F473969
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 669 | 317 | 669 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100739847|Ga0070680_1007398472 |
| Length | 202 |
| Sequence | LRFDPRLSRENGRCREIHEAGIVSLTALWGAPITRGEKMRLYSGKIPAIAGEVVKALIESGDIAVVDRNEAEMDAQAVLKEYLRLDREITEKAKDALQKKGLPYEQFGRIKRALAHEKGFGLGEEALEWMTNQMIESFMQSPHIDEIFAEDTVLRKRMADVLKKHMQVDEELKIRNLEEGTATWEIEYQKVLDQMKRNRGLE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 152 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 155 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 158 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 159 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 166 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 168 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 172 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 173 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 175 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 183 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 194 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 201 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 210 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 217 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 218 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 219 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 220 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 252 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 253 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 254 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 272 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 273 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 274 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 275 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 277 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 278 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 279 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 284 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049852 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control | Metagenome | Rhizosphere |
| 287 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 288 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 289 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 296 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 298 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 299 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 300 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 301 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 302 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 303 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 304 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 305 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 306 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 307 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 308 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 309 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 310 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 311 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 312 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 313 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 314 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 315 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 316 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.4 |
| Metatranscriptomes | 0.6 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.04 |
| Nodule | 0 |
| Rhizoplane | 4.04 |
| Rhizosphere | 89.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10113803 | 3300003323 | Bacteria | 3797 |
| 2 | rootH1_10113805 | 3300003323 | Bacteria | 2953 |
| 3 | Ga0065707_10571873 | 3300005295 | Unclassified | 707 |
| 4 | Ga0070658_10004177 | 3300005327 | Bacteria | 11813 |
| 5 | Ga0070658_10250431 | 3300005327 | Bacteria | 1503 |
| 6 | Ga0070658_10652810 | 3300005327 | Bacteria | 913 |
| 7 | Ga0070658_11012103 | 3300005327 | Bacteria | 723 |
| 8 | Ga0070683_100001809 | 3300005329 | Bacteria | 16673 |
| 9 | Ga0070683_100136278 | 3300005329 | Bacteria | 2325 |
| 10 | Ga0070683_100289120 | 3300005329 | Bacteria | 1559 |
| 11 | Ga0070683_100567100 | 3300005329 | Bacteria | 1086 |
| 12 | Ga0070690_100030672 | 3300005330 | Bacteria | 3343 |
| 13 | Ga0070690_100050166 | 3300005330 | Bacteria | 2662 |
| 14 | Ga0070670_100007137 | 3300005331 | Bacteria | 9460 |
| 15 | Ga0068869_100417443 | 3300005334 | Unclassified | 1106 |
| 16 | Ga0070666_10087093 | 3300005335 | Bacteria | 2140 |
| 17 | Ga0070680_100073940 | 3300005336 | Bacteria | 2803 |
| 18 | Ga0070680_100739847 | 3300005336 | Bacteria | 847 |
| 19 | Ga0070682_100045975 | 3300005337 | Bacteria | 2708 |
| 20 | Ga0070682_100107781 | 3300005337 | Unclassified | 1851 |
| 21 | Ga0070682_101553339 | 3300005337 | Bacteria | 571 |
| 22 | Ga0068868_100585841 | 3300005338 | Unclassified | 987 |
| 23 | Ga0068868_100989746 | 3300005338 | Archaea | 769 |
| 24 | Ga0070660_100417576 | 3300005339 | Bacteria | 1111 |
| 25 | Ga0070689_100000018 | 3300005340 | Bacteria | 153256 |
| 26 | Ga0070689_100064580 | 3300005340 | Bacteria | 2849 |
| 27 | Ga0070689_100354370 | 3300005340 | Bacteria | 1232 |
| 28 | Ga0070689_100367332 | 3300005340 | Bacteria | 1210 |
| 29 | Ga0070689_100405936 | 3300005340 | Bacteria | 1152 |
| 30 | Ga0070687_100000438 | 3300005343 | Bacteria | 14065 |
| 31 | Ga0070687_100048081 | 3300005343 | Bacteria | 2192 |
| 32 | Ga0070687_100359932 | 3300005343 | Bacteria | 942 |
| 33 | Ga0070692_10188933 | 3300005345 | Unclassified | 1199 |
| 34 | Ga0070668_100251626 | 3300005347 | Unclassified | 1467 |
| 35 | Ga0070675_100110103 | 3300005354 | Bacteria | 2329 |
| 36 | Ga0070675_100273051 | 3300005354 | Bacteria | 1484 |
| 37 | Ga0070675_101450756 | 3300005354 | Bacteria | 633 |
| 38 | Ga0070671_100186601 | 3300005355 | Bacteria | 1757 |
| 39 | Ga0070673_100547232 | 3300005364 | Bacteria | 1051 |
| 40 | Ga0070688_100006544 | 3300005365 | Bacteria | 6231 |
| 41 | Ga0070688_100092787 | 3300005365 | Bacteria | 1975 |
| 42 | Ga0070688_100143873 | 3300005365 | Bacteria | 1623 |
| 43 | Ga0070688_100277030 | 3300005365 | Bacteria | 1204 |
| 44 | Ga0070659_100078159 | 3300005366 | Bacteria | 2639 |
| 45 | Ga0070659_101164292 | 3300005366 | Bacteria | 681 |
| 46 | Ga0070659_101230173 | 3300005366 | Viruses | 663 |
| 47 | Ga0070709_10346747 | 3300005434 | Bacteria | 1096 |
| 48 | Ga0070709_10387247 | 3300005434 | Unclassified | 1041 |
| 49 | Ga0070701_10164240 | 3300005438 | Bacteria | 1288 |
| 50 | Ga0070711_100853679 | 3300005439 | Bacteria | 775 |
| 51 | Ga0070705_100269681 | 3300005440 | Bacteria | 1205 |
| 52 | Ga0070700_100256787 | 3300005441 | Bacteria | 1256 |
| 53 | Ga0070694_100137900 | 3300005444 | Bacteria | 1769 |
| 54 | Ga0070694_100621798 | 3300005444 | Unclassified | 872 |
| 55 | Ga0070708_100233490 | 3300005445 | Bacteria | 1726 |
| 56 | Ga0070678_100048916 | 3300005456 | Bacteria | 3048 |
| 57 | Ga0070678_100312593 | 3300005456 | Bacteria | 1339 |
| 58 | Ga0070681_10034342 | 3300005458 | Bacteria | 5092 |
| 59 | Ga0070681_10120316 | 3300005458 | Bacteria | 2561 |
| 60 | Ga0070681_10316519 | 3300005458 | Bacteria | 1470 |
| 61 | Ga0070685_10020753 | 3300005466 | Bacteria | 3559 |
| 62 | Ga0070707_101116055 | 3300005468 | Bacteria | 755 |
| 63 | Ga0070698_100004067 | 3300005471 | Bacteria | 16076 |
| 64 | Ga0070698_100015147 | 3300005471 | Bacteria | 8153 |
| 65 | Ga0070698_100742138 | 3300005471 | Unclassified | 925 |
| 66 | Ga0070679_100002586 | 3300005530 | Bacteria | 16447 |
| 67 | Ga0070679_100002759 | 3300005530 | Bacteria | 15976 |
| 68 | Ga0070679_100045791 | 3300005530 | Bacteria | 4359 |
| 69 | Ga0070679_100389001 | 3300005530 | Bacteria | 1341 |
| 70 | Ga0070679_100765132 | 3300005530 | Bacteria | 909 |
| 71 | Ga0070684_100064203 | 3300005535 | Bacteria | 3220 |
| 72 | Ga0070684_100955125 | 3300005535 | Bacteria | 804 |
| 73 | Ga0068853_100018010 | 3300005539 | Bacteria | 5839 |
| 74 | Ga0070672_100050698 | 3300005543 | Bacteria | 3234 |
| 75 | Ga0070672_100220740 | 3300005543 | Bacteria | 1590 |
| 76 | Ga0070672_100434671 | 3300005543 | Unclassified | 1129 |
| 77 | Ga0070686_100066079 | 3300005544 | Bacteria | 2351 |
| 78 | Ga0070686_100451044 | 3300005544 | Bacteria | 989 |
| 79 | Ga0070693_100310212 | 3300005547 | Bacteria | 1067 |
| 80 | Ga0070665_100005092 | 3300005548 | Bacteria | 13634 |
| 81 | Ga0070665_100360029 | 3300005548 | Bacteria | 1461 |
| 82 | Ga0070665_100839713 | 3300005548 | Bacteria | 932 |
| 83 | Ga0070665_100890438 | 3300005548 | Bacteria | 903 |
| 84 | Ga0070704_100155710 | 3300005549 | Bacteria | 1802 |
| 85 | Ga0070704_100422311 | 3300005549 | Bacteria | 1142 |
| 86 | Ga0070704_101210924 | 3300005549 | Bacteria | 689 |
| 87 | Ga0070704_101486948 | 3300005549 | Unclassified | 623 |
| 88 | Ga0068855_100042142 | 3300005563 | Bacteria | 5409 |
| 89 | Ga0068855_100044129 | 3300005563 | Bacteria | 5277 |
| 90 | Ga0068855_100099652 | 3300005563 | Bacteria | 3346 |
| 91 | Ga0068855_100396082 | 3300005563 | Bacteria | 1514 |
| 92 | Ga0068855_100854693 | 3300005563 | Unclassified | 964 |
| 93 | Ga0068857_101110367 | 3300005577 | Unclassified | 764 |
| 94 | Ga0068854_100925076 | 3300005578 | Bacteria | 768 |
| 95 | Ga0068856_100071957 | 3300005614 | Bacteria | 3423 |
| 96 | Ga0068856_100099460 | 3300005614 | Bacteria | 2900 |
| 97 | Ga0068856_100266013 | 3300005614 | Bacteria | 1730 |
| 98 | Ga0070702_100144811 | 3300005615 | Unclassified | 1518 |
| 99 | Ga0070702_100451483 | 3300005615 | Bacteria | 933 |
| 100 | Ga0068852_100100836 | 3300005616 | Bacteria | 2606 |
| 101 | Ga0068852_100128954 | 3300005616 | Bacteria | 2327 |
| 102 | Ga0068859_100003886 | 3300005617 | Bacteria | 15256 |
| 103 | Ga0068859_100145292 | 3300005617 | Bacteria | 2446 |
| 104 | Ga0068859_100478174 | 3300005617 | Bacteria | 1341 |
| 105 | Ga0068859_101510063 | 3300005617 | Unclassified | 741 |
| 106 | Ga0068864_100285349 | 3300005618 | Unclassified | 1542 |
| 107 | Ga0068864_101321523 | 3300005618 | Unclassified | 722 |
| 108 | Ga0068866_10068111 | 3300005718 | Bacteria | 1871 |
| 109 | Ga0068866_10234842 | 3300005718 | Unclassified | 1114 |
| 110 | Ga0068861_100047232 | 3300005719 | Bacteria | 3249 |
| 111 | Ga0068863_100110103 | 3300005841 | Bacteria | 2622 |
| 112 | Ga0068858_100061393 | 3300005842 | Bacteria | 3475 |
| 113 | Ga0068860_100331999 | 3300005843 | Bacteria | 1494 |
| 114 | Ga0068860_100829599 | 3300005843 | Bacteria | 939 |
| 115 | Ga0068862_100127217 | 3300005844 | Bacteria | 2250 |
| 116 | Ga0068862_100897036 | 3300005844 | Bacteria | 871 |
| 117 | Ga0081455_10057468 | 3300005937 | Bacteria | 3296 |
| 118 | Ga0081538_10218608 | 3300005981 | Unclassified | 758 |
| 119 | Ga0081538_10236316 | 3300005981 | Bacteria | 709 |
| 120 | Ga0070717_10044568 | 3300006028 | Bacteria | 3623 |
| 121 | Ga0070717_10047790 | 3300006028 | Bacteria | 3507 |
| 122 | Ga0070716_100027828 | 3300006173 | Bacteria | 3041 |
| 123 | Ga0070712_100664917 | 3300006175 | Bacteria | 886 |
| 124 | Ga0097621_100224434 | 3300006237 | Bacteria | 1638 |
| 125 | Ga0097621_100290742 | 3300006237 | Unclassified | 1441 |
| 126 | Ga0097621_100329530 | 3300006237 | Bacteria | 1354 |
| 127 | Ga0097621_100391454 | 3300006237 | Unclassified | 1243 |
| 128 | Ga0068871_100862035 | 3300006358 | Unclassified | 838 |
| 129 | Ga0075430_100069851 | 3300006846 | Bacteria | 2946 |
| 130 | Ga0075430_100724475 | 3300006846 | Unclassified | 820 |
| 131 | Ga0075433_11192576 | 3300006852 | Unclassified | 661 |
| 132 | Ga0075429_100002168 | 3300006880 | Bacteria | 16391 |
| 133 | Ga0075429_100053377 | 3300006880 | Bacteria | 3517 |
| 134 | Ga0075429_100548929 | 3300006880 | Bacteria | 1013 |
| 135 | Ga0068865_100004469 | 3300006881 | Bacteria | 8438 |
| 136 | Ga0068865_100162886 | 3300006881 | Bacteria | 1703 |
| 137 | Ga0097620_100003886 | 3300006931 | Bacteria | 15256 |
| 138 | Ga0097620_100145283 | 3300006931 | Bacteria | 2446 |
| 139 | Ga0097620_100478205 | 3300006931 | Bacteria | 1341 |
| 140 | Ga0097620_101510074 | 3300006931 | Unclassified | 741 |
| 141 | Ga0075435_100349275 | 3300007076 | Bacteria | 1268 |
| 142 | Ga0105240_10004581 | 3300009093 | Bacteria | 20959 |
| 143 | Ga0105240_10736817 | 3300009093 | Bacteria | 1073 |
| 144 | Ga0111539_10041391 | 3300009094 | Bacteria | 5539 |
| 145 | Ga0111539_10118985 | 3300009094 | Unclassified | 3095 |
| 146 | Ga0111539_10268651 | 3300009094 | Bacteria | 1985 |
| 147 | Ga0111539_10873641 | 3300009094 | Bacteria | 1046 |
| 148 | Ga0111539_11170879 | 3300009094 | Bacteria | 893 |
| 149 | Ga0105245_10000072 | 3300009098 | Bacteria | 105617 |
| 150 | Ga0105245_10752747 | 3300009098 | Bacteria | 1010 |
| 151 | Ga0105245_11278919 | 3300009098 | Bacteria | 782 |
| 152 | Ga0114129_10174875 | 3300009147 | Bacteria | 2925 |
| 153 | Ga0114129_10622251 | 3300009147 | Unclassified | 1396 |
| 154 | Ga0114129_10913190 | 3300009147 | Bacteria | 1112 |
| 155 | Ga0114129_11109646 | 3300009147 | Bacteria | 990 |
| 156 | Ga0105243_10436838 | 3300009148 | Bacteria | 1225 |
| 157 | Ga0105243_10714723 | 3300009148 | Bacteria | 978 |
| 158 | Ga0105241_10666874 | 3300009174 | Unclassified | 946 |
| 159 | Ga0105241_11491943 | 3300009174 | Unclassified | 650 |
| 160 | Ga0105242_10410989 | 3300009176 | Unclassified | 1266 |
| 161 | Ga0105242_10721372 | 3300009176 | Archaea | 978 |
| 162 | Ga0105248_11157124 | 3300009177 | Bacteria | 874 |
| 163 | Ga0105237_10000014 | 3300009545 | Bacteria | 293492 |
| 164 | Ga0105237_10068855 | 3300009545 | Bacteria | 3533 |
| 165 | Ga0105237_10518793 | 3300009545 | Bacteria | 1198 |
| 166 | Ga0105237_10558821 | 3300009545 | Bacteria | 1151 |
| 167 | Ga0105238_10008178 | 3300009551 | Bacteria | 10462 |
| 168 | Ga0105238_10020007 | 3300009551 | Bacteria | 6813 |
| 169 | Ga0105238_10288280 | 3300009551 | Bacteria | 1624 |
| 170 | Ga0105238_10511480 | 3300009551 | Bacteria | 1203 |
| 171 | Ga0105238_11046936 | 3300009551 | Bacteria | 838 |
| 172 | Ga0105249_10169215 | 3300009553 | Bacteria | 2118 |
| 173 | Ga0105249_10192196 | 3300009553 | Bacteria | 1993 |
| 174 | Ga0105239_10077252 | 3300010375 | Bacteria | 3664 |
| 175 | Ga0105239_10710355 | 3300010375 | Bacteria | 1150 |
| 176 | Ga0105246_11291614 | 3300011119 | Bacteria | 676 |
| 177 | Ga0105246_11450197 | 3300011119 | Unclassified | 642 |
| 178 | Ga0157369_10885145 | 3300013105 | Bacteria | 916 |
| 179 | Ga0157369_11168735 | 3300013105 | Bacteria | 786 |
| 180 | Ga0157374_10044255 | 3300013296 | Bacteria | 4115 |
| 181 | Ga0157374_10096208 | 3300013296 | Bacteria | 2832 |
| 182 | Ga0157374_10953278 | 3300013296 | Unclassified | 877 |
| 183 | Ga0157374_11102220 | 3300013296 | Bacteria | 814 |
| 184 | Ga0157378_10338060 | 3300013297 | Unclassified | 1467 |
| 185 | Ga0157378_10377713 | 3300013297 | Bacteria | 1391 |
| 186 | Ga0157378_11099223 | 3300013297 | Bacteria | 832 |
| 187 | Ga0163162_10495001 | 3300013306 | Bacteria | 1353 |
| 188 | Ga0157372_10064255 | 3300013307 | Bacteria | 4118 |
| 189 | Ga0157372_11358423 | 3300013307 | Bacteria | 819 |
| 190 | Ga0163163_11091899 | 3300014325 | Unclassified | 861 |
| 191 | Ga0157377_10437107 | 3300014745 | Unclassified | 900 |
| 192 | Ga0157379_10237470 | 3300014968 | Bacteria | 1653 |
| 193 | Ga0157379_10808372 | 3300014968 | Bacteria | 885 |
| 194 | Ga0157376_10355224 | 3300014969 | Unclassified | 1404 |
| 195 | Ga0157376_10651438 | 3300014969 | Bacteria | 1054 |
| 196 | Ga0157376_10776662 | 3300014969 | Bacteria | 969 |
| 197 | Ga0157376_10866669 | 3300014969 | Bacteria | 919 |
| 198 | Ga0197907_10644234 | 3300020069 | Bacteria | 746 |
| 199 | Ga0206356_10488560 | 3300020070 | Bacteria | 1080 |
| 200 | Ga0206352_11294615 | 3300020078 | Unclassified | 656 |
| 201 | Ga0206354_11390788 | 3300020081 | Unclassified | 1097 |
| 202 | Ga0207697_10009698 | 3300025315 | Bacteria | 4147 |
| 203 | Ga0207697_10168681 | 3300025315 | Bacteria | 957 |
| 204 | Ga0207692_10052812 | 3300025898 | Bacteria | 2067 |
| 205 | Ga0207692_10289510 | 3300025898 | Bacteria | 993 |
| 206 | Ga0207685_10590573 | 3300025905 | Bacteria | 595 |
| 207 | Ga0207699_10068257 | 3300025906 | Bacteria | 2165 |
| 208 | Ga0207645_10000305 | 3300025907 | Bacteria | 41231 |
| 209 | Ga0207643_10151141 | 3300025908 | Bacteria | 1392 |
| 210 | Ga0207705_10001999 | 3300025909 | Bacteria | 15855 |
| 211 | Ga0207705_10108306 | 3300025909 | Bacteria | 2051 |
| 212 | Ga0207707_10012710 | 3300025912 | Bacteria | 7318 |
| 213 | Ga0207707_10021786 | 3300025912 | Bacteria | 5601 |
| 214 | Ga0207707_10087528 | 3300025912 | Bacteria | 2721 |
| 215 | Ga0207707_10107531 | 3300025912 | Bacteria | 2438 |
| 216 | Ga0207707_10259232 | 3300025912 | Bacteria | 1509 |
| 217 | Ga0207695_10003405 | 3300025913 | Bacteria | 22458 |
| 218 | Ga0207695_10094121 | 3300025913 | Bacteria | 3004 |
| 219 | Ga0207671_10000270 | 3300025914 | Bacteria | 77396 |
| 220 | Ga0207671_10131744 | 3300025914 | Unclassified | 1919 |
| 221 | Ga0207693_10420527 | 3300025915 | Bacteria | 1045 |
| 222 | Ga0207663_10819534 | 3300025916 | Bacteria | 742 |
| 223 | Ga0207660_10023885 | 3300025917 | Bacteria | 4133 |
| 224 | Ga0207660_10159462 | 3300025917 | Bacteria | 1739 |
| 225 | Ga0207660_10159532 | 3300025917 | Bacteria | 1739 |
| 226 | Ga0207660_10212875 | 3300025917 | Bacteria | 1514 |
| 227 | Ga0207662_10001910 | 3300025918 | Bacteria | 10272 |
| 228 | Ga0207662_10046301 | 3300025918 | Unclassified | 2573 |
| 229 | Ga0207662_10047120 | 3300025918 | Bacteria | 2553 |
| 230 | Ga0207662_10072131 | 3300025918 | Bacteria | 2092 |
| 231 | Ga0207662_10082136 | 3300025918 | Bacteria | 1968 |
| 232 | Ga0207662_10578370 | 3300025918 | Bacteria | 780 |
| 233 | Ga0207649_10237412 | 3300025920 | Bacteria | 1307 |
| 234 | Ga0207652_10004517 | 3300025921 | Bacteria | 11297 |
| 235 | Ga0207652_10008761 | 3300025921 | Bacteria | 8143 |
| 236 | Ga0207652_10067593 | 3300025921 | Bacteria | 3099 |
| 237 | Ga0207652_10231423 | 3300025921 | Unclassified | 1665 |
| 238 | Ga0207652_10436937 | 3300025921 | Archaea | 1180 |
| 239 | Ga0207652_10481101 | 3300025921 | Bacteria | 1118 |
| 240 | Ga0207646_10478056 | 3300025922 | Bacteria | 1123 |
| 241 | Ga0207646_10487958 | 3300025922 | Unclassified | 1111 |
| 242 | Ga0207646_11055033 | 3300025922 | Bacteria | 716 |
| 243 | Ga0207681_10002259 | 3300025923 | Bacteria | 12251 |
| 244 | Ga0207694_10010604 | 3300025924 | Bacteria | 6957 |
| 245 | Ga0207694_10013117 | 3300025924 | Bacteria | 6239 |
| 246 | Ga0207694_10118235 | 3300025924 | Bacteria | 2114 |
| 247 | Ga0207694_10504021 | 3300025924 | Bacteria | 1014 |
| 248 | Ga0207650_10008878 | 3300025925 | Bacteria | 6866 |
| 249 | Ga0207650_10138454 | 3300025925 | Bacteria | 1911 |
| 250 | Ga0207650_10194812 | 3300025925 | Unclassified | 1621 |
| 251 | Ga0207659_10016522 | 3300025926 | Bacteria | 4804 |
| 252 | Ga0207659_10026438 | 3300025926 | Bacteria | 3916 |
| 253 | Ga0207659_11165279 | 3300025926 | Bacteria | 663 |
| 254 | Ga0207687_10002588 | 3300025927 | Bacteria | 12277 |
| 255 | Ga0207687_10877173 | 3300025927 | Bacteria | 767 |
| 256 | Ga0207644_10072396 | 3300025931 | Bacteria | 2524 |
| 257 | Ga0207690_10336187 | 3300025932 | Bacteria | 1191 |
| 258 | Ga0207690_10989459 | 3300025932 | Bacteria | 699 |
| 259 | Ga0207686_10314690 | 3300025934 | Archaea | 1167 |
| 260 | Ga0207686_10332352 | 3300025934 | Unclassified | 1139 |
| 261 | Ga0207709_10257805 | 3300025935 | Bacteria | 1277 |
| 262 | Ga0207670_10000001 | 3300025936 | Bacteria | 949312 |
| 263 | Ga0207670_10045655 | 3300025936 | Bacteria | 2905 |
| 264 | Ga0207670_10253605 | 3300025936 | Unclassified | 1361 |
| 265 | Ga0207670_10421693 | 3300025936 | Bacteria | 1071 |
| 266 | Ga0207670_11221515 | 3300025936 | Unclassified | 636 |
| 267 | Ga0207669_10002571 | 3300025937 | Bacteria | 7754 |
| 268 | Ga0207704_10014734 | 3300025938 | Bacteria | 3960 |
| 269 | Ga0207704_10135406 | 3300025938 | Bacteria | 1714 |
| 270 | Ga0207665_10119873 | 3300025939 | Bacteria | 1857 |
| 271 | Ga0207691_10035731 | 3300025940 | Bacteria | 4609 |
| 272 | Ga0207691_10644810 | 3300025940 | Bacteria | 895 |
| 273 | Ga0207689_10061294 | 3300025942 | Unclassified | 3093 |
| 274 | Ga0207689_10190251 | 3300025942 | Unclassified | 1693 |
| 275 | Ga0207689_10243204 | 3300025942 | Bacteria | 1488 |
| 276 | Ga0207689_11271457 | 3300025942 | Bacteria | 619 |
| 277 | Ga0207661_10000960 | 3300025944 | Bacteria | 18978 |
| 278 | Ga0207661_10525690 | 3300025944 | Unclassified | 1082 |
| 279 | Ga0207667_10127810 | 3300025949 | Bacteria | 2618 |
| 280 | Ga0207667_10231031 | 3300025949 | Bacteria | 1894 |
| 281 | Ga0207667_10254992 | 3300025949 | Bacteria | 1794 |
| 282 | Ga0207667_10890483 | 3300025949 | Bacteria | 882 |
| 283 | Ga0207651_10002205 | 3300025960 | Bacteria | 9219 |
| 284 | Ga0207651_10067837 | 3300025960 | Bacteria | 2512 |
| 285 | Ga0207712_10157986 | 3300025961 | Bacteria | 1758 |
| 286 | Ga0207712_10246511 | 3300025961 | Bacteria | 1442 |
| 287 | Ga0207668_10006597 | 3300025972 | Bacteria | 6862 |
| 288 | Ga0207668_10214698 | 3300025972 | Bacteria | 1541 |
| 289 | Ga0207640_10290875 | 3300025981 | Bacteria | 1288 |
| 290 | Ga0207658_10292796 | 3300025986 | Bacteria | 1400 |
| 291 | Ga0207658_10473770 | 3300025986 | Bacteria | 1112 |
| 292 | Ga0207677_10426600 | 3300026023 | Bacteria | 1131 |
| 293 | Ga0207677_11103795 | 3300026023 | Bacteria | 723 |
| 294 | Ga0207703_10064050 | 3300026035 | Bacteria | 3016 |
| 295 | Ga0207703_10625597 | 3300026035 | Bacteria | 1020 |
| 296 | Ga0207639_10017468 | 3300026041 | Bacteria | 5086 |
| 297 | Ga0207639_10708444 | 3300026041 | Bacteria | 934 |
| 298 | Ga0207708_10006083 | 3300026075 | Bacteria | 8950 |
| 299 | Ga0207708_10084489 | 3300026075 | Bacteria | 2441 |
| 300 | Ga0207702_10096229 | 3300026078 | Bacteria | 2603 |
| 301 | Ga0207702_10280958 | 3300026078 | Bacteria | 1574 |
| 302 | Ga0207648_10003927 | 3300026089 | Bacteria | 15482 |
| 303 | Ga0207676_10965426 | 3300026095 | Unclassified | 838 |
| 304 | Ga0207674_10075073 | 3300026116 | Bacteria | 3391 |
| 305 | Ga0207674_10156323 | 3300026116 | Bacteria | 2236 |
| 306 | Ga0207674_10202300 | 3300026116 | Bacteria | 1935 |
| 307 | Ga0207674_10223423 | 3300026116 | Bacteria | 1831 |
| 308 | Ga0207674_10293133 | 3300026116 | Bacteria | 1575 |
| 309 | Ga0207674_10686137 | 3300026116 | Bacteria | 989 |
| 310 | Ga0207675_100013757 | 3300026118 | Bacteria | 7547 |
| 311 | Ga0207675_100037626 | 3300026118 | Bacteria | 4513 |
| 312 | Ga0207675_101205443 | 3300026118 | Bacteria | 777 |
| 313 | Ga0207683_10148526 | 3300026121 | Bacteria | 2115 |
| 314 | Ga0207683_10346262 | 3300026121 | Bacteria | 1363 |
| 315 | Ga0207683_10423630 | 3300026121 | Bacteria | 1226 |
| 316 | Ga0207698_10105753 | 3300026142 | Bacteria | 2346 |
| 317 | Ga0207698_10215000 | 3300026142 | Bacteria | 1732 |
| 318 | Ga0207428_10457821 | 3300027907 | Unclassified | 930 |
| 319 | Ga0268266_10002761 | 3300028379 | Bacteria | 18352 |
| 320 | Ga0268266_10257722 | 3300028379 | Bacteria | 1615 |
| 321 | Ga0268266_10361059 | 3300028379 | Bacteria | 1367 |
| 322 | Ga0268265_10091200 | 3300028380 | Bacteria | 2436 |
| 323 | Ga0268264_10632660 | 3300028381 | Bacteria | 1057 |
| 324 | Ga0265337_1015017 | 3300028556 | Bacteria | 2550 |
| 325 | Ga0265326_10002726 | 3300028558 | Bacteria | 5927 |
| 326 | Ga0265319_1029533 | 3300028563 | Bacteria | 1924 |
| 327 | Ga0265319_1051690 | 3300028563 | Bacteria | 1355 |
| 328 | Ga0265334_10014224 | 3300028573 | Unclassified | 3318 |
| 329 | Ga0265334_10153170 | 3300028573 | Bacteria | 812 |
| 330 | Ga0265334_10211168 | 3300028573 | Unclassified | 672 |
| 331 | Ga0265318_10000001 | 3300028577 | Bacteria | 500711 |
| 332 | Ga0265318_10002071 | 3300028577 | Bacteria | 10985 |
| 333 | Ga0265318_10113314 | 3300028577 | Bacteria | 997 |
| 334 | Ga0265323_10000747 | 3300028653 | Bacteria | 17451 |
| 335 | Ga0265323_10008433 | 3300028653 | Bacteria | 4249 |
| 336 | Ga0265323_10099692 | 3300028653 | Unclassified | 962 |
| 337 | Ga0265322_10034737 | 3300028654 | Unclassified | 1436 |
| 338 | Ga0265336_10007772 | 3300028666 | Bacteria | 3800 |
| 339 | Ga0307517_10019612 | 3300028786 | Bacteria | 8665 |
| 340 | Ga0307515_10010405 | 3300028794 | Bacteria | 17822 |
| 341 | Ga0265338_10001115 | 3300028800 | Bacteria | 44587 |
| 342 | Ga0265338_10018541 | 3300028800 | Bacteria | 7445 |
| 343 | Ga0265338_10031496 | 3300028800 | Bacteria | 5199 |
| 344 | Ga0265338_10142082 | 3300028800 | Bacteria | 1879 |
| 345 | Ga0265338_10162017 | 3300028800 | Bacteria | 1726 |
| 346 | Ga0265338_10174710 | 3300028800 | Bacteria | 1643 |
| 347 | Ga0265338_10358640 | 3300028800 | Bacteria | 1046 |
| 348 | Ga0265324_10000172 | 3300029957 | Bacteria | 50391 |
| 349 | Ga0265330_10000002 | 3300031235 | Bacteria | 481237 |
| 350 | Ga0265330_10000588 | 3300031235 | Bacteria | 23647 |
| 351 | Ga0265330_10000838 | 3300031235 | Bacteria | 19299 |
| 352 | Ga0265330_10001551 | 3300031235 | Bacteria | 13211 |
| 353 | Ga0265330_10002799 | 3300031235 | Bacteria | 9339 |
| 354 | Ga0265330_10003798 | 3300031235 | Bacteria | 7786 |
| 355 | Ga0265330_10004572 | 3300031235 | Bacteria | 7004 |
| 356 | Ga0265330_10043045 | 3300031235 | Unclassified | 1999 |
| 357 | Ga0265330_10121421 | 3300031235 | Bacteria | 1113 |
| 358 | Ga0265332_10000242 | 3300031238 | Bacteria | 43401 |
| 359 | Ga0265332_10000331 | 3300031238 | Bacteria | 36017 |
| 360 | Ga0265332_10004135 | 3300031238 | Bacteria | 6879 |
| 361 | Ga0265332_10064850 | 3300031238 | Bacteria | 1560 |
| 362 | Ga0265332_10102899 | 3300031238 | Bacteria | 1204 |
| 363 | Ga0265328_10000280 | 3300031239 | Bacteria | 23796 |
| 364 | Ga0265328_10000683 | 3300031239 | Bacteria | 15763 |
| 365 | Ga0265328_10012366 | 3300031239 | Unclassified | 3397 |
| 366 | Ga0265320_10000007 | 3300031240 | Bacteria | 331219 |
| 367 | Ga0265320_10002363 | 3300031240 | Bacteria | 13201 |
| 368 | Ga0265320_10011167 | 3300031240 | Bacteria | 5297 |
| 369 | Ga0265320_10011806 | 3300031240 | Bacteria | 5120 |
| 370 | Ga0265320_10288858 | 3300031240 | Bacteria | 726 |
| 371 | Ga0265320_10342532 | 3300031240 | Unclassified | 660 |
| 372 | Ga0265325_10000856 | 3300031241 | Bacteria | 21940 |
| 373 | Ga0265325_10008903 | 3300031241 | Bacteria | 5898 |
| 374 | Ga0265325_10020117 | 3300031241 | Unclassified | 3683 |
| 375 | Ga0265329_10000098 | 3300031242 | Bacteria | 41248 |
| 376 | Ga0265329_10000806 | 3300031242 | Bacteria | 15941 |
| 377 | Ga0265329_10015809 | 3300031242 | Bacteria | 2629 |
| 378 | Ga0265340_10000741 | 3300031247 | Bacteria | 18540 |
| 379 | Ga0265340_10126383 | 3300031247 | Unclassified | 1175 |
| 380 | Ga0265339_10000141 | 3300031249 | Bacteria | 60047 |
| 381 | Ga0265339_10010416 | 3300031249 | Bacteria | 5776 |
| 382 | Ga0265339_10042307 | 3300031249 | Unclassified | 2522 |
| 383 | Ga0265339_10065697 | 3300031249 | Bacteria | 1944 |
| 384 | Ga0265339_10146761 | 3300031249 | Bacteria | 1196 |
| 385 | Ga0265339_10238733 | 3300031249 | Unclassified | 883 |
| 386 | Ga0265339_10306876 | 3300031249 | Bacteria | 756 |
| 387 | Ga0265331_10000001 | 3300031250 | Bacteria | 798836 |
| 388 | Ga0265331_10007316 | 3300031250 | Bacteria | 6396 |
| 389 | Ga0265331_10110045 | 3300031250 | Bacteria | 1264 |
| 390 | Ga0265331_10238382 | 3300031250 | Bacteria | 816 |
| 391 | Ga0265316_10000053 | 3300031344 | Bacteria | 125221 |
| 392 | Ga0265316_10000108 | 3300031344 | Bacteria | 88867 |
| 393 | Ga0265316_10000583 | 3300031344 | Bacteria | 40804 |
| 394 | Ga0265316_10000878 | 3300031344 | Bacteria | 32962 |
| 395 | Ga0265316_10002456 | 3300031344 | Bacteria | 19220 |
| 396 | Ga0265316_10002912 | 3300031344 | Bacteria | 17515 |
| 397 | Ga0265316_10006504 | 3300031344 | Bacteria | 11148 |
| 398 | Ga0265316_10024023 | 3300031344 | Bacteria | 5117 |
| 399 | Ga0265316_10043815 | 3300031344 | Bacteria | 3563 |
| 400 | Ga0265316_10050155 | 3300031344 | Bacteria | 3284 |
| 401 | Ga0265316_10180086 | 3300031344 | Bacteria | 1574 |
| 402 | Ga0265316_10329649 | 3300031344 | Bacteria | 1107 |
| 403 | Ga0307513_10213379 | 3300031456 | Bacteria | 1759 |
| 404 | Ga0307509_10000164 | 3300031507 | Bacteria | 104223 |
| 405 | Ga0307509_10027240 | 3300031507 | Bacteria | 6362 |
| 406 | Ga0307509_10114355 | 3300031507 | Bacteria | 2694 |
| 407 | Ga0265313_10000090 | 3300031595 | Bacteria | 90099 |
| 408 | Ga0265313_10053988 | 3300031595 | Bacteria | 1910 |
| 409 | Ga0265313_10058506 | 3300031595 | Bacteria | 1816 |
| 410 | Ga0265313_10149831 | 3300031595 | Bacteria | 998 |
| 411 | Ga0265313_10288722 | 3300031595 | Unclassified | 661 |
| 412 | Ga0307508_10154304 | 3300031616 | Unclassified | 1900 |
| 413 | Ga0307508_10154665 | 3300031616 | Bacteria | 1897 |
| 414 | Ga0265314_10000006 | 3300031711 | Bacteria | 540431 |
| 415 | Ga0265314_10000009 | 3300031711 | Bacteria | 476805 |
| 416 | Ga0265314_10005265 | 3300031711 | Bacteria | 11710 |
| 417 | Ga0265314_10009719 | 3300031711 | Bacteria | 8090 |
| 418 | Ga0265314_10012976 | 3300031711 | Bacteria | 6766 |
| 419 | Ga0265314_10017512 | 3300031711 | Bacteria | 5622 |
| 420 | Ga0265314_10030286 | 3300031711 | Bacteria | 4007 |
| 421 | Ga0265314_10437368 | 3300031711 | Bacteria | 699 |
| 422 | Ga0265342_10000065 | 3300031712 | Bacteria | 112156 |
| 423 | Ga0265342_10000654 | 3300031712 | Bacteria | 36347 |
| 424 | Ga0265342_10002973 | 3300031712 | Bacteria | 14234 |
| 425 | Ga0265342_10007901 | 3300031712 | Bacteria | 7712 |
| 426 | Ga0265342_10016011 | 3300031712 | Bacteria | 4911 |
| 427 | Ga0265342_10018799 | 3300031712 | Bacteria | 4467 |
| 428 | Ga0265342_10033590 | 3300031712 | Unclassified | 3153 |
| 429 | Ga0265342_10058193 | 3300031712 | Unclassified | 2284 |
| 430 | Ga0265342_10098237 | 3300031712 | Bacteria | 1671 |
| 431 | Ga0265342_10188316 | 3300031712 | Unclassified | 1127 |
| 432 | Ga0265342_10189915 | 3300031712 | Bacteria | 1121 |
| 433 | Ga0265342_10364525 | 3300031712 | Bacteria | 750 |
| 434 | Ga0316576_10000030 | 3300031727 | Bacteria | 41956 |
| 435 | Ga0316576_10127528 | 3300031727 | Bacteria | 1913 |
| 436 | Ga0316576_10657081 | 3300031727 | Unclassified | 762 |
| 437 | Ga0307405_10621681 | 3300031731 | Unclassified | 884 |
| 438 | Ga0307406_10142112 | 3300031901 | Unclassified | 1700 |
| 439 | Ga0307412_10249621 | 3300031911 | Bacteria | 1377 |
| 440 | Ga0307415_100047187 | 3300032126 | Bacteria | 2899 |
| 441 | Ga0307415_100683764 | 3300032126 | Bacteria | 924 |
| 442 | Ga0307507_10342761 | 3300033179 | Bacteria | 884 |
| 443 | Ga0307507_10546470 | 3300033179 | Bacteria | 612 |
| 444 | Ga0373950_0000015 | 3300034818 | Bacteria | 281101 |
| 445 | Ga0373950_0000106 | 3300034818 | Bacteria | 18811 |
| 446 | Ga0373944_0254710 | 3300035089 | Unclassified | 649 |
| 447 | Ga0373949_0000228 | 3300035090 | Bacteria | 21254 |
| 448 | Ga0373923_0195783 | 3300035111 | Bacteria | 933 |
| 449 | Ga0373923_0302451 | 3300035111 | Bacteria | 757 |
| 450 | Ga0373936_0000009 | 3300035113 | Bacteria | 263478 |
| 451 | Ga0373941_0047170 | 3300035115 | Bacteria | 1356 |
| 452 | Ga0373941_0301582 | 3300035115 | Unclassified | 640 |
| 453 | Ga0373945_0012235 | 3300035116 | Bacteria | 2847 |
| 454 | Ga0373953_0050652 | 3300035117 | Bacteria | 1678 |
| 455 | Ga0373954_0027481 | 3300035118 | Bacteria | 2612 |
| 456 | Ga0373954_0248140 | 3300035118 | Unclassified | 876 |
| 457 | Ga0373954_0565668 | 3300035118 | Bacteria | 563 |
| 458 | Ga0373956_0054854 | 3300035119 | Bacteria | 1797 |
| 459 | Ga0373956_0096269 | 3300035119 | Bacteria | 1369 |
| 460 | Ga0373957_0012584 | 3300035120 | Bacteria | 2853 |
| 461 | Ga0373957_0015579 | 3300035120 | Bacteria | 2619 |
| 462 | Ga0373957_0038128 | 3300035120 | Bacteria | 1798 |
| 463 | Ga0373946_0521887 | 3300035171 | Bacteria | 611 |
| 464 | Ga0373955_0045088 | 3300035172 | Bacteria | 2378 |
| 465 | Ga0373955_0093032 | 3300035172 | Bacteria | 1721 |
| 466 | Ga0373955_0200800 | 3300035172 | Bacteria | 1187 |
| 467 | Ga0373955_0234302 | 3300035172 | Bacteria | 1099 |
| 468 | Ga0373961_0000132 | 3300035241 | Bacteria | 38247 |
| 469 | Ga0373933_0000801 | 3300035724 | Bacteria | 19152 |
| 470 | Ga0373933_0045864 | 3300035724 | Bacteria | 2593 |
| 471 | Ga0373933_0191542 | 3300035724 | Bacteria | 1306 |
| 472 | Ga0373933_0382750 | 3300035724 | Bacteria | 916 |
| 473 | Ga0373947_0068533 | 3300035725 | Bacteria | 2170 |
| 474 | Ga0373947_1028996 | 3300035725 | Bacteria | 562 |
| 475 | Ga0373937_0007263 | 3300036401 | Bacteria | 9589 |
| 476 | Ga0373937_0007632 | 3300036401 | Bacteria | 9371 |
| 477 | Ga0373937_0182473 | 3300036401 | Bacteria | 1971 |
| 478 | Ga0373937_0248621 | 3300036401 | Bacteria | 1676 |
| 479 | Ga0373937_0643620 | 3300036401 | Bacteria | 1005 |
| 480 | Ga0316582_0067751 | 3300036647 | Unclassified | 2304 |
| 481 | Ga0316584_0000106 | 3300036712 | Bacteria | 34818 |
| 482 | Ga0373925_0065036 | 3300037068 | Bacteria | 2747 |
| 483 | Ga0373925_0188831 | 3300037068 | Bacteria | 1634 |
| 484 | Ga0395899_0010235 | 3300037312 | Bacteria | 7186 |
| 485 | Ga0395899_0192670 | 3300037312 | Unclassified | 1426 |
| 486 | Ga0395900_0612644 | 3300037418 | Bacteria | 1028 |
| 487 | Ga0395900_0756919 | 3300037418 | Unclassified | 901 |
| 488 | Ga0395898_0082216 | 3300037466 | Bacteria | 3105 |
| 489 | Ga0395898_0964670 | 3300037466 | Unclassified | 789 |
| 490 | Ga0395905_0449008 | 3300037471 | Bacteria | 1187 |
| 491 | Ga0395905_0902289 | 3300037471 | Bacteria | 787 |
| 492 | Ga0395901_0206849 | 3300038443 | Bacteria | 2055 |
| 493 | Ga0436365_1570115 | 3300039437 | Unclassified | 1638 |
| 494 | Ga0436363_0344008 | 3300039450 | Bacteria | 1464 |
| 495 | Ga0451787_397521 | 3300041441 | Unclassified | 747 |
| 496 | Ga0451793_1704137 | 3300041452 | Unclassified | 932 |
| 497 | Ga0451797_0791634 | 3300041453 | Bacteria | 665 |
| 498 | Ga0451802_0260369 | 3300041460 | Bacteria | 1774 |
| 499 | Ga0451804_1020604 | 3300041463 | Unclassified | 535 |
| 500 | Ga0451807_2163525 | 3300041486 | Bacteria | 803 |
| 501 | Ga0451853_1406462 | 3300041512 | Unclassified | 1043 |
| 502 | Ga0451853_3702505 | 3300041512 | Unclassified | 642 |
| 503 | Ga0451577_0028182 | 3300042876 | Bacteria | 5081 |
| 504 | Ga0451577_0452357 | 3300042876 | Bacteria | 1166 |
| 505 | Ga0466972_0124667 | 3300044658 | Bacteria | 1214 |
| 506 | Ga0453684_0000078 | 3300044712 | Bacteria | 428794 |
| 507 | Ga0453684_0050881 | 3300044712 | Bacteria | 5441 |
| 508 | Ga0453684_0189167 | 3300044712 | Bacteria | 2409 |
| 509 | Ga0453684_0339694 | 3300044712 | Unclassified | 1696 |
| 510 | Ga0453684_0654278 | 3300044712 | Unclassified | 1146 |
| 511 | Ga0466957_0307876 | 3300044842 | Bacteria | 1066 |
| 512 | Ga0451576_0155695 | 3300045051 | Bacteria | 2384 |
| 513 | Ga0451576_1592132 | 3300045051 | Unclassified | 678 |
| 514 | Ga0466967_0371022 | 3300045976 | Bacteria | 1388 |
| 515 | Ga0466967_1058577 | 3300045976 | Bacteria | 808 |
| 516 | Ga0495590_0033611 | 3300046457 | Unclassified | 1793 |
| 517 | Ga0495651_0045584 | 3300046462 | Bacteria | 3397 |
| 518 | Ga0495582_0696781 | 3300046473 | Bacteria | 588 |
| 519 | Ga0495662_0337042 | 3300046476 | Unclassified | 741 |
| 520 | Ga0495664_0739567 | 3300046477 | Bacteria | 580 |
| 521 | Ga0495628_0120726 | 3300046516 | Bacteria | 2011 |
| 522 | Ga0495630_0004817 | 3300046517 | Bacteria | 9465 |
| 523 | Ga0495652_0436993 | 3300046529 | Bacteria | 919 |
| 524 | Ga0495586_0657002 | 3300046535 | Unclassified | 606 |
| 525 | Ga0495587_0212397 | 3300046536 | Bacteria | 1092 |
| 526 | Ga0495622_0164321 | 3300046557 | Bacteria | 1000 |
| 527 | Ga0495634_0002302 | 3300046642 | Bacteria | 15979 |
| 528 | Ga0495634_0491710 | 3300046642 | Unclassified | 720 |
| 529 | Ga0495657_0160202 | 3300046675 | Bacteria | 1393 |
| 530 | Ga0495623_0094467 | 3300046679 | Bacteria | 1829 |
| 531 | Ga0495674_0017181 | 3300047319 | Bacteria | 6735 |
| 532 | Ga0495684_0311672 | 3300047471 | Bacteria | 1128 |
| 533 | Ga0495686_0039813 | 3300047472 | Bacteria | 3000 |
| 534 | Ga0495686_0093671 | 3300047472 | Bacteria | 1821 |
| 535 | Ga0496101_0198767 | 3300048904 | Unclassified | 1549 |
| 536 | Ga0496104_0033434 | 3300048907 | Bacteria | 4790 |
| 537 | Ga0496104_0264217 | 3300048907 | Bacteria | 1633 |
| 538 | Ga0496105_1196353 | 3300048908 | Unclassified | 560 |
| 539 | Ga0496106_0537971 | 3300048909 | Unclassified | 938 |
| 540 | Ga0496107_0053616 | 3300048910 | Bacteria | 2909 |
| 541 | Ga0496108_0046394 | 3300048911 | Bacteria | 3630 |
| 542 | Ga0496109_0218006 | 3300048912 | Bacteria | 1795 |
| 543 | Ga0496109_0380206 | 3300048912 | Bacteria | 1334 |
| 544 | Ga0496110_0828207 | 3300048913 | Unclassified | 830 |
| 545 | Ga0496111_0753002 | 3300048914 | Unclassified | 707 |
| 546 | Ga0496112_0211733 | 3300048915 | Bacteria | 1895 |
| 547 | Ga0496114_0002777 | 3300048917 | Bacteria | 13405 |
| 548 | Ga0496114_0019436 | 3300048917 | Bacteria | 5503 |
| 549 | Ga0496114_0059321 | 3300048917 | Bacteria | 3196 |
| 550 | Ga0496114_0077206 | 3300048917 | Bacteria | 2808 |
| 551 | Ga0496114_0106945 | 3300048917 | Bacteria | 2394 |
| 552 | Ga0496114_0404011 | 3300048917 | Bacteria | 1210 |
| 553 | Ga0496114_0899780 | 3300048917 | Bacteria | 766 |
| 554 | Ga0496115_0006149 | 3300048918 | Bacteria | 8781 |
| 555 | Ga0496115_0135818 | 3300048918 | Bacteria | 2028 |
| 556 | Ga0501290_047341 | 3300049513 | Unclassified | 661 |
| 557 | Ga0501292_042245 | 3300049515 | Bacteria | 790 |
| 558 | Ga0501034_0000327 | 3300049571 | Bacteria | 83596 |
| 559 | Ga0501034_0111981 | 3300049571 | Unclassified | 2720 |
| 560 | Ga0501036_0182698 | 3300049572 | Bacteria | 1765 |
| 561 | Ga0501038_0201690 | 3300049574 | Bacteria | 1596 |
| 562 | Ga0501042_0665344 | 3300049578 | Bacteria | 757 |
| 563 | Ga0501043_0000408 | 3300049579 | Bacteria | 38659 |
| 564 | Ga0501043_0373850 | 3300049579 | Unclassified | 1080 |
| 565 | Ga0501046_0000438 | 3300049580 | Bacteria | 41879 |
| 566 | Ga0501046_0404525 | 3300049580 | Bacteria | 986 |
| 567 | Ga0501047_0000008 | 3300049581 | Bacteria | 441758 |
| 568 | Ga0501047_0012216 | 3300049581 | Bacteria | 8131 |
| 569 | Ga0501047_0109014 | 3300049581 | Archaea | 2651 |
| 570 | Ga0501048_0063453 | 3300049582 | Archaea | 2613 |
| 571 | Ga0501067_0000030 | 3300049583 | Bacteria | 87924 |
| 572 | Ga0501067_0083379 | 3300049583 | Unclassified | 1773 |
| 573 | Ga0501068_0007147 | 3300049584 | Bacteria | 6180 |
| 574 | Ga0501068_0044351 | 3300049584 | Unclassified | 2678 |
| 575 | Ga0501068_0731906 | 3300049584 | Unclassified | 647 |
| 576 | Ga0501069_0003625 | 3300049585 | Bacteria | 7949 |
| 577 | Ga0501069_0032569 | 3300049585 | Bacteria | 2869 |
| 578 | Ga0501069_0085107 | 3300049585 | Bacteria | 1784 |
| 579 | Ga0501070_0001091 | 3300049586 | Bacteria | 24388 |
| 580 | Ga0501070_0008109 | 3300049586 | Bacteria | 8890 |
| 581 | Ga0501070_0034368 | 3300049586 | Bacteria | 4239 |
| 582 | Ga0501070_0124778 | 3300049586 | Unclassified | 2128 |
| 583 | Ga0501070_1166252 | 3300049586 | Bacteria | 592 |
| 584 | Ga0501071_0734071 | 3300049587 | Unclassified | 761 |
| 585 | Ga0501072_0000023 | 3300049588 | Bacteria | 149177 |
| 586 | Ga0501072_0159228 | 3300049588 | Unclassified | 1801 |
| 587 | Ga0501073_0000481 | 3300049589 | Bacteria | 27721 |
| 588 | Ga0501073_0000498 | 3300049589 | Bacteria | 27426 |
| 589 | Ga0501073_0000767 | 3300049589 | Bacteria | 22755 |
| 590 | Ga0501073_0104657 | 3300049589 | Bacteria | 1964 |
| 591 | Ga0501073_0284111 | 3300049589 | Unclassified | 1142 |
| 592 | Ga0501074_0000439 | 3300049590 | Bacteria | 24841 |
| 593 | Ga0501074_0027466 | 3300049590 | Bacteria | 4127 |
| 594 | Ga0501076_0805907 | 3300049592 | Bacteria | 775 |
| 595 | Ga0501208_052022 | 3300049655 | Unclassified | 783 |
| 596 | Ga0501216_001541 | 3300049660 | Bacteria | 3129 |
| 597 | Ga0501227_000349 | 3300049665 | Bacteria | 9774 |
| 598 | Ga0501227_002080 | 3300049665 | Bacteria | 4435 |
| 599 | Ga0501230_000461 | 3300049667 | Bacteria | 4023 |
| 600 | Ga0501233_004596 | 3300049668 | Bacteria | 2537 |
| 601 | Ga0501235_019594 | 3300049669 | Bacteria | 1501 |
| 602 | Ga0501260_021073 | 3300049689 | Unclassified | 707 |
| 603 | Ga0501219_015625 | 3300049703 | Unclassified | 616 |
| 604 | Ga0501079_0000031 | 3300049741 | Bacteria | 59419 |
| 605 | Ga0501079_0216961 | 3300049741 | Bacteria | 1494 |
| 606 | Ga0501080_0007570 | 3300049742 | Bacteria | 9816 |
| 607 | Ga0501080_0146816 | 3300049742 | Bacteria | 2180 |
| 608 | Ga0501080_0347191 | 3300049742 | Unclassified | 1340 |
| 609 | Ga0501080_0623077 | 3300049742 | Bacteria | 956 |
| 610 | Ga0501081_0064363 | 3300049743 | Bacteria | 2547 |
| 611 | Ga0501083_0001622 | 3300049744 | Bacteria | 15387 |
| 612 | Ga0501083_0004836 | 3300049744 | Bacteria | 9519 |
| 613 | Ga0501083_0075030 | 3300049744 | Bacteria | 2246 |
| 614 | Ga0501083_0130591 | 3300049744 | Unclassified | 1646 |
| 615 | Ga0501267_004923 | 3300049764 | Bacteria | 1253 |
| 616 | Ga0501035_0042339 | 3300049822 | Bacteria | 4108 |
| 617 | Ga0501044_0049920 | 3300049823 | Bacteria | 4318 |
| 618 | Ga0501220_03393 | 3300049852 | Unclassified | 697 |
| 619 | nmdc:mga03683_345097_c1 | 3300050489 | Bacteria | 704 |
| 620 | nmdc:mga03n38_406597_c1 | 3300050490 | Bacteria | 750 |
| 621 | nmdc:mga05p37_1479769_c1 | 3300050507 | Bacteria | 678 |
| 622 | nmdc:mga05p37_189987_c1 | 3300050507 | Bacteria | 2494 |
| 623 | nmdc:mga09592_3157_c1 | 3300050508 | Bacteria | 13383 |
| 624 | nmdc:mga09592_96549_c1 | 3300050508 | Bacteria | 2528 |
| 625 | nmdc:mga0qj67_144070_c1 | 3300050509 | Bacteria | 1932 |
| 626 | nmdc:mga0qj67_415754_c1 | 3300050509 | Bacteria | 1084 |
| 627 | nmdc:mga0qj67_896508_c1 | 3300050509 | Unclassified | 699 |
| 628 | nmdc:mga08y16_169856_c1 | 3300050511 | Bacteria | 2265 |
| 629 | nmdc:mga08y16_5330_c1 | 3300050511 | Bacteria | 13455 |
| 630 | nmdc:mga08y16_596202_c1 | 3300050511 | Bacteria | 1114 |
| 631 | nmdc:mga08y16_656791_c1 | 3300050511 | Bacteria | 1052 |
| 632 | nmdc:mga08y16_79762_c1 | 3300050511 | Bacteria | 3412 |
| 633 | nmdc:mga08y16_901610_c1 | 3300050511 | Bacteria | 870 |
| 634 | nmdc:mga08y16_941975_c1 | 3300050511 | Unclassified | 847 |
| 635 | nmdc:mga0n895_1090206_c1 | 3300050512 | Bacteria | 776 |
| 636 | nmdc:mga0rr50_214103_c1 | 3300050513 | Unclassified | 1588 |
| 637 | nmdc:mga0rr50_367047_c1 | 3300050513 | Bacteria | 1212 |
| 638 | Ga0500635_0012695 | 3300053080 | Bacteria | 2427 |
| 639 | Ga0495619_0057969 | 3300053085 | Bacteria | 2570 |
| 640 | Ga0500578_0195725 | 3300053086 | Bacteria | 1239 |
| 641 | Ga0500646_0038137 | 3300053090 | Bacteria | 1344 |
| 642 | Ga0500583_0168375 | 3300053092 | Unclassified | 1091 |
| 643 | Ga0500566_0000983 | 3300053094 | Bacteria | 16425 |
| 644 | Ga0500566_0011880 | 3300053094 | Bacteria | 5128 |
| 645 | Ga0500640_001204 | 3300053095 | Bacteria | 7593 |
| 646 | Ga0500554_000512 | 3300053102 | Bacteria | 8072 |
| 647 | Ga0500594_0055888 | 3300053118 | Bacteria | 1124 |
| 648 | Ga0500595_000017 | 3300053119 | Bacteria | 206032 |
| 649 | Ga0500597_074498 | 3300053120 | Bacteria | 1469 |
| 650 | Ga0500597_265858 | 3300053120 | Bacteria | 696 |
| 651 | Ga0500607_174195 | 3300053121 | Bacteria | 964 |
| 652 | Ga0500614_002961 | 3300053123 | Bacteria | 3707 |
| 653 | Ga0500614_035288 | 3300053123 | Bacteria | 1245 |
| 654 | Ga0500642_0020210 | 3300053130 | Bacteria | 2613 |
| 655 | Ga0500642_0139687 | 3300053130 | Bacteria | 1136 |
| 656 | Ga0500559_0006312 | 3300053136 | Bacteria | 5357 |
| 657 | Ga0500568_0107481 | 3300053139 | Bacteria | 1044 |
| 658 | Ga0500585_060518 | 3300053144 | Bacteria | 1362 |
| 659 | Ga0500619_022090 | 3300053154 | Unclassified | 1843 |
| 660 | Ga0500627_0258592 | 3300053158 | Bacteria | 769 |
| 661 | Ga0500639_131510 | 3300053163 | Bacteria | 1185 |
| 662 | Ga0500636_0216542 | 3300053177 | Bacteria | 1001 |
| 663 | Ga0500636_0216971 | 3300053177 | Bacteria | 1000 |
| 664 | Ga0501084_0000002 | 3300054114 | Bacteria | 273420 |
| 665 | Ga0501084_0108988 | 3300054114 | Bacteria | 2327 |
| 666 | Ga0501084_0784512 | 3300054114 | Bacteria | 803 |
| 667 | Ga0501082_0009842 | 3300060353 | Bacteria | 8237 |
| 668 | Ga0501082_0045856 | 3300060353 | Bacteria | 3769 |
| 669 | Ga0501082_0221171 | 3300060353 | Bacteria | 1647 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041463 | Ga0451804_1020604 | Ga0451804_1020604_11_478 | 155 |
| 2 | 3300005340 | Ga0070689_100000018 | Ga0070689_10000001825 | 161 |
| 3 | 3300025936 | Ga0207670_10000001 | Ga0207670_1000000125 | 161 |
| 4 | 3300009147 | Ga0114129_10913190 | Ga0114129_109131901 | 162 |
| 5 | 3300005340 | Ga0070689_100354370 | Ga0070689_1003543702 | 163 |
| 6 | 3300005539 | Ga0068853_100018010 | Ga0068853_1000180103 | 163 |
| 7 | 3300005544 | Ga0070686_100066079 | Ga0070686_1000660794 | 163 |
| 8 | 3300005563 | Ga0068855_100044129 | Ga0068855_1000441297 | 163 |
| 9 | 3300005617 | Ga0068859_100003886 | Ga0068859_1000038865 | 163 |
| 10 | 3300005843 | Ga0068860_100331999 | Ga0068860_1003319992 | 163 |
| 11 | 3300005843 | Ga0068860_100829599 | Ga0068860_1008295992 | 163 |
| 12 | 3300006931 | Ga0097620_100003886 | Ga0097620_10000388612 | 163 |
| 13 | 3300009551 | Ga0105238_10008178 | Ga0105238_100081784 | 163 |
| 14 | 3300009551 | Ga0105238_10020007 | Ga0105238_100200077 | 163 |
| 15 | 3300013297 | Ga0157378_11099223 | Ga0157378_110992232 | 163 |
| 16 | 3300025924 | Ga0207694_10010604 | Ga0207694_100106046 | 163 |
| 17 | 3300025924 | Ga0207694_10013117 | Ga0207694_100131177 | 163 |
| 18 | 3300025949 | Ga0207667_10231031 | Ga0207667_102310314 | 163 |
| 19 | 3300026041 | Ga0207639_10017468 | Ga0207639_100174683 | 163 |
| 20 | 3300026116 | Ga0207674_10156323 | Ga0207674_101563232 | 163 |
| 21 | 3300028381 | Ga0268264_10632660 | Ga0268264_106326602 | 163 |
| 22 | 3300028563 | Ga0265319_1051690 | Ga0265319_10516901 | 163 |
| 23 | 3300031712 | Ga0265342_10189915 | Ga0265342_101899152 | 163 |
| 24 | 3300005327 | Ga0070658_10004177 | Ga0070658_100041772 | 164 |
| 25 | 3300005336 | Ga0070680_100739847 | Ga0070680_1007398472 | 164 |
| 26 | 3300005337 | Ga0070682_100045975 | Ga0070682_1000459752 | 164 |
| 27 | 3300005339 | Ga0070660_100417576 | Ga0070660_1004175762 | 164 |
| 28 | 3300005366 | Ga0070659_101230173 | Ga0070659_1012301731 | 164 |
| 29 | 3300005458 | Ga0070681_10034342 | Ga0070681_100343422 | 164 |
| 30 | 3300005530 | Ga0070679_100045791 | Ga0070679_1000457912 | 164 |
| 31 | 3300005563 | Ga0068855_100099652 | Ga0068855_1000996522 | 164 |
| 32 | 3300005578 | Ga0068854_100925076 | Ga0068854_1009250762 | 164 |
| 33 | 3300009093 | Ga0105240_10004581 | Ga0105240_100045812 | 164 |
| 34 | 3300009147 | Ga0114129_10622251 | Ga0114129_106222512 | 164 |
| 35 | 3300009545 | Ga0105237_10000014 | Ga0105237_1000001492 | 164 |
| 36 | 3300010375 | Ga0105239_10077252 | Ga0105239_100772522 | 164 |
| 37 | 3300025909 | Ga0207705_10001999 | Ga0207705_100019992 | 164 |
| 38 | 3300025912 | Ga0207707_10107531 | Ga0207707_101075313 | 164 |
| 39 | 3300025913 | Ga0207695_10003405 | Ga0207695_1000340515 | 164 |
| 40 | 3300025914 | Ga0207671_10000270 | Ga0207671_1000027040 | 164 |
| 41 | 3300025917 | Ga0207660_10023885 | Ga0207660_100238852 | 164 |
| 42 | 3300025917 | Ga0207660_10212875 | Ga0207660_102128752 | 164 |
| 43 | 3300025921 | Ga0207652_10004517 | Ga0207652_100045172 | 164 |
| 44 | 3300025921 | Ga0207652_10067593 | Ga0207652_100675932 | 164 |
| 45 | 3300025932 | Ga0207690_10336187 | Ga0207690_103361871 | 164 |
| 46 | 3300025949 | Ga0207667_10127810 | Ga0207667_101278102 | 164 |
| 47 | 3300025981 | Ga0207640_10290875 | Ga0207640_102908751 | 164 |
| 48 | 3300026116 | Ga0207674_10202300 | Ga0207674_102023003 | 164 |
| 49 | 3300041512 | Ga0451853_1406462 | Ga0451853_1406462_290_805 | 164 |
| 50 | 3300003323 | rootH1_10113803 | rootH1_101138035 | 170 |
| 51 | 3300003323 | rootH1_10113805 | rootH1_101138054 | 170 |
| 52 | 3300005295 | Ga0065707_10571873 | Ga0065707_105718731 | 170 |
| 53 | 3300005327 | Ga0070658_10250431 | Ga0070658_102504313 | 170 |
| 54 | 3300005327 | Ga0070658_10652810 | Ga0070658_106528102 | 170 |
| 55 | 3300005327 | Ga0070658_11012103 | Ga0070658_110121031 | 170 |
| 56 | 3300005329 | Ga0070683_100001809 | Ga0070683_1000018093 | 170 |
| 57 | 3300005329 | Ga0070683_100136278 | Ga0070683_1001362782 | 170 |
| 58 | 3300005329 | Ga0070683_100289120 | Ga0070683_1002891202 | 170 |
| 59 | 3300005329 | Ga0070683_100567100 | Ga0070683_1005671002 | 170 |
| 60 | 3300005330 | Ga0070690_100030672 | Ga0070690_1000306721 | 170 |
| 61 | 3300005330 | Ga0070690_100050166 | Ga0070690_1000501664 | 170 |
| 62 | 3300005331 | Ga0070670_100007137 | Ga0070670_10000713711 | 170 |
| 63 | 3300005334 | Ga0068869_100417443 | Ga0068869_1004174432 | 170 |
| 64 | 3300005335 | Ga0070666_10087093 | Ga0070666_100870934 | 170 |
| 65 | 3300005336 | Ga0070680_100073940 | Ga0070680_1000739401 | 170 |
| 66 | 3300005337 | Ga0070682_100107781 | Ga0070682_1001077813 | 170 |
| 67 | 3300005337 | Ga0070682_101553339 | Ga0070682_1015533391 | 170 |
| 68 | 3300005338 | Ga0068868_100585841 | Ga0068868_1005858412 | 170 |
| 69 | 3300005338 | Ga0068868_100989746 | Ga0068868_1009897461 | 170 |
| 70 | 3300005340 | Ga0070689_100064580 | Ga0070689_1000645801 | 170 |
| 71 | 3300005340 | Ga0070689_100367332 | Ga0070689_1003673321 | 170 |
| 72 | 3300005340 | Ga0070689_100405936 | Ga0070689_1004059362 | 170 |
| 73 | 3300005343 | Ga0070687_100000438 | Ga0070687_10000043813 | 170 |
| 74 | 3300005343 | Ga0070687_100048081 | Ga0070687_1000480812 | 170 |
| 75 | 3300005343 | Ga0070687_100359932 | Ga0070687_1003599322 | 170 |
| 76 | 3300005345 | Ga0070692_10188933 | Ga0070692_101889332 | 170 |
| 77 | 3300005347 | Ga0070668_100251626 | Ga0070668_1002516262 | 170 |
| 78 | 3300005354 | Ga0070675_100110103 | Ga0070675_1001101034 | 170 |
| 79 | 3300005354 | Ga0070675_100273051 | Ga0070675_1002730513 | 170 |
| 80 | 3300005354 | Ga0070675_101450756 | Ga0070675_1014507561 | 170 |
| 81 | 3300005355 | Ga0070671_100186601 | Ga0070671_1001866012 | 170 |
| 82 | 3300005364 | Ga0070673_100547232 | Ga0070673_1005472322 | 170 |
| 83 | 3300005365 | Ga0070688_100006544 | Ga0070688_1000065447 | 170 |
| 84 | 3300005365 | Ga0070688_100092787 | Ga0070688_1000927874 | 170 |
| 85 | 3300005365 | Ga0070688_100143873 | Ga0070688_1001438732 | 170 |
| 86 | 3300005365 | Ga0070688_100277030 | Ga0070688_1002770302 | 170 |
| 87 | 3300005366 | Ga0070659_100078159 | Ga0070659_1000781593 | 170 |
| 88 | 3300005366 | Ga0070659_101164292 | Ga0070659_1011642921 | 170 |
| 89 | 3300005434 | Ga0070709_10346747 | Ga0070709_103467472 | 170 |
| 90 | 3300005434 | Ga0070709_10387247 | Ga0070709_103872472 | 170 |
| 91 | 3300005438 | Ga0070701_10164240 | Ga0070701_101642401 | 170 |
| 92 | 3300005439 | Ga0070711_100853679 | Ga0070711_1008536791 | 170 |
| 93 | 3300005440 | Ga0070705_100269681 | Ga0070705_1002696812 | 170 |
| 94 | 3300005441 | Ga0070700_100256787 | Ga0070700_1002567871 | 170 |
| 95 | 3300005444 | Ga0070694_100137900 | Ga0070694_1001379002 | 170 |
| 96 | 3300005444 | Ga0070694_100621798 | Ga0070694_1006217982 | 170 |
| 97 | 3300005445 | Ga0070708_100233490 | Ga0070708_1002334903 | 170 |
| 98 | 3300005456 | Ga0070678_100048916 | Ga0070678_1000489164 | 170 |
| 99 | 3300005456 | Ga0070678_100312593 | Ga0070678_1003125933 | 170 |
| 100 | 3300005458 | Ga0070681_10120316 | Ga0070681_101203162 | 170 |
| 101 | 3300005458 | Ga0070681_10316519 | Ga0070681_103165192 | 170 |
| 102 | 3300005466 | Ga0070685_10020753 | Ga0070685_100207536 | 170 |
| 103 | 3300005468 | Ga0070707_101116055 | Ga0070707_1011160551 | 170 |
| 104 | 3300005471 | Ga0070698_100004067 | Ga0070698_10000406717 | 170 |
| 105 | 3300005471 | Ga0070698_100015147 | Ga0070698_1000151473 | 170 |
| 106 | 3300005471 | Ga0070698_100742138 | Ga0070698_1007421382 | 170 |
| 107 | 3300005530 | Ga0070679_100002586 | Ga0070679_1000025866 | 170 |
| 108 | 3300005530 | Ga0070679_100002759 | Ga0070679_1000027593 | 170 |
| 109 | 3300005530 | Ga0070679_100389001 | Ga0070679_1003890012 | 170 |
| 110 | 3300005530 | Ga0070679_100765132 | Ga0070679_1007651322 | 170 |
| 111 | 3300005535 | Ga0070684_100064203 | Ga0070684_1000642034 | 170 |
| 112 | 3300005535 | Ga0070684_100955125 | Ga0070684_1009551251 | 170 |
| 113 | 3300005543 | Ga0070672_100050698 | Ga0070672_1000506984 | 170 |
| 114 | 3300005543 | Ga0070672_100220740 | Ga0070672_1002207402 | 170 |
| 115 | 3300005543 | Ga0070672_100434671 | Ga0070672_1004346712 | 170 |
| 116 | 3300005544 | Ga0070686_100451044 | Ga0070686_1004510441 | 170 |
| 117 | 3300005547 | Ga0070693_100310212 | Ga0070693_1003102122 | 170 |
| 118 | 3300005548 | Ga0070665_100005092 | Ga0070665_1000050924 | 170 |
| 119 | 3300005548 | Ga0070665_100360029 | Ga0070665_1003600291 | 170 |
| 120 | 3300005548 | Ga0070665_100839713 | Ga0070665_1008397133 | 170 |
| 121 | 3300005548 | Ga0070665_100890438 | Ga0070665_1008904381 | 170 |
| 122 | 3300005549 | Ga0070704_100155710 | Ga0070704_1001557103 | 170 |
| 123 | 3300005549 | Ga0070704_100422311 | Ga0070704_1004223111 | 170 |
| 124 | 3300005549 | Ga0070704_101210924 | Ga0070704_1012109241 | 170 |
| 125 | 3300005549 | Ga0070704_101486948 | Ga0070704_1014869481 | 170 |
| 126 | 3300005563 | Ga0068855_100042142 | Ga0068855_1000421423 | 170 |
| 127 | 3300005563 | Ga0068855_100396082 | Ga0068855_1003960822 | 170 |
| 128 | 3300005563 | Ga0068855_100854693 | Ga0068855_1008546931 | 170 |
| 129 | 3300005577 | Ga0068857_101110367 | Ga0068857_1011103671 | 170 |
| 130 | 3300005614 | Ga0068856_100071957 | Ga0068856_1000719572 | 170 |
| 131 | 3300005614 | Ga0068856_100099460 | Ga0068856_1000994602 | 170 |
| 132 | 3300005614 | Ga0068856_100266013 | Ga0068856_1002660132 | 170 |
| 133 | 3300005615 | Ga0070702_100144811 | Ga0070702_1001448112 | 170 |
| 134 | 3300005615 | Ga0070702_100451483 | Ga0070702_1004514831 | 170 |
| 135 | 3300005616 | Ga0068852_100100836 | Ga0068852_1001008362 | 170 |
| 136 | 3300005616 | Ga0068852_100128954 | Ga0068852_1001289542 | 170 |
| 137 | 3300005617 | Ga0068859_100145292 | Ga0068859_1001452924 | 170 |
| 138 | 3300005617 | Ga0068859_100478174 | Ga0068859_1004781743 | 170 |
| 139 | 3300005617 | Ga0068859_101510063 | Ga0068859_1015100632 | 170 |
| 140 | 3300005618 | Ga0068864_100285349 | Ga0068864_1002853492 | 170 |
| 141 | 3300005618 | Ga0068864_101321523 | Ga0068864_1013215231 | 170 |
| 142 | 3300005718 | Ga0068866_10068111 | Ga0068866_100681113 | 170 |
| 143 | 3300005718 | Ga0068866_10234842 | Ga0068866_102348422 | 170 |
| 144 | 3300005719 | Ga0068861_100047232 | Ga0068861_1000472322 | 170 |
| 145 | 3300005841 | Ga0068863_100110103 | Ga0068863_1001101032 | 170 |
| 146 | 3300005842 | Ga0068858_100061393 | Ga0068858_1000613932 | 170 |
| 147 | 3300005844 | Ga0068862_100127217 | Ga0068862_1001272172 | 170 |
| 148 | 3300005844 | Ga0068862_100897036 | Ga0068862_1008970362 | 170 |
| 149 | 3300005937 | Ga0081455_10057468 | Ga0081455_100574682 | 170 |
| 150 | 3300005981 | Ga0081538_10218608 | Ga0081538_102186082 | 170 |
| 151 | 3300005981 | Ga0081538_10236316 | Ga0081538_102363162 | 170 |
| 152 | 3300006028 | Ga0070717_10044568 | Ga0070717_100445682 | 170 |
| 153 | 3300006028 | Ga0070717_10047790 | Ga0070717_100477904 | 170 |
| 154 | 3300006173 | Ga0070716_100027828 | Ga0070716_1000278284 | 170 |
| 155 | 3300006175 | Ga0070712_100664917 | Ga0070712_1006649171 | 170 |
| 156 | 3300006237 | Ga0097621_100224434 | Ga0097621_1002244342 | 170 |
| 157 | 3300006237 | Ga0097621_100290742 | Ga0097621_1002907422 | 170 |
| 158 | 3300006237 | Ga0097621_100329530 | Ga0097621_1003295302 | 170 |
| 159 | 3300006237 | Ga0097621_100391454 | Ga0097621_1003914542 | 170 |
| 160 | 3300006358 | Ga0068871_100862035 | Ga0068871_1008620352 | 170 |
| 161 | 3300006846 | Ga0075430_100069851 | Ga0075430_1000698514 | 170 |
| 162 | 3300006846 | Ga0075430_100724475 | Ga0075430_1007244751 | 170 |
| 163 | 3300006852 | Ga0075433_11192576 | Ga0075433_111925761 | 170 |
| 164 | 3300006880 | Ga0075429_100002168 | Ga0075429_10000216816 | 170 |
| 165 | 3300006880 | Ga0075429_100053377 | Ga0075429_1000533773 | 170 |
| 166 | 3300006880 | Ga0075429_100548929 | Ga0075429_1005489292 | 170 |
| 167 | 3300006881 | Ga0068865_100004469 | Ga0068865_1000044698 | 170 |
| 168 | 3300006881 | Ga0068865_100162886 | Ga0068865_1001628862 | 170 |
| 169 | 3300006931 | Ga0097620_100145283 | Ga0097620_1001452834 | 170 |
| 170 | 3300006931 | Ga0097620_100478205 | Ga0097620_1004782053 | 170 |
| 171 | 3300006931 | Ga0097620_101510074 | Ga0097620_1015100742 | 170 |
| 172 | 3300007076 | Ga0075435_100349275 | Ga0075435_1003492752 | 170 |
| 173 | 3300009093 | Ga0105240_10736817 | Ga0105240_107368171 | 170 |
| 174 | 3300009094 | Ga0111539_10041391 | Ga0111539_100413914 | 170 |
| 175 | 3300009094 | Ga0111539_10118985 | Ga0111539_101189852 | 170 |
| 176 | 3300009094 | Ga0111539_10268651 | Ga0111539_102686512 | 170 |
| 177 | 3300009094 | Ga0111539_10873641 | Ga0111539_108736412 | 170 |
| 178 | 3300009094 | Ga0111539_11170879 | Ga0111539_111708792 | 170 |
| 179 | 3300009098 | Ga0105245_10000072 | Ga0105245_1000007229 | 170 |
| 180 | 3300009098 | Ga0105245_10752747 | Ga0105245_107527472 | 170 |
| 181 | 3300009098 | Ga0105245_11278919 | Ga0105245_112789191 | 170 |
| 182 | 3300009147 | Ga0114129_10174875 | Ga0114129_101748755 | 170 |
| 183 | 3300009147 | Ga0114129_11109646 | Ga0114129_111096462 | 170 |
| 184 | 3300009148 | Ga0105243_10436838 | Ga0105243_104368382 | 170 |
| 185 | 3300009148 | Ga0105243_10714723 | Ga0105243_107147232 | 170 |
| 186 | 3300009174 | Ga0105241_10666874 | Ga0105241_106668741 | 170 |
| 187 | 3300009174 | Ga0105241_11491943 | Ga0105241_114919431 | 170 |
| 188 | 3300009176 | Ga0105242_10410989 | Ga0105242_104109891 | 170 |
| 189 | 3300009176 | Ga0105242_10721372 | Ga0105242_107213721 | 170 |
| 190 | 3300009177 | Ga0105248_11157124 | Ga0105248_111571242 | 170 |
| 191 | 3300009545 | Ga0105237_10068855 | Ga0105237_100688552 | 170 |
| 192 | 3300009545 | Ga0105237_10518793 | Ga0105237_105187932 | 170 |
| 193 | 3300009545 | Ga0105237_10558821 | Ga0105237_105588211 | 170 |
| 194 | 3300009551 | Ga0105238_10288280 | Ga0105238_102882801 | 170 |
| 195 | 3300009551 | Ga0105238_10511480 | Ga0105238_105114801 | 170 |
| 196 | 3300009551 | Ga0105238_11046936 | Ga0105238_110469361 | 170 |
| 197 | 3300009553 | Ga0105249_10169215 | Ga0105249_101692153 | 170 |
| 198 | 3300009553 | Ga0105249_10192196 | Ga0105249_101921963 | 170 |
| 199 | 3300010375 | Ga0105239_10710355 | Ga0105239_107103552 | 170 |
| 200 | 3300011119 | Ga0105246_11291614 | Ga0105246_112916141 | 170 |
| 201 | 3300011119 | Ga0105246_11450197 | Ga0105246_114501971 | 170 |
| 202 | 3300013105 | Ga0157369_10885145 | Ga0157369_108851452 | 170 |
| 203 | 3300013105 | Ga0157369_11168735 | Ga0157369_111687352 | 170 |
| 204 | 3300013296 | Ga0157374_10044255 | Ga0157374_100442553 | 170 |
| 205 | 3300013296 | Ga0157374_10096208 | Ga0157374_100962085 | 170 |
| 206 | 3300013296 | Ga0157374_10953278 | Ga0157374_109532782 | 170 |
| 207 | 3300013296 | Ga0157374_11102220 | Ga0157374_111022202 | 170 |
| 208 | 3300013297 | Ga0157378_10338060 | Ga0157378_103380603 | 170 |
| 209 | 3300013297 | Ga0157378_10377713 | Ga0157378_103777132 | 170 |
| 210 | 3300013306 | Ga0163162_10495001 | Ga0163162_104950012 | 170 |
| 211 | 3300013307 | Ga0157372_10064255 | Ga0157372_100642553 | 170 |
| 212 | 3300013307 | Ga0157372_11358423 | Ga0157372_113584232 | 170 |
| 213 | 3300014325 | Ga0163163_11091899 | Ga0163163_110918991 | 170 |
| 214 | 3300014745 | Ga0157377_10437107 | Ga0157377_104371071 | 170 |
| 215 | 3300014968 | Ga0157379_10237470 | Ga0157379_102374702 | 170 |
| 216 | 3300014968 | Ga0157379_10808372 | Ga0157379_108083721 | 170 |
| 217 | 3300014969 | Ga0157376_10355224 | Ga0157376_103552242 | 170 |
| 218 | 3300014969 | Ga0157376_10651438 | Ga0157376_106514381 | 170 |
| 219 | 3300014969 | Ga0157376_10776662 | Ga0157376_107766622 | 170 |
| 220 | 3300014969 | Ga0157376_10866669 | Ga0157376_108666691 | 170 |
| 221 | 3300020069 | Ga0197907_10644234 | Ga0197907_106442342 | 170 |
| 222 | 3300020070 | Ga0206356_10488560 | Ga0206356_104885602 | 170 |
| 223 | 3300020078 | Ga0206352_11294615 | Ga0206352_112946151 | 170 |
| 224 | 3300020081 | Ga0206354_11390788 | Ga0206354_113907882 | 170 |
| 225 | 3300025315 | Ga0207697_10009698 | Ga0207697_100096987 | 170 |
| 226 | 3300025315 | Ga0207697_10168681 | Ga0207697_101686812 | 170 |
| 227 | 3300025898 | Ga0207692_10052812 | Ga0207692_100528122 | 170 |
| 228 | 3300025898 | Ga0207692_10289510 | Ga0207692_102895102 | 170 |
| 229 | 3300025905 | Ga0207685_10590573 | Ga0207685_105905731 | 170 |
| 230 | 3300025906 | Ga0207699_10068257 | Ga0207699_100682573 | 170 |
| 231 | 3300025907 | Ga0207645_10000305 | Ga0207645_1000030530 | 170 |
| 232 | 3300025908 | Ga0207643_10151141 | Ga0207643_101511412 | 170 |
| 233 | 3300025909 | Ga0207705_10108306 | Ga0207705_101083063 | 170 |
| 234 | 3300025912 | Ga0207707_10012710 | Ga0207707_100127101 | 170 |
| 235 | 3300025912 | Ga0207707_10021786 | Ga0207707_100217865 | 170 |
| 236 | 3300025912 | Ga0207707_10087528 | Ga0207707_100875283 | 170 |
| 237 | 3300025912 | Ga0207707_10259232 | Ga0207707_102592322 | 170 |
| 238 | 3300025913 | Ga0207695_10094121 | Ga0207695_100941215 | 170 |
| 239 | 3300025914 | Ga0207671_10131744 | Ga0207671_101317443 | 170 |
| 240 | 3300025915 | Ga0207693_10420527 | Ga0207693_104205271 | 170 |
| 241 | 3300025916 | Ga0207663_10819534 | Ga0207663_108195341 | 170 |
| 242 | 3300025917 | Ga0207660_10159462 | Ga0207660_101594622 | 170 |
| 243 | 3300025917 | Ga0207660_10159532 | Ga0207660_101595322 | 170 |
| 244 | 3300025918 | Ga0207662_10001910 | Ga0207662_100019104 | 170 |
| 245 | 3300025918 | Ga0207662_10046301 | Ga0207662_100463012 | 170 |
| 246 | 3300025918 | Ga0207662_10047120 | Ga0207662_100471202 | 170 |
| 247 | 3300025918 | Ga0207662_10072131 | Ga0207662_100721312 | 170 |
| 248 | 3300025918 | Ga0207662_10082136 | Ga0207662_100821362 | 170 |
| 249 | 3300025918 | Ga0207662_10578370 | Ga0207662_105783701 | 170 |
| 250 | 3300025920 | Ga0207649_10237412 | Ga0207649_102374122 | 170 |
| 251 | 3300025921 | Ga0207652_10008761 | Ga0207652_100087618 | 170 |
| 252 | 3300025921 | Ga0207652_10231423 | Ga0207652_102314232 | 170 |
| 253 | 3300025921 | Ga0207652_10436937 | Ga0207652_104369372 | 170 |
| 254 | 3300025921 | Ga0207652_10481101 | Ga0207652_104811011 | 170 |
| 255 | 3300025922 | Ga0207646_10478056 | Ga0207646_104780563 | 170 |
| 256 | 3300025922 | Ga0207646_10487958 | Ga0207646_104879581 | 170 |
| 257 | 3300025922 | Ga0207646_11055033 | Ga0207646_110550331 | 170 |
| 258 | 3300025923 | Ga0207681_10002259 | Ga0207681_1000225911 | 170 |
| 259 | 3300025924 | Ga0207694_10118235 | Ga0207694_101182353 | 170 |
| 260 | 3300025924 | Ga0207694_10504021 | Ga0207694_105040211 | 170 |
| 261 | 3300025925 | Ga0207650_10008878 | Ga0207650_100088788 | 170 |
| 262 | 3300025925 | Ga0207650_10138454 | Ga0207650_101384544 | 170 |
| 263 | 3300025925 | Ga0207650_10194812 | Ga0207650_101948121 | 170 |
| 264 | 3300025926 | Ga0207659_10016522 | Ga0207659_100165222 | 170 |
| 265 | 3300025926 | Ga0207659_10026438 | Ga0207659_100264382 | 170 |
| 266 | 3300025926 | Ga0207659_11165279 | Ga0207659_111652791 | 170 |
| 267 | 3300025927 | Ga0207687_10002588 | Ga0207687_100025886 | 170 |
| 268 | 3300025927 | Ga0207687_10877173 | Ga0207687_108771731 | 170 |
| 269 | 3300025931 | Ga0207644_10072396 | Ga0207644_100723962 | 170 |
| 270 | 3300025932 | Ga0207690_10989459 | Ga0207690_109894591 | 170 |
| 271 | 3300025934 | Ga0207686_10314690 | Ga0207686_103146902 | 170 |
| 272 | 3300025934 | Ga0207686_10332352 | Ga0207686_103323521 | 170 |
| 273 | 3300025935 | Ga0207709_10257805 | Ga0207709_102578052 | 170 |
| 274 | 3300025936 | Ga0207670_10045655 | Ga0207670_100456551 | 170 |
| 275 | 3300025936 | Ga0207670_10253605 | Ga0207670_102536052 | 170 |
| 276 | 3300025936 | Ga0207670_10421693 | Ga0207670_104216932 | 170 |
| 277 | 3300025936 | Ga0207670_11221515 | Ga0207670_112215151 | 170 |
| 278 | 3300025937 | Ga0207669_10002571 | Ga0207669_100025714 | 170 |
| 279 | 3300025938 | Ga0207704_10014734 | Ga0207704_100147345 | 170 |
| 280 | 3300025938 | Ga0207704_10135406 | Ga0207704_101354062 | 170 |
| 281 | 3300025939 | Ga0207665_10119873 | Ga0207665_101198733 | 170 |
| 282 | 3300025940 | Ga0207691_10035731 | Ga0207691_100357317 | 170 |
| 283 | 3300025940 | Ga0207691_10644810 | Ga0207691_106448102 | 170 |
| 284 | 3300025942 | Ga0207689_10061294 | Ga0207689_100612943 | 170 |
| 285 | 3300025942 | Ga0207689_10190251 | Ga0207689_101902512 | 170 |
| 286 | 3300025942 | Ga0207689_10243204 | Ga0207689_102432043 | 170 |
| 287 | 3300025942 | Ga0207689_11271457 | Ga0207689_112714571 | 170 |
| 288 | 3300025944 | Ga0207661_10000960 | Ga0207661_1000096017 | 170 |
| 289 | 3300025944 | Ga0207661_10525690 | Ga0207661_105256901 | 170 |
| 290 | 3300025949 | Ga0207667_10254992 | Ga0207667_102549922 | 170 |
| 291 | 3300025949 | Ga0207667_10890483 | Ga0207667_108904831 | 170 |
| 292 | 3300025960 | Ga0207651_10002205 | Ga0207651_100022057 | 170 |
| 293 | 3300025960 | Ga0207651_10067837 | Ga0207651_100678375 | 170 |
| 294 | 3300025961 | Ga0207712_10157986 | Ga0207712_101579861 | 170 |
| 295 | 3300025961 | Ga0207712_10246511 | Ga0207712_102465111 | 170 |
| 296 | 3300025972 | Ga0207668_10006597 | Ga0207668_100065973 | 170 |
| 297 | 3300025972 | Ga0207668_10214698 | Ga0207668_102146982 | 170 |
| 298 | 3300025986 | Ga0207658_10292796 | Ga0207658_102927962 | 170 |
| 299 | 3300025986 | Ga0207658_10473770 | Ga0207658_104737702 | 170 |
| 300 | 3300026023 | Ga0207677_10426600 | Ga0207677_104266002 | 170 |
| 301 | 3300026023 | Ga0207677_11103795 | Ga0207677_111037951 | 170 |
| 302 | 3300026035 | Ga0207703_10064050 | Ga0207703_100640502 | 170 |
| 303 | 3300026035 | Ga0207703_10625597 | Ga0207703_106255972 | 170 |
| 304 | 3300026041 | Ga0207639_10708444 | Ga0207639_107084442 | 170 |
| 305 | 3300026075 | Ga0207708_10006083 | Ga0207708_100060839 | 170 |
| 306 | 3300026075 | Ga0207708_10084489 | Ga0207708_100844893 | 170 |
| 307 | 3300026078 | Ga0207702_10096229 | Ga0207702_100962291 | 170 |
| 308 | 3300026078 | Ga0207702_10280958 | Ga0207702_102809583 | 170 |
| 309 | 3300026089 | Ga0207648_10003927 | Ga0207648_100039279 | 170 |
| 310 | 3300026095 | Ga0207676_10965426 | Ga0207676_109654261 | 170 |
| 311 | 3300026116 | Ga0207674_10075073 | Ga0207674_100750732 | 170 |
| 312 | 3300026116 | Ga0207674_10223423 | Ga0207674_102234232 | 170 |
| 313 | 3300026116 | Ga0207674_10293133 | Ga0207674_102931332 | 170 |
| 314 | 3300026116 | Ga0207674_10686137 | Ga0207674_106861372 | 170 |
| 315 | 3300026118 | Ga0207675_100013757 | Ga0207675_1000137574 | 170 |
| 316 | 3300026118 | Ga0207675_100037626 | Ga0207675_1000376263 | 170 |
| 317 | 3300026118 | Ga0207675_101205443 | Ga0207675_1012054431 | 170 |
| 318 | 3300026121 | Ga0207683_10148526 | Ga0207683_101485263 | 170 |
| 319 | 3300026121 | Ga0207683_10346262 | Ga0207683_103462622 | 170 |
| 320 | 3300026121 | Ga0207683_10423630 | Ga0207683_104236301 | 170 |
| 321 | 3300026142 | Ga0207698_10105753 | Ga0207698_101057532 | 170 |
| 322 | 3300026142 | Ga0207698_10215000 | Ga0207698_102150002 | 170 |
| 323 | 3300027907 | Ga0207428_10457821 | Ga0207428_104578211 | 170 |
| 324 | 3300028379 | Ga0268266_10002761 | Ga0268266_100027617 | 170 |
| 325 | 3300028379 | Ga0268266_10257722 | Ga0268266_102577223 | 170 |
| 326 | 3300028379 | Ga0268266_10361059 | Ga0268266_103610592 | 170 |
| 327 | 3300028380 | Ga0268265_10091200 | Ga0268265_100912002 | 170 |
| 328 | 3300028556 | Ga0265337_1015017 | Ga0265337_10150172 | 170 |
| 329 | 3300028558 | Ga0265326_10002726 | Ga0265326_100027266 | 170 |
| 330 | 3300028563 | Ga0265319_1029533 | Ga0265319_10295333 | 170 |
| 331 | 3300028573 | Ga0265334_10014224 | Ga0265334_100142242 | 170 |
| 332 | 3300028573 | Ga0265334_10153170 | Ga0265334_101531701 | 170 |
| 333 | 3300028573 | Ga0265334_10211168 | Ga0265334_102111681 | 170 |
| 334 | 3300028577 | Ga0265318_10000001 | Ga0265318_10000001223 | 170 |
| 335 | 3300028577 | Ga0265318_10002071 | Ga0265318_1000207111 | 170 |
| 336 | 3300028577 | Ga0265318_10113314 | Ga0265318_101133141 | 170 |
| 337 | 3300028653 | Ga0265323_10000747 | Ga0265323_1000074718 | 170 |
| 338 | 3300028653 | Ga0265323_10008433 | Ga0265323_100084332 | 170 |
| 339 | 3300028653 | Ga0265323_10099692 | Ga0265323_100996922 | 170 |
| 340 | 3300028654 | Ga0265322_10034737 | Ga0265322_100347374 | 170 |
| 341 | 3300028666 | Ga0265336_10007772 | Ga0265336_100077724 | 170 |
| 342 | 3300028786 | Ga0307517_10019612 | Ga0307517_100196124 | 170 |
| 343 | 3300028794 | Ga0307515_10010405 | Ga0307515_100104058 | 170 |
| 344 | 3300028800 | Ga0265338_10001115 | Ga0265338_100011159 | 170 |
| 345 | 3300028800 | Ga0265338_10018541 | Ga0265338_100185417 | 170 |
| 346 | 3300028800 | Ga0265338_10031496 | Ga0265338_100314963 | 170 |
| 347 | 3300028800 | Ga0265338_10142082 | Ga0265338_101420822 | 170 |
| 348 | 3300028800 | Ga0265338_10162017 | Ga0265338_101620172 | 170 |
| 349 | 3300028800 | Ga0265338_10174710 | Ga0265338_101747103 | 170 |
| 350 | 3300028800 | Ga0265338_10358640 | Ga0265338_103586401 | 170 |
| 351 | 3300029957 | Ga0265324_10000172 | Ga0265324_100001728 | 170 |
| 352 | 3300031235 | Ga0265330_10000002 | Ga0265330_10000002150 | 170 |
| 353 | 3300031235 | Ga0265330_10000588 | Ga0265330_1000058819 | 170 |
| 354 | 3300031235 | Ga0265330_10000838 | Ga0265330_1000083810 | 170 |
| 355 | 3300031235 | Ga0265330_10001551 | Ga0265330_1000155113 | 170 |
| 356 | 3300031235 | Ga0265330_10002799 | Ga0265330_100027999 | 170 |
| 357 | 3300031235 | Ga0265330_10003798 | Ga0265330_100037987 | 170 |
| 358 | 3300031235 | Ga0265330_10004572 | Ga0265330_100045723 | 170 |
| 359 | 3300031235 | Ga0265330_10043045 | Ga0265330_100430452 | 170 |
| 360 | 3300031235 | Ga0265330_10121421 | Ga0265330_101214213 | 170 |
| 361 | 3300031238 | Ga0265332_10000242 | Ga0265332_1000024210 | 170 |
| 362 | 3300031238 | Ga0265332_10000331 | Ga0265332_1000033130 | 170 |
| 363 | 3300031238 | Ga0265332_10004135 | Ga0265332_100041352 | 170 |
| 364 | 3300031238 | Ga0265332_10064850 | Ga0265332_100648501 | 170 |
| 365 | 3300031238 | Ga0265332_10102899 | Ga0265332_101028991 | 170 |
| 366 | 3300031239 | Ga0265328_10000280 | Ga0265328_1000028025 | 170 |
| 367 | 3300031239 | Ga0265328_10000683 | Ga0265328_100006835 | 170 |
| 368 | 3300031239 | Ga0265328_10012366 | Ga0265328_100123662 | 170 |
| 369 | 3300031240 | Ga0265320_10000007 | Ga0265320_10000007233 | 170 |
| 370 | 3300031240 | Ga0265320_10002363 | Ga0265320_1000236314 | 170 |
| 371 | 3300031240 | Ga0265320_10011167 | Ga0265320_100111677 | 170 |
| 372 | 3300031240 | Ga0265320_10011806 | Ga0265320_100118066 | 170 |
| 373 | 3300031240 | Ga0265320_10288858 | Ga0265320_102888581 | 170 |
| 374 | 3300031240 | Ga0265320_10342532 | Ga0265320_103425321 | 170 |
| 375 | 3300031241 | Ga0265325_10000856 | Ga0265325_100008569 | 170 |
| 376 | 3300031241 | Ga0265325_10008903 | Ga0265325_100089035 | 170 |
| 377 | 3300031241 | Ga0265325_10020117 | Ga0265325_100201173 | 170 |
| 378 | 3300031242 | Ga0265329_10000098 | Ga0265329_100000984 | 170 |
| 379 | 3300031242 | Ga0265329_10000806 | Ga0265329_100008067 | 170 |
| 380 | 3300031242 | Ga0265329_10015809 | Ga0265329_100158093 | 170 |
| 381 | 3300031247 | Ga0265340_10000741 | Ga0265340_100007413 | 170 |
| 382 | 3300031247 | Ga0265340_10126383 | Ga0265340_101263832 | 170 |
| 383 | 3300031249 | Ga0265339_10000141 | Ga0265339_1000014144 | 170 |
| 384 | 3300031249 | Ga0265339_10010416 | Ga0265339_100104163 | 170 |
| 385 | 3300031249 | Ga0265339_10042307 | Ga0265339_100423071 | 170 |
| 386 | 3300031249 | Ga0265339_10065697 | Ga0265339_100656973 | 170 |
| 387 | 3300031249 | Ga0265339_10146761 | Ga0265339_101467611 | 170 |
| 388 | 3300031249 | Ga0265339_10238733 | Ga0265339_102387332 | 170 |
| 389 | 3300031249 | Ga0265339_10306876 | Ga0265339_103068761 | 170 |
| 390 | 3300031250 | Ga0265331_10000001 | Ga0265331_10000001305 | 170 |
| 391 | 3300031250 | Ga0265331_10007316 | Ga0265331_100073167 | 170 |
| 392 | 3300031250 | Ga0265331_10110045 | Ga0265331_101100452 | 170 |
| 393 | 3300031250 | Ga0265331_10238382 | Ga0265331_102383822 | 170 |
| 394 | 3300031344 | Ga0265316_10000053 | Ga0265316_1000005341 | 170 |
| 395 | 3300031344 | Ga0265316_10000108 | Ga0265316_1000010824 | 170 |
| 396 | 3300031344 | Ga0265316_10000583 | Ga0265316_1000058324 | 170 |
| 397 | 3300031344 | Ga0265316_10000878 | Ga0265316_100008783 | 170 |
| 398 | 3300031344 | Ga0265316_10002456 | Ga0265316_1000245612 | 170 |
| 399 | 3300031344 | Ga0265316_10002912 | Ga0265316_100029126 | 170 |
| 400 | 3300031344 | Ga0265316_10006504 | Ga0265316_100065048 | 170 |
| 401 | 3300031344 | Ga0265316_10024023 | Ga0265316_100240232 | 170 |
| 402 | 3300031344 | Ga0265316_10043815 | Ga0265316_100438154 | 170 |
| 403 | 3300031344 | Ga0265316_10050155 | Ga0265316_100501552 | 170 |
| 404 | 3300031344 | Ga0265316_10180086 | Ga0265316_101800863 | 170 |
| 405 | 3300031344 | Ga0265316_10329649 | Ga0265316_103296492 | 170 |
| 406 | 3300031456 | Ga0307513_10213379 | Ga0307513_102133792 | 170 |
| 407 | 3300031507 | Ga0307509_10000164 | Ga0307509_1000016430 | 170 |
| 408 | 3300031507 | Ga0307509_10027240 | Ga0307509_100272403 | 170 |
| 409 | 3300031507 | Ga0307509_10114355 | Ga0307509_101143552 | 170 |
| 410 | 3300031595 | Ga0265313_10000090 | Ga0265313_100000907 | 170 |
| 411 | 3300031595 | Ga0265313_10053988 | Ga0265313_100539882 | 170 |
| 412 | 3300031595 | Ga0265313_10058506 | Ga0265313_100585063 | 170 |
| 413 | 3300031595 | Ga0265313_10149831 | Ga0265313_101498312 | 170 |
| 414 | 3300031595 | Ga0265313_10288722 | Ga0265313_102887221 | 170 |
| 415 | 3300031616 | Ga0307508_10154304 | Ga0307508_101543044 | 170 |
| 416 | 3300031616 | Ga0307508_10154665 | Ga0307508_101546652 | 170 |
| 417 | 3300031711 | Ga0265314_10000006 | Ga0265314_10000006339 | 170 |
| 418 | 3300031711 | Ga0265314_10000009 | Ga0265314_10000009332 | 170 |
| 419 | 3300031711 | Ga0265314_10005265 | Ga0265314_100052658 | 170 |
| 420 | 3300031711 | Ga0265314_10009719 | Ga0265314_100097193 | 170 |
| 421 | 3300031711 | Ga0265314_10012976 | Ga0265314_100129766 | 170 |
| 422 | 3300031711 | Ga0265314_10017512 | Ga0265314_100175126 | 170 |
| 423 | 3300031711 | Ga0265314_10030286 | Ga0265314_100302864 | 170 |
| 424 | 3300031711 | Ga0265314_10437368 | Ga0265314_104373681 | 170 |
| 425 | 3300031712 | Ga0265342_10000065 | Ga0265342_1000006530 | 170 |
| 426 | 3300031712 | Ga0265342_10000654 | Ga0265342_1000065435 | 170 |
| 427 | 3300031712 | Ga0265342_10002973 | Ga0265342_100029738 | 170 |
| 428 | 3300031712 | Ga0265342_10007901 | Ga0265342_100079016 | 170 |
| 429 | 3300031712 | Ga0265342_10016011 | Ga0265342_100160115 | 170 |
| 430 | 3300031712 | Ga0265342_10018799 | Ga0265342_100187993 | 170 |
| 431 | 3300031712 | Ga0265342_10033590 | Ga0265342_100335902 | 170 |
| 432 | 3300031712 | Ga0265342_10058193 | Ga0265342_100581934 | 170 |
| 433 | 3300031712 | Ga0265342_10098237 | Ga0265342_100982372 | 170 |
| 434 | 3300031712 | Ga0265342_10188316 | Ga0265342_101883162 | 170 |
| 435 | 3300031712 | Ga0265342_10364525 | Ga0265342_103645251 | 170 |
| 436 | 3300031727 | Ga0316576_10000030 | Ga0316576_100000308 | 170 |
| 437 | 3300031727 | Ga0316576_10127528 | Ga0316576_101275282 | 170 |
| 438 | 3300031727 | Ga0316576_10657081 | Ga0316576_106570811 | 170 |
| 439 | 3300031731 | Ga0307405_10621681 | Ga0307405_106216812 | 170 |
| 440 | 3300031901 | Ga0307406_10142112 | Ga0307406_101421123 | 170 |
| 441 | 3300031911 | Ga0307412_10249621 | Ga0307412_102496212 | 170 |
| 442 | 3300032126 | Ga0307415_100047187 | Ga0307415_1000471873 | 170 |
| 443 | 3300032126 | Ga0307415_100683764 | Ga0307415_1006837641 | 170 |
| 444 | 3300033179 | Ga0307507_10342761 | Ga0307507_103427611 | 170 |
| 445 | 3300033179 | Ga0307507_10546470 | Ga0307507_105464701 | 170 |
| 446 | 3300034818 | Ga0373950_0000015 | Ga0373950_0000015_63652_64167 | 170 |
| 447 | 3300034818 | Ga0373950_0000106 | Ga0373950_0000106_11608_12123 | 170 |
| 448 | 3300035089 | Ga0373944_0254710 | Ga0373944_0254710_105_620 | 170 |
| 449 | 3300035090 | Ga0373949_0000228 | Ga0373949_0000228_2221_2736 | 170 |
| 450 | 3300035111 | Ga0373923_0195783 | Ga0373923_0195783_257_772 | 170 |
| 451 | 3300035111 | Ga0373923_0302451 | Ga0373923_0302451_167_682 | 170 |
| 452 | 3300035113 | Ga0373936_0000009 | Ga0373936_0000009_21022_21537 | 170 |
| 453 | 3300035115 | Ga0373941_0047170 | Ga0373941_0047170_494_1009 | 170 |
| 454 | 3300035115 | Ga0373941_0301582 | Ga0373941_0301582_25_540 | 170 |
| 455 | 3300035116 | Ga0373945_0012235 | Ga0373945_0012235_69_584 | 170 |
| 456 | 3300035117 | Ga0373953_0050652 | Ga0373953_0050652_532_1047 | 170 |
| 457 | 3300035118 | Ga0373954_0027481 | Ga0373954_0027481_1129_1644 | 170 |
| 458 | 3300035118 | Ga0373954_0248140 | Ga0373954_0248140_42_557 | 170 |
| 459 | 3300035118 | Ga0373954_0565668 | Ga0373954_0565668_34_549 | 170 |
| 460 | 3300035119 | Ga0373956_0054854 | Ga0373956_0054854_1241_1756 | 170 |
| 461 | 3300035119 | Ga0373956_0096269 | Ga0373956_0096269_593_1108 | 170 |
| 462 | 3300035120 | Ga0373957_0012584 | Ga0373957_0012584_1710_2225 | 170 |
| 463 | 3300035120 | Ga0373957_0015579 | Ga0373957_0015579_1279_1794 | 170 |
| 464 | 3300035120 | Ga0373957_0038128 | Ga0373957_0038128_304_819 | 170 |
| 465 | 3300035171 | Ga0373946_0521887 | Ga0373946_0521887_43_558 | 170 |
| 466 | 3300035172 | Ga0373955_0045088 | Ga0373955_0045088_1117_1632 | 170 |
| 467 | 3300035172 | Ga0373955_0093032 | Ga0373955_0093032_619_1134 | 170 |
| 468 | 3300035172 | Ga0373955_0200800 | Ga0373955_0200800_421_936 | 170 |
| 469 | 3300035172 | Ga0373955_0234302 | Ga0373955_0234302_256_771 | 170 |
| 470 | 3300035241 | Ga0373961_0000132 | Ga0373961_0000132_11353_11868 | 170 |
| 471 | 3300035724 | Ga0373933_0000801 | Ga0373933_0000801_4455_4970 | 170 |
| 472 | 3300035724 | Ga0373933_0045864 | Ga0373933_0045864_1635_2150 | 170 |
| 473 | 3300035724 | Ga0373933_0191542 | Ga0373933_0191542_459_974 | 170 |
| 474 | 3300035724 | Ga0373933_0382750 | Ga0373933_0382750_267_782 | 170 |
| 475 | 3300035725 | Ga0373947_0068533 | Ga0373947_0068533_233_748 | 170 |
| 476 | 3300035725 | Ga0373947_1028996 | Ga0373947_1028996_20_535 | 170 |
| 477 | 3300036401 | Ga0373937_0007263 | Ga0373937_0007263_1084_1599 | 170 |
| 478 | 3300036401 | Ga0373937_0007632 | Ga0373937_0007632_12_527 | 170 |
| 479 | 3300036401 | Ga0373937_0182473 | Ga0373937_0182473_722_1237 | 170 |
| 480 | 3300036401 | Ga0373937_0248621 | Ga0373937_0248621_757_1272 | 170 |
| 481 | 3300036401 | Ga0373937_0643620 | Ga0373937_0643620_166_681 | 170 |
| 482 | 3300036647 | Ga0316582_0067751 | Ga0316582_0067751_1325_1840 | 170 |
| 483 | 3300036712 | Ga0316584_0000106 | Ga0316584_0000106_26934_27449 | 170 |
| 484 | 3300037068 | Ga0373925_0065036 | Ga0373925_0065036_593_1108 | 170 |
| 485 | 3300037068 | Ga0373925_0188831 | Ga0373925_0188831_745_1260 | 170 |
| 486 | 3300037312 | Ga0395899_0010235 | Ga0395899_0010235_6224_6739 | 170 |
| 487 | 3300037312 | Ga0395899_0192670 | Ga0395899_0192670_271_786 | 170 |
| 488 | 3300037418 | Ga0395900_0612644 | Ga0395900_0612644_330_845 | 170 |
| 489 | 3300037418 | Ga0395900_0756919 | Ga0395900_0756919_359_874 | 170 |
| 490 | 3300037466 | Ga0395898_0082216 | Ga0395898_0082216_79_594 | 170 |
| 491 | 3300037466 | Ga0395898_0964670 | Ga0395898_0964670_205_720 | 170 |
| 492 | 3300037471 | Ga0395905_0449008 | Ga0395905_0449008_626_1141 | 170 |
| 493 | 3300037471 | Ga0395905_0902289 | Ga0395905_0902289_51_566 | 170 |
| 494 | 3300038443 | Ga0395901_0206849 | Ga0395901_0206849_966_1481 | 170 |
| 495 | 3300039437 | Ga0436365_1570115 | Ga0436365_1570115_148_663 | 170 |
| 496 | 3300039450 | Ga0436363_0344008 | Ga0436363_0344008_817_1329 | 170 |
| 497 | 3300041441 | Ga0451787_397521 | Ga0451787_397521_115_630 | 170 |
| 498 | 3300041452 | Ga0451793_1704137 | Ga0451793_1704137_131_646 | 170 |
| 499 | 3300041453 | Ga0451797_0791634 | Ga0451797_0791634_46_561 | 170 |
| 500 | 3300041460 | Ga0451802_0260369 | Ga0451802_0260369_385_897 | 170 |
| 501 | 3300041486 | Ga0451807_2163525 | Ga0451807_2163525_242_754 | 170 |
| 502 | 3300041512 | Ga0451853_3702505 | Ga0451853_3702505_110_625 | 170 |
| 503 | 3300042876 | Ga0451577_0028182 | Ga0451577_0028182_4543_5058 | 170 |
| 504 | 3300042876 | Ga0451577_0452357 | Ga0451577_0452357_244_759 | 170 |
| 505 | 3300044658 | Ga0466972_0124667 | Ga0466972_0124667_348_887 | 170 |
| 506 | 3300044712 | Ga0453684_0000078 | Ga0453684_0000078_222866_223381 | 170 |
| 507 | 3300044712 | Ga0453684_0050881 | Ga0453684_0050881_2633_3151 | 170 |
| 508 | 3300044712 | Ga0453684_0189167 | Ga0453684_0189167_529_1044 | 170 |
| 509 | 3300044712 | Ga0453684_0339694 | Ga0453684_0339694_537_1052 | 170 |
| 510 | 3300044712 | Ga0453684_0654278 | Ga0453684_0654278_47_562 | 170 |
| 511 | 3300044842 | Ga0466957_0307876 | Ga0466957_0307876_433_948 | 170 |
| 512 | 3300045051 | Ga0451576_0155695 | Ga0451576_0155695_1330_1845 | 170 |
| 513 | 3300045051 | Ga0451576_1592132 | Ga0451576_1592132_67_582 | 170 |
| 514 | 3300045976 | Ga0466967_0371022 | Ga0466967_0371022_781_1296 | 170 |
| 515 | 3300045976 | Ga0466967_1058577 | Ga0466967_1058577_196_708 | 170 |
| 516 | 3300046457 | Ga0495590_0033611 | Ga0495590_0033611_732_1247 | 170 |
| 517 | 3300046462 | Ga0495651_0045584 | Ga0495651_0045584_1072_1587 | 170 |
| 518 | 3300046473 | Ga0495582_0696781 | Ga0495582_0696781_47_562 | 170 |
| 519 | 3300046476 | Ga0495662_0337042 | Ga0495662_0337042_138_653 | 170 |
| 520 | 3300046477 | Ga0495664_0739567 | Ga0495664_0739567_39_554 | 170 |
| 521 | 3300046516 | Ga0495628_0120726 | Ga0495628_0120726_1407_1922 | 170 |
| 522 | 3300046517 | Ga0495630_0004817 | Ga0495630_0004817_8748_9263 | 170 |
| 523 | 3300046529 | Ga0495652_0436993 | Ga0495652_0436993_39_554 | 170 |
| 524 | 3300046535 | Ga0495586_0657002 | Ga0495586_0657002_47_562 | 170 |
| 525 | 3300046536 | Ga0495587_0212397 | Ga0495587_0212397_301_813 | 170 |
| 526 | 3300046557 | Ga0495622_0164321 | Ga0495622_0164321_123_638 | 170 |
| 527 | 3300046642 | Ga0495634_0002302 | Ga0495634_0002302_11861_12376 | 170 |
| 528 | 3300046642 | Ga0495634_0491710 | Ga0495634_0491710_170_685 | 170 |
| 529 | 3300046675 | Ga0495657_0160202 | Ga0495657_0160202_533_1048 | 170 |
| 530 | 3300046679 | Ga0495623_0094467 | Ga0495623_0094467_1069_1581 | 170 |
| 531 | 3300047319 | Ga0495674_0017181 | Ga0495674_0017181_2346_2861 | 170 |
| 532 | 3300047471 | Ga0495684_0311672 | Ga0495684_0311672_190_705 | 170 |
| 533 | 3300047472 | Ga0495686_0039813 | Ga0495686_0039813_1398_1913 | 170 |
| 534 | 3300047472 | Ga0495686_0093671 | Ga0495686_0093671_838_1353 | 170 |
| 535 | 3300048904 | Ga0496101_0198767 | Ga0496101_0198767_167_682 | 170 |
| 536 | 3300048907 | Ga0496104_0033434 | Ga0496104_0033434_4003_4518 | 170 |
| 537 | 3300048907 | Ga0496104_0264217 | Ga0496104_0264217_366_881 | 170 |
| 538 | 3300048908 | Ga0496105_1196353 | Ga0496105_1196353_11_526 | 170 |
| 539 | 3300048909 | Ga0496106_0537971 | Ga0496106_0537971_156_671 | 170 |
| 540 | 3300048910 | Ga0496107_0053616 | Ga0496107_0053616_724_1239 | 170 |
| 541 | 3300048911 | Ga0496108_0046394 | Ga0496108_0046394_530_1045 | 170 |
| 542 | 3300048912 | Ga0496109_0218006 | Ga0496109_0218006_503_1018 | 170 |
| 543 | 3300048912 | Ga0496109_0380206 | Ga0496109_0380206_548_1063 | 170 |
| 544 | 3300048913 | Ga0496110_0828207 | Ga0496110_0828207_125_640 | 170 |
| 545 | 3300048914 | Ga0496111_0753002 | Ga0496111_0753002_13_528 | 170 |
| 546 | 3300048915 | Ga0496112_0211733 | Ga0496112_0211733_660_1175 | 170 |
| 547 | 3300048917 | Ga0496114_0002777 | Ga0496114_0002777_7685_8200 | 170 |
| 548 | 3300048917 | Ga0496114_0019436 | Ga0496114_0019436_2172_2687 | 170 |
| 549 | 3300048917 | Ga0496114_0059321 | Ga0496114_0059321_784_1299 | 170 |
| 550 | 3300048917 | Ga0496114_0077206 | Ga0496114_0077206_2001_2516 | 170 |
| 551 | 3300048917 | Ga0496114_0106945 | Ga0496114_0106945_1068_1583 | 170 |
| 552 | 3300048917 | Ga0496114_0404011 | Ga0496114_0404011_393_908 | 170 |
| 553 | 3300048917 | Ga0496114_0899780 | Ga0496114_0899780_175_690 | 170 |
| 554 | 3300048918 | Ga0496115_0006149 | Ga0496115_0006149_1652_2167 | 170 |
| 555 | 3300048918 | Ga0496115_0135818 | Ga0496115_0135818_642_1157 | 170 |
| 556 | 3300049513 | Ga0501290_047341 | Ga0501290_047341_117_632 | 170 |
| 557 | 3300049515 | Ga0501292_042245 | Ga0501292_042245_179_694 | 170 |
| 558 | 3300049571 | Ga0501034_0000327 | Ga0501034_0000327_52775_53290 | 170 |
| 559 | 3300049571 | Ga0501034_0111981 | Ga0501034_0111981_505_1020 | 170 |
| 560 | 3300049572 | Ga0501036_0182698 | Ga0501036_0182698_325_840 | 170 |
| 561 | 3300049574 | Ga0501038_0201690 | Ga0501038_0201690_197_712 | 170 |
| 562 | 3300049578 | Ga0501042_0665344 | Ga0501042_0665344_162_677 | 170 |
| 563 | 3300049579 | Ga0501043_0000408 | Ga0501043_0000408_28376_28891 | 170 |
| 564 | 3300049579 | Ga0501043_0373850 | Ga0501043_0373850_326_841 | 170 |
| 565 | 3300049580 | Ga0501046_0000438 | Ga0501046_0000438_892_1407 | 170 |
| 566 | 3300049580 | Ga0501046_0404525 | Ga0501046_0404525_343_858 | 170 |
| 567 | 3300049581 | Ga0501047_0000008 | Ga0501047_0000008_224687_225202 | 170 |
| 568 | 3300049581 | Ga0501047_0012216 | Ga0501047_0012216_7249_7764 | 170 |
| 569 | 3300049581 | Ga0501047_0109014 | Ga0501047_0109014_1866_2381 | 170 |
| 570 | 3300049582 | Ga0501048_0063453 | Ga0501048_0063453_271_786 | 170 |
| 571 | 3300049583 | Ga0501067_0000030 | Ga0501067_0000030_83956_84471 | 170 |
| 572 | 3300049583 | Ga0501067_0083379 | Ga0501067_0083379_510_1022 | 170 |
| 573 | 3300049584 | Ga0501068_0007147 | Ga0501068_0007147_832_1347 | 170 |
| 574 | 3300049584 | Ga0501068_0044351 | Ga0501068_0044351_958_1473 | 170 |
| 575 | 3300049584 | Ga0501068_0731906 | Ga0501068_0731906_123_635 | 170 |
| 576 | 3300049585 | Ga0501069_0003625 | Ga0501069_0003625_4011_4610 | 170 |
| 577 | 3300049585 | Ga0501069_0032569 | Ga0501069_0032569_1691_2206 | 170 |
| 578 | 3300049585 | Ga0501069_0085107 | Ga0501069_0085107_1205_1720 | 170 |
| 579 | 3300049586 | Ga0501070_0001091 | Ga0501070_0001091_11643_12158 | 170 |
| 580 | 3300049586 | Ga0501070_0008109 | Ga0501070_0008109_704_1219 | 170 |
| 581 | 3300049586 | Ga0501070_0034368 | Ga0501070_0034368_2001_2516 | 170 |
| 582 | 3300049586 | Ga0501070_0124778 | Ga0501070_0124778_1129_1644 | 170 |
| 583 | 3300049586 | Ga0501070_1166252 | Ga0501070_1166252_26_541 | 170 |
| 584 | 3300049587 | Ga0501071_0734071 | Ga0501071_0734071_208_723 | 170 |
| 585 | 3300049588 | Ga0501072_0000023 | Ga0501072_0000023_134392_134907 | 170 |
| 586 | 3300049588 | Ga0501072_0159228 | Ga0501072_0159228_760_1275 | 170 |
| 587 | 3300049589 | Ga0501073_0000481 | Ga0501073_0000481_14152_14745 | 170 |
| 588 | 3300049589 | Ga0501073_0000498 | Ga0501073_0000498_11814_12329 | 170 |
| 589 | 3300049589 | Ga0501073_0000767 | Ga0501073_0000767_10398_10913 | 170 |
| 590 | 3300049589 | Ga0501073_0104657 | Ga0501073_0104657_92_607 | 170 |
| 591 | 3300049589 | Ga0501073_0284111 | Ga0501073_0284111_365_880 | 170 |
| 592 | 3300049590 | Ga0501074_0000439 | Ga0501074_0000439_9181_9696 | 170 |
| 593 | 3300049590 | Ga0501074_0027466 | Ga0501074_0027466_2545_3099 | 170 |
| 594 | 3300049592 | Ga0501076_0805907 | Ga0501076_0805907_66_581 | 170 |
| 595 | 3300049655 | Ga0501208_052022 | Ga0501208_052022_110_625 | 170 |
| 596 | 3300049660 | Ga0501216_001541 | Ga0501216_001541_2297_2812 | 170 |
| 597 | 3300049665 | Ga0501227_000349 | Ga0501227_000349_5593_6108 | 170 |
| 598 | 3300049665 | Ga0501227_002080 | Ga0501227_002080_946_1461 | 170 |
| 599 | 3300049667 | Ga0501230_000461 | Ga0501230_000461_466_981 | 170 |
| 600 | 3300049668 | Ga0501233_004596 | Ga0501233_004596_236_751 | 170 |
| 601 | 3300049669 | Ga0501235_019594 | Ga0501235_019594_365_880 | 170 |
| 602 | 3300049689 | Ga0501260_021073 | Ga0501260_021073_84_599 | 170 |
| 603 | 3300049703 | Ga0501219_015625 | Ga0501219_015625_89_604 | 170 |
| 604 | 3300049741 | Ga0501079_0000031 | Ga0501079_0000031_892_1407 | 170 |
| 605 | 3300049741 | Ga0501079_0216961 | Ga0501079_0216961_412_927 | 170 |
| 606 | 3300049742 | Ga0501080_0007570 | Ga0501080_0007570_3158_3673 | 170 |
| 607 | 3300049742 | Ga0501080_0146816 | Ga0501080_0146816_1278_1832 | 170 |
| 608 | 3300049742 | Ga0501080_0347191 | Ga0501080_0347191_489_1004 | 170 |
| 609 | 3300049742 | Ga0501080_0623077 | Ga0501080_0623077_343_858 | 170 |
| 610 | 3300049743 | Ga0501081_0064363 | Ga0501081_0064363_610_1125 | 170 |
| 611 | 3300049744 | Ga0501083_0001622 | Ga0501083_0001622_6272_6787 | 170 |
| 612 | 3300049744 | Ga0501083_0004836 | Ga0501083_0004836_2195_2710 | 170 |
| 613 | 3300049744 | Ga0501083_0075030 | Ga0501083_0075030_1629_2183 | 170 |
| 614 | 3300049744 | Ga0501083_0130591 | Ga0501083_0130591_827_1342 | 170 |
| 615 | 3300049764 | Ga0501267_004923 | Ga0501267_004923_155_670 | 170 |
| 616 | 3300049822 | Ga0501035_0042339 | Ga0501035_0042339_12_527 | 170 |
| 617 | 3300049823 | Ga0501044_0049920 | Ga0501044_0049920_1192_1707 | 170 |
| 618 | 3300049852 | Ga0501220_03393 | Ga0501220_03393_115_630 | 170 |
| 619 | 3300050489 | nmdc:mga03683_345097_c1 | nmdc:mga03683_345097_c1_155_670 | 170 |
| 620 | 3300050490 | nmdc:mga03n38_406597_c1 | nmdc:mga03n38_406597_c1_27_542 | 170 |
| 621 | 3300050507 | nmdc:mga05p37_1479769_c1 | nmdc:mga05p37_1479769_c1_136_651 | 170 |
| 622 | 3300050507 | nmdc:mga05p37_189987_c1 | nmdc:mga05p37_189987_c1_340_852 | 170 |
| 623 | 3300050508 | nmdc:mga09592_3157_c1 | nmdc:mga09592_3157_c1_7946_8461 | 170 |
| 624 | 3300050508 | nmdc:mga09592_96549_c1 | nmdc:mga09592_96549_c1_88_603 | 170 |
| 625 | 3300050509 | nmdc:mga0qj67_144070_c1 | nmdc:mga0qj67_144070_c1_1180_1695 | 170 |
| 626 | 3300050509 | nmdc:mga0qj67_415754_c1 | nmdc:mga0qj67_415754_c1_465_980 | 170 |
| 627 | 3300050509 | nmdc:mga0qj67_896508_c1 | nmdc:mga0qj67_896508_c1_84_614 | 170 |
| 628 | 3300050511 | nmdc:mga08y16_169856_c1 | nmdc:mga08y16_169856_c1_571_1086 | 170 |
| 629 | 3300050511 | nmdc:mga08y16_5330_c1 | nmdc:mga08y16_5330_c1_12767_13282 | 170 |
| 630 | 3300050511 | nmdc:mga08y16_596202_c1 | nmdc:mga08y16_596202_c1_338_853 | 170 |
| 631 | 3300050511 | nmdc:mga08y16_656791_c1 | nmdc:mga08y16_656791_c1_287_802 | 170 |
| 632 | 3300050511 | nmdc:mga08y16_79762_c1 | nmdc:mga08y16_79762_c1_656_1171 | 170 |
| 633 | 3300050511 | nmdc:mga08y16_901610_c1 | nmdc:mga08y16_901610_c1_212_727 | 170 |
| 634 | 3300050511 | nmdc:mga08y16_941975_c1 | nmdc:mga08y16_941975_c1_94_606 | 170 |
| 635 | 3300050512 | nmdc:mga0n895_1090206_c1 | nmdc:mga0n895_1090206_c1_203_718 | 170 |
| 636 | 3300050513 | nmdc:mga0rr50_214103_c1 | nmdc:mga0rr50_214103_c1_425_940 | 170 |
| 637 | 3300050513 | nmdc:mga0rr50_367047_c1 | nmdc:mga0rr50_367047_c1_317_832 | 170 |
| 638 | 3300053080 | Ga0500635_0012695 | Ga0500635_0012695_1878_2393 | 170 |
| 639 | 3300053085 | Ga0495619_0057969 | Ga0495619_0057969_688_1203 | 170 |
| 640 | 3300053086 | Ga0500578_0195725 | Ga0500578_0195725_437_952 | 170 |
| 641 | 3300053090 | Ga0500646_0038137 | Ga0500646_0038137_539_1054 | 170 |
| 642 | 3300053092 | Ga0500583_0168375 | Ga0500583_0168375_529_1044 | 170 |
| 643 | 3300053094 | Ga0500566_0000983 | Ga0500566_0000983_10974_11489 | 170 |
| 644 | 3300053094 | Ga0500566_0011880 | Ga0500566_0011880_2043_2558 | 170 |
| 645 | 3300053095 | Ga0500640_001204 | Ga0500640_001204_2075_2590 | 170 |
| 646 | 3300053102 | Ga0500554_000512 | Ga0500554_000512_4980_5495 | 170 |
| 647 | 3300053118 | Ga0500594_0055888 | Ga0500594_0055888_264_779 | 170 |
| 648 | 3300053119 | Ga0500595_000017 | Ga0500595_000017_149729_150244 | 170 |
| 649 | 3300053120 | Ga0500597_074498 | Ga0500597_074498_651_1166 | 170 |
| 650 | 3300053120 | Ga0500597_265858 | Ga0500597_265858_162_677 | 170 |
| 651 | 3300053121 | Ga0500607_174195 | Ga0500607_174195_109_624 | 170 |
| 652 | 3300053123 | Ga0500614_002961 | Ga0500614_002961_615_1130 | 170 |
| 653 | 3300053123 | Ga0500614_035288 | Ga0500614_035288_21_536 | 170 |
| 654 | 3300053130 | Ga0500642_0020210 | Ga0500642_0020210_1547_2062 | 170 |
| 655 | 3300053130 | Ga0500642_0139687 | Ga0500642_0139687_526_1041 | 170 |
| 656 | 3300053136 | Ga0500559_0006312 | Ga0500559_0006312_744_1259 | 170 |
| 657 | 3300053139 | Ga0500568_0107481 | Ga0500568_0107481_323_838 | 170 |
| 658 | 3300053144 | Ga0500585_060518 | Ga0500585_060518_83_598 | 170 |
| 659 | 3300053154 | Ga0500619_022090 | Ga0500619_022090_1258_1773 | 170 |
| 660 | 3300053158 | Ga0500627_0258592 | Ga0500627_0258592_97_612 | 170 |
| 661 | 3300053163 | Ga0500639_131510 | Ga0500639_131510_444_959 | 170 |
| 662 | 3300053177 | Ga0500636_0216542 | Ga0500636_0216542_470_985 | 170 |
| 663 | 3300053177 | Ga0500636_0216971 | Ga0500636_0216971_342_857 | 170 |
| 664 | 3300054114 | Ga0501084_0000002 | Ga0501084_0000002_216557_217072 | 170 |
| 665 | 3300054114 | Ga0501084_0108988 | Ga0501084_0108988_663_1178 | 170 |
| 666 | 3300054114 | Ga0501084_0784512 | Ga0501084_0784512_41_556 | 170 |
| 667 | 3300060353 | Ga0501082_0009842 | Ga0501082_0009842_338_853 | 170 |
| 668 | 3300060353 | Ga0501082_0045856 | Ga0501082_0045856_2183_2782 | 170 |
| 669 | 3300060353 | Ga0501082_0221171 | Ga0501082_0221171_187_702 | 170 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8t8l-assembly1.cif.gz_A | structure of domain of unknown function 507 (duf507) in space group p3(2)21 | 0.7259 | 1 | 170 |
| 8t8l-assembly1.cif.gz_A | structure of domain of unknown function 507 (duf507) in space group p3(2)21 | 0.7223 | 1 | 170 |
| 3of4-assembly2.cif.gz_C-2 | crystal structure of a fmn/fad- and nad(p)h-dependent nitroreductase (nfnb, il2077) from idiomarina loihiensis l2tr at 1.90 a resolution | 0.4428 | 51 | 123 |
| 8bqs-assembly1.cif.gz_AF | cryo-em structure of the i-ii-iii2-iv2 respiratory supercomplex from tetrahymena thermophila | 0.3798 | 32 | 101 |
| 5fnn-assembly2.cif.gz_B | iron and selenomethionine containing iron sulfur cluster repair protein ytfe | 0.365 | 5 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8N815_49_172_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.5159 | 12 | 125 | 1.10.472.10 |
| af_Q8N815_49_172_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.4799 | 12 | 125 | 1.10.472.10 |
| af_K7LKA4_9_392_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.4667 | 8 | 121 | 1.20.1530.20 |
| 3l8rG00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.4282 | 29 | 127 | 1.20.58.80 |
| af_I1L0X1_75_228_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.3907 | 5 | 127 | 1.20.140.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5Q8F1-F1-model_v4 | DUF507 family protein | 0.9839 | 2 | 170 |
|
| AF-A0A7C5Q8F1-F1-model_v4 | DUF507 family protein | 0.9726 | 2 | 170 |
|
| AF-A0A7C4DLI6-F1-model_v4 | DUF507 family protein | 0.9693 | 1 | 127 |
|
| AF-A0A2N2H1W8-F1-model_v4 | DUF507 domain-containing protein | 0.9631 | 1 | 170 |
|
| AF-A0A7Y5GZD8-F1-model_v4 | DUF507 family protein | 0.9599 | 1 | 168 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar