ga0068868_100090157
705 Ga0068868_100482328
706 Ga0070689_100293569
707 Ga0070689_102156624
708 Ga0070687_100031951
709 Ga0070687_100195607
710 Ga0070687_100226456
711 Ga0070687_100630090
712 Ga0070692_10026437
713 Ga0070692_10037035
714 Ga0070692_10052731
715 Ga0070692_10097148
716 Ga0070692_10184891
717 Ga0070692_10259316
718 Ga0070692_10481523
719 Ga0070692_10654462
720 Ga0070692_11333761
721 Ga0070668_100001301
722 Ga0070669_100004174
723 Ga0070669_100090124
724 Ga0070669_100499039
725 Ga0070669_101164882
726 Ga0070669_101623142
727 Ga0070669_101862409
728 Ga0070675_100036971
729 Ga0070671_100078129
730 Ga0070671_100303817
731 Ga0070674_100100519
732 Ga0070673_100080509
733 Ga0070673_100219957
734 Ga0070688_101608331
735 Ga0070667_100163513
736 Ga0070667_101096185
737 Ga0070703_10029008
738 Ga0070709_10890742
739 Ga0070710_10568285
740 Ga0070701_10054571
741 Ga0070701_10218314
742 Ga0070701_10304546
743 Ga0070701_10361770
744 Ga0070701_11121699
745 Ga0070705_100007164
746 Ga0070705_100014893
747 Ga0070705_100209768
748 Ga0070705_100329493
749 Ga0070705_100363848
750 Ga0070705_100985201
751 Ga0070700_100124804
752 Ga0070700_100816696
753 Ga0070700_101816988
754 Ga0070694_100025250
755 Ga0070694_100038300
756 Ga0070694_100060926
757 Ga0070694_100146045
758 Ga0070694_100385453
759 Ga0070694_100516034
760 Ga0070694_100682228
761 Ga0070694_100914384
762 Ga0070694_101864763
763 Ga0070708_100266165
764 Ga0070708_100473195
765 Ga0070708_100886988
766 Ga0070708_101009571
767 Ga0070708_102150926
768 Ga0070678_100099244
769 Ga0070678_101031640
770 Ga0070662_100332343
771 Ga0070662_100491196
772 Ga0070662_100609543
773 Ga0070662_101600632
774 Ga0070662_101833181
775 Ga0070681_10000108
776 Ga0070681_10139707
777 Ga0070681_10553509
778 Ga0070681_11836403
779 Ga0068867_100007343
780 Ga0068867_100041375
781 Ga0068867_100532795
782 Ga0068867_100546394
783 Ga0068867_101318019
784 Ga0068867_101881403
785 Ga0070685_10265319
786 Ga0070685_10422865
787 Ga0070706_100000216
788 Ga0070706_100004103
789 Ga0070706_100032535
790 Ga0070706_100330665
791 Ga0070706_101807576
792 Ga0070706_101822791
793 Ga0070707_100382763
794 Ga0070707_100476995
795 Ga0070707_100533228
796 Ga0070698_100044816
797 Ga0070698_100310915
798 Ga0070698_100449839
799 Ga0070698_100856995
800 Ga0070698_101168345
801 Ga0070698_101325488
802 Ga0070699_100093478
803 Ga0070699_100112459
804 Ga0070699_100392765
805 Ga0070699_101845648
806 Ga0070679_100000130
807 Ga0070684_100430672
808 Ga0070684_101488701
809 Ga0070697_100000086
810 Ga0070697_100000118
811 Ga0070697_100481416
812 Ga0070697_100767185
813 Ga0070697_100822616
814 Ga0070697_101309921
815 Ga0068853_101437103
816 Ga0068853_101940570
817 Ga0070672_100049693
818 Ga0070672_100719740
819 Ga0070686_100001031
820 Ga0070686_100008719
821 Ga0070686_100075772
822 Ga0070686_100399020
823 Ga0070686_101218249
824 Ga0070695_100071825
825 Ga0070695_100218619
826 Ga0070695_100263989
827 Ga0070695_100310277
828 Ga0070695_100521828
829 Ga0070695_100555760
830 Ga0070695_101379621
831 Ga0070695_101500257
832 Ga0070696_100146905
833 Ga0070696_100149154
834 Ga0070696_100153020
835 Ga0070696_100202296
836 Ga0070696_100235001
837 Ga0070696_100419198
838 Ga0070696_100457222
839 Ga0070696_100502689
840 Ga0070696_100539611
841 Ga0070696_101007274
842 Ga0070696_101243264
843 Ga0070693_100159098
844 Ga0070693_100179600
845 Ga0070693_100518836
846 Ga0070665_102160193
847 Ga0070704_100082820
848 Ga0070704_100106694
849 Ga0070704_100236563
850 Ga0070704_100279563
851 Ga0070704_100330755
852 Ga0070704_100379381
853 Ga0070704_100574175
854 Ga0070704_100690554
855 Ga0070704_100945436
856 Ga0070664_100221950
857 Ga0070664_100503163
858 Ga0068857_100035000
859 Ga0068857_100627076
860 Ga0068857_100789456
861 Ga0068857_101619978
862 Ga0068854_100418480
863 Ga0068854_100492843
864 Ga0068854_100504607
865 Ga0068854_100793663
866 Ga0068854_100975520
867 Ga0068856_100237661
868 Ga0068856_100285590
869 Ga0070702_100067537
870 Ga0070702_100184546
871 Ga0070702_100414124
872 Ga0068852_100420520
873 Ga0068852_100471626
874 Ga0068852_100640984
875 Ga0068859_100031382
876 Ga0068859_100061273
877 Ga0068859_100065848
878 Ga0068859_100090596
879 Ga0068859_100120058
880 Ga0068859_100121083
881 Ga0068859_100173081
882 Ga0068859_100943875
883 Ga0068859_102901621
884 Ga0068864_100001928
885 Ga0068864_100024571
886 Ga0068864_100028411
887 Ga0068864_100380489
888 Ga0068864_101561843
889 Ga0068864_102481936
890 Ga0068866_10421172
891 Ga0068866_10615426
892 Ga0068861_100002132
893 Ga0068861_100026721
894 Ga0068861_100197160
895 Ga0068861_100781765
896 Ga0068851_10012886
897 Ga0068870_10025400
898 Ga0068870_11063211
899 Ga0068863_100238677
900 Ga0068863_100247125
901 Ga0068863_100346182
902 Ga0068863_100572360
903 Ga0068863_102169592
904 Ga0068858_100171746
905 Ga0068858_100737201
906 Ga0068858_101289280
907 Ga0068858_101636342
908 Ga0068860_100103151
909 Ga0068860_100280735
910 Ga0068860_100608500
911 Ga0068860_100814245
912 Ga0068860_100925819
913 Ga0068862_100133975
914 Ga0068862_100296842
915 Ga0068862_100525029
916 Ga0068862_102666068
917 Ga0081455_10957745
918 Ga0075432_10549534
919 Ga0070716_100259081
920 Ga0070716_100678879
921 Ga0075367_10294670
922 Ga0097621_100043486
923 Ga0097621_100156119
924 Ga0097621_100716053
925 Ga0075370_10074493
926 Ga0068871_100050127
927 Ga0068871_100116201
928 Ga0068871_100856015
929 Ga0075428_100212654
930 Ga0075428_100655884
931 Ga0075428_100683461
932 Ga0075428_101035683
933 Ga0075428_101505299
934 Ga0075430_100039051
935 Ga0075430_101650549
936 Ga0075431_100285559
937 Ga0075431_100537585
938 Ga0075431_101425513
939 Ga0075433_10042458
940 Ga0075433_10049868
941 Ga0075433_10080344
942 Ga0075433_10093851
943 Ga0075433_10112190
944 Ga0075433_10151040
945 Ga0075433_10223919
946 Ga0075433_10370591
947 Ga0075433_10377360
948 Ga0075433_10561817
949 Ga0075433_10688495
950 Ga0075433_11290899
951 Ga0075434_100039335
952 Ga0075434_100092149
953 Ga0075434_100786982
954 Ga0075434_101507399
955 Ga0075429_100394816
956 Ga0075429_100506868
957 Ga0068865_100018299
958 Ga0068865_100185198
959 Ga0097620_100031382
960 Ga0097620_100061270
961 Ga0097620_100065848
962 Ga0097620_100090595
963 Ga0097620_100120047
964 Ga0097620_100121089
965 Ga0097620_100173082
966 Ga0097620_100943961
967 Ga0097620_102902383
968 Ga0075435_100073954
969 Ga0075435_100578337
970 Ga0099794_10148384
971 Ga0105251_10097285
972 Ga0105251_10231362
973 Ga0105240_10044355
974 Ga0111539_10078483
975 Ga0111539_10291615
976 Ga0111539_10616740
977 Ga0111539_10763025
978 Ga0111539_11639135
979 Ga0105245_11197391
980 Ga0105245_11332801
981 Ga0105247_10090522
982 Ga0105247_11297514
983 Ga0114129_10008450
984 Ga0114129_10008912
985 Ga0114129_10013659
986 Ga0114129_10021800
987 Ga0114129_10238444
988 Ga0114129_10464299
989 Ga0114129_10721809
990 Ga0114129_10875043
991 Ga0114129_11959575
992 Ga0114129_11961647
993 Ga0114129_12326639
994 Ga0105243_10006488
995 Ga0105243_10845099
996 Ga0105243_13021298
997 Ga0105241_10065736
998 Ga0105241_10093244
999 Ga0105241_10122736
1000 Ga0105241_10319937
1001 Ga0105241_10348266
1002 Ga0105241_10668006
1003 Ga0105241_11252852
1004 Ga0105241_11360157
1005 Ga0105241_11733366
1006 Ga0105241_12610935
1007 Ga0105241_12670027
1008 Ga0105242_10141890
1009 Ga0105242_10227622
1010 Ga0105242_10614266
1011 Ga0105242_10990431
1012 Ga0105242_11373617
1013 Ga0105248_10013728
1014 Ga0105248_10124156
1015 Ga0105248_10467076
1016 Ga0105248_11529466
1017 Ga0105237_10009403
1018 Ga0105237_10036125
1019 Ga0105237_10138610
1020 Ga0105249_10000107
1021 Ga0105249_10098441
1022 Ga0105249_11872809
1023 Ga0105239_10269080
1024 Ga0105239_10515442
1025 Ga0105239_11071461
1026 Ga0105246_10149491
1027 Ga0105246_10181191
1028 Ga0105246_10205432
1029 Ga0105246_10837966
1030 Ga0105246_11080007
1031 Ga0105246_11189085
1032 Ga0105246_11411166
1033 Ga0105246_12062267
1034 Ga0157325_1007819
1035 Ga0157373_10000857
1036 Ga0157371_10607041
1037 Ga0157371_10725762
1038 Ga0157374_10943458
1039 Ga0157374_11790901
1040 Ga0157378_10017159
1041 Ga0157378_10042359
1042 Ga0157378_10075554
1043 Ga0157378_10111385
1044 Ga0157378_10214472
1045 Ga0157378_10392245
1046 Ga0157378_11577890
1047 Ga0157378_11817956
1048 Ga0157378_12183188
1049 Ga0163162_10000006
1050 Ga0163162_10010167
1051 Ga0163162_10023261
1052 Ga0163162_10036443
1053 Ga0163162_10083466
1054 Ga0163162_10173021
1055 Ga0163162_10758170
1056 Ga0163162_11068456
1057 Ga0163162_11091694
1058 Ga0157372_10051237
1059 Ga0157372_10200224
1060 Ga0157372_10627483
1061 Ga0157372_11258379
1062 Ga0157372_11854135
1063 Ga0157375_10091717
1064 Ga0157375_10164115
1065 Ga0157375_10420570
1066 Ga0157375_10827384
1067 Ga0157375_12407651
1068 Ga0157375_12642345
1069 Ga0163163_10010593
1070 Ga0163163_10021611
1071 Ga0163163_10022356
1072 Ga0163163_10309494
1073 Ga0163163_10508867
1074 Ga0163163_10548441
1075 Ga0163163_12347633
1076 Ga0157380_10000397
1077 Ga0157380_10002310
1078 Ga0157380_10003547
1079 Ga0157380_10058612
1080 Ga0157380_10137974
1081 Ga0157380_10624039
1082 Ga0157380_11482782
1083 Ga0157377_10023625
1084 Ga0157377_10540117
1085 Ga0157379_10217561
1086 Ga0157379_10250799
1087 Ga0157379_10425834
1088 Ga0157379_10888075
1089 Ga0157379_11891580
1090 Ga0157376_10065170
1091 Ga0157376_10066499
1092 Ga0157376_10803103
1093 Ga0163161_10063404
1094 Ga0163161_10103650
1095 Ga0163161_10307925
1096 Ga0207656_10007804
1097 Ga0207713_1219891
1098 Ga0207653_10005072
1099 Ga0207642_10721550
1100 Ga0207642_11016456
1101 Ga0207710_10071936
1102 Ga0207688_10402406
1103 Ga0207680_10124322
1104 Ga0207647_10556043
1105 Ga0207645_10200990
1106 Ga0207645_10344927
1107 Ga0207643_10007411
1108 Ga0207684_10000117
1109 Ga0207684_10048355
1110 Ga0207684_10321212
1111 Ga0207684_10487929
1112 Ga0207684_10889611
1113 Ga0207684_11303448
1114 Ga0207684_11423170
1115 Ga0207654_10313853
1116 Ga0207654_10765609
1117 Ga0207654_10998631
1118 Ga0207654_11273911
1119 Ga0207707_10000013
1120 Ga0207707_10014344
1121 Ga0207707_10679519
1122 Ga0207695_10066615
1123 Ga0207671_10002628
1124 Ga0207671_10051976
1125 Ga0207671_11122357
1126 Ga0207663_10535433
1127 Ga0207660_10001456
1128 Ga0207660_11389217
1129 Ga0207662_10023207
1130 Ga0207662_10313443
1131 Ga0207652_10000071
1132 Ga0207646_10220898
1133 Ga0207646_11275651
1134 Ga0207681_10019237
1135 Ga0207681_10583876
1136 Ga0207681_11755125
1137 Ga0207650_10059196
1138 Ga0207659_10531447
1139 Ga0207644_10036336
1140 Ga0207644_10296270
1141 Ga0207706_10184055
1142 Ga0207706_10327664
1143 Ga0207706_10437332
1144 Ga0207706_10496418
1145 Ga0207706_11620779
1146 Ga0207686_11702310
1147 Ga0207709_10004094
1148 Ga0207709_10219084
1149 Ga0207709_11640130
1150 Ga0207670_10797564
1151 Ga0207669_10705012
1152 Ga0207704_10852181
1153 Ga0207704_11016466
1154 Ga0207665_10285216
1155 Ga0207665_10630290
1156 Ga0207691_10002161
1157 Ga0207691_10323514
1158 Ga0207711_10021621
1159 Ga0207711_10565569
1160 Ga0207689_10014491
1161 Ga0207689_10063830
1162 Ga0207689_10083318
1163 Ga0207689_10119622
1164 Ga0207689_10308978
1165 Ga0207689_10552653
1166 Ga0207689_10565877
1167 Ga0207679_10496830
1168 Ga0207651_10623247
1169 Ga0207651_12131488
1170 Ga0207712_10001712
1171 Ga0207712_10065692
1172 Ga0207668_10085161
1173 Ga0207640_10112809
1174 Ga0207640_10399056
1175 Ga0207640_10420771
1176 Ga0207640_10692952
1177 Ga0207658_11360783
1178 Ga0207658_11755842
1179 Ga0207677_10201212
1180 Ga0207677_10454094
1181 Ga0207677_10488730
1182 Ga0207703_10433675
1183 Ga0207703_10623606
1184 Ga0207703_10634888
1185 Ga0207703_11213691
1186 Ga0207703_12164511
1187 Ga0207708_10005204
1188 Ga0207708_10093451
1189 Ga0207708_10623734
1190 Ga0207702_10228734
1191 Ga0207702_11083045
1192 Ga0207641_10146743
1193 Ga0207641_10191628
1194 Ga0207641_10322589
1195 Ga0207641_10624927
1196 Ga0207641_10802986
1197 Ga0207641_10893537
1198 Ga0207641_12304961
1199 Ga0207648_10084437
1200 Ga0207648_10086349
1201 Ga0207648_10274597
1202 Ga0207648_10277758
1203 Ga0207648_10610627
1204 Ga0207648_11622570
1205 Ga0207676_10010554
1206 Ga0207676_10028814
1207 Ga0207676_10153463
1208 Ga0207676_10405354
1209 Ga0207676_10532617
1210 Ga0207676_10915958
1211 Ga0207676_11752206
1212 Ga0207674_10035682
1213 Ga0207674_10051209
1214 Ga0207674_10479573
1215 Ga0207674_10856714
1216 Ga0207674_10992198
1217 Ga0207674_11407502
1218 Ga0207675_100003593
1219 Ga0207675_100021302
1220 Ga0207675_100086612
1221 Ga0207675_100165154
1222 Ga0207675_100249745
1223 Ga0207683_10103216
1224 Ga0207683_10919914
1225 Ga0207698_11509349
1226 Ga0209974_10084843
1227 Ga0207428_10139028
1228 Ga0268266_11617954
1229 Ga0268264_10837865
1230 Ga0268264_11040076
1231 Ga0268264_11161499
1232 Ga0307513_10443487
1233 Ga0307513_10776099
1234 Ga0307408_100604889
1235 Ga0307408_101649758
1236 Ga0307405_10669352
1237 Ga0307405_11326834
1238 Ga0307413_10286412
1239 Ga0307406_11070978
1240 Ga0307416_100037962
1241 Ga0307411_11534603
1242 Ga0373957_0238689
1243 Ga0373937_1876672
1244 Ga0395900_0442445
1245 Ga0395900_1022321
1246 Ga0395900_1273194
1247 Ga0395900_1449918
1248 Ga0395898_0043307
1249 Ga0395901_0181742
1250 Ga0395901_0308301
1251 Ga0395901_0335988
1252 Ga0242420_094377
1253 Ga0439465_0059568
1254 Ga0439449_0129027
1255 Ga0439455_0009879
1256 Ga0439446_0277391
1257 Ga0439458_0004588
1258 Ga0439434_0025594
1259 Ga0450893_0046286
1260 Ga0453683_1194342
1261 Ga0451576_0382759
1262 Ga0466967_1151466
1263 Ga0495629_0383229
1264 Ga0495636_0068698
1265 Ga0495672_0180577
1266 Ga0496102_0139592
1267 Ga0496104_0234692
1268 Ga0496106_0072648
1269 Ga0496106_1198707
1270 Ga0496109_0673733
1271 Ga0496110_0160317
1272 Ga0496112_1631816
1273 Ga0496114_1319549
1274 Ga0501296_029349
1275 Ga0501298_011585
1276 Ga0501299_041768
1277 Ga0501077_0679995
1278 Ga0501198_052199
1279 Ga0501202_240309
1280 Ga0501206_031191
1281 Ga0501207_003273
1282 Ga0501216_039430
1283 Ga0501217_005553
1284 Ga0501223_033909
1285 Ga0501224_012286
1286 Ga0501230_162543
1287 Ga0501235_096332
1288 Ga0501236_004164
1289 Ga0501249_056517
1290 Ga0501252_093575
1291 Ga0501253_181847
1292 Ga0501256_001626
1293 Ga0501256_045747
1294 Ga0501259_079016
1295 Ga0501221_083919
1296 Ga0501225_0034819
1297 Ga0501229_017482
1298 Ga0501245_049520
1299 Ga0501081_0631826
1300 Ga0501241_010067
1301 Ga0501264_023408
1302 Ga0501267_021642
1303 Ga0501273_014945
1304 Ga0501281_20606
1305 Ga0501283_017085
1306 Ga0501212_051860
1307 nmdc:mga05p37_1238125_c1
1308 nmdc:mga05p37_12471_c1
1309 nmdc:mga05p37_1745640_c1
1310 nmdc:mga05p37_285747_c1
1311 nmdc:mga05p37_42181_c1
1312 nmdc:mga05p37_53374_c1
1313 nmdc:mga05p37_54108_c1
1314 nmdc:mga05p37_819857_c1
1315 nmdc:mga09592_333140_c1
1316 nmdc:mga09592_683195_c1
1317 nmdc:mga06r32_263844_c1
1318 nmdc:mga08y16_133348_c1
1319 nmdc:mga08y16_1598432_c1
1320 nmdc:mga08y16_38564_c1
1321 nmdc:mga08y16_616146_c1
1322 nmdc:mga0n895_2063760_c1
1323 nmdc:mga0n895_216998_c1
1324 nmdc:mga0n895_217052_c1
1325 nmdc:mga0n895_258003_c1
1326 nmdc:mga0rr50_78848_c1
1327 nmdc:mga0rr50_88415_c1
1328 nmdc:mga08x19_825318_c1
1329 nmdc:mga0a205_117095_c1
1330 nmdc:mga0a205_1171085_c1
1331 nmdc:mga0a205_121533_c1
1332 nmdc:mga0a205_123306_c1
1333 nmdc:mga0a205_210473_c1
1334 nmdc:mga0a205_834723_c1
1335 nmdc:mga0a205_95673_c1
1336 nmdc:mga0sz30_519166_c1
1337 Ga0495619_0682718
1338 Ga0500562_035012

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08734

GYD

GYD domain

4

92

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2w29-assembly1.cif.gz_B gly102thr mutant of rv3291c 0.8672 1 85
2w25-assembly1.cif.gz_B crystal structure of glu104ala mutant 0.8659 2 85
2vc1-assembly1.cif.gz_B feast or famine regulatory protein (rv3291c)from m. tuberculosis complexed with l-methionine 0.8656 1 85
2ivm-assembly1.cif.gz_A crystal structure of a transcriptional regulator 0.858 1 85
2qz8-assembly1.cif.gz_B-2 crystal structure of mycobacterium tuberculosis leucine response regulatory protein (lrpa) 0.8558 2 85
ID Description Score Start End Superfamily
4pcqD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.8464 2 83 3.30.70.920
2w24A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.832 1 83 3.30.70.920
2z4pD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.8149 1 83 3.30.70.920
2z4pD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.8054 1 83 3.30.70.920
3i4pA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.785 2 83 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A2V6J8P1-F1-model_v4 GYD family protein 0.9952 1 86
AF-A0A531LR19-F1-model_v4 GYD domain-containing protein 0.987 1 79
AF-X1J557-F1-model_v4 GYD domain-containing protein 0.9856 1 79
AF-A0A2V6J8P1-F1-model_v4 GYD family protein 0.9838 1 86
AF-A0A537QUB6-F1-model_v4 GYD domain-containing protein 0.9811 3 83

Map