F473969

General Info

Members Datasets Scaffolds Average Seq Length
669 317 669 171

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100739847|Ga0070680_1007398472
Length 202
Sequence LRFDPRLSRENGRCREIHEAGIVSLTALWGAPITRGEKMRLYSGKIPAIAGEVVKALIESGDIAVVDRNEAEMDAQAVLKEYLRLDREITEKAKDALQKKGLPYEQFGRIKRALAHEKGFGLGEEALEWMTNQMIESFMQSPHIDEIFAEDTVLRKRMADVLKKHMQVDEELKIRNLEEGTATWEIEYQKVLDQMKRNRGLE

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
150 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
151 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
154 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
155 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
156 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
167 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
183 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
184 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
185 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
211 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
212 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
213 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
214 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
215 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
253 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
272 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
273 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
274 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
275 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
276 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
277 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
278 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
284 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
287 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
288 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
298 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
299 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
300 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
301 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
302 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
303 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
304 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
305 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
306 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
307 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
308 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
309 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
310 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
311 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
312 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
313 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
314 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
315 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.04
Nodule 0
Rhizoplane 4.04
Rhizosphere 89.54
Stem 0
Stem Tuber 0
Unclassified 2.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10113803 3300003323 Bacteria 3797
2 rootH1_10113805 3300003323 Bacteria 2953
3 Ga0065707_10571873 3300005295 Unclassified 707
4 Ga0070658_10004177 3300005327 Bacteria 11813
5 Ga0070658_10250431 3300005327 Bacteria 1503
6 Ga0070658_10652810 3300005327 Bacteria 913
7 Ga0070658_11012103 3300005327 Bacteria 723
8 Ga0070683_100001809 3300005329 Bacteria 16673
9 Ga0070683_100136278 3300005329 Bacteria 2325
10 Ga0070683_100289120 3300005329 Bacteria 1559
11 Ga0070683_100567100 3300005329 Bacteria 1086
12 Ga0070690_100030672 3300005330 Bacteria 3343
13 Ga0070690_100050166 3300005330 Bacteria 2662
14 Ga0070670_100007137 3300005331 Bacteria 9460
15 Ga0068869_100417443 3300005334 Unclassified 1106
16 Ga0070666_10087093 3300005335 Bacteria 2140
17 Ga0070680_100073940 3300005336 Bacteria 2803
18 Ga0070680_100739847 3300005336 Bacteria 847
19 Ga0070682_100045975 3300005337 Bacteria 2708
20 Ga0070682_100107781 3300005337 Unclassified 1851
21 Ga0070682_101553339 3300005337 Bacteria 571
22 Ga0068868_100585841 3300005338 Unclassified 987
23 Ga0068868_100989746 3300005338 Archaea 769
24 Ga0070660_100417576 3300005339 Bacteria 1111
25 Ga0070689_100000018 3300005340 Bacteria 153256
26 Ga0070689_100064580 3300005340 Bacteria 2849
27 Ga0070689_100354370 3300005340 Bacteria 1232
28 Ga0070689_100367332 3300005340 Bacteria 1210
29 Ga0070689_100405936 3300005340 Bacteria 1152
30 Ga0070687_100000438 3300005343 Bacteria 14065
31 Ga0070687_100048081 3300005343 Bacteria 2192
32 Ga0070687_100359932 3300005343 Bacteria 942
33 Ga0070692_10188933 3300005345 Unclassified 1199
34 Ga0070668_100251626 3300005347 Unclassified 1467
35 Ga0070675_100110103 3300005354 Bacteria 2329
36 Ga0070675_100273051 3300005354 Bacteria 1484
37 Ga0070675_101450756 3300005354 Bacteria 633
38 Ga0070671_100186601 3300005355 Bacteria 1757
39 Ga0070673_100547232 3300005364 Bacteria 1051
40 Ga0070688_100006544 3300005365 Bacteria 6231
41 Ga0070688_100092787 3300005365 Bacteria 1975
42 Ga0070688_100143873 3300005365 Bacteria 1623
43 Ga0070688_100277030 3300005365 Bacteria 1204
44 Ga0070659_100078159 3300005366 Bacteria 2639
45 Ga0070659_101164292 3300005366 Bacteria 681
46 Ga0070659_101230173 3300005366 Viruses 663
47 Ga0070709_10346747 3300005434 Bacteria 1096
48 Ga0070709_10387247 3300005434 Unclassified 1041
49 Ga0070701_10164240 3300005438 Bacteria 1288
50 Ga0070711_100853679 3300005439 Bacteria 775
51 Ga0070705_100269681 3300005440 Bacteria 1205
52 Ga0070700_100256787 3300005441 Bacteria 1256
53 Ga0070694_100137900 3300005444 Bacteria 1769
54 Ga0070694_100621798 3300005444 Unclassified 872
55 Ga0070708_100233490 3300005445 Bacteria 1726
56 Ga0070678_100048916 3300005456 Bacteria 3048
57 Ga0070678_100312593 3300005456 Bacteria 1339
58 Ga0070681_10034342 3300005458 Bacteria 5092
59 Ga0070681_10120316 3300005458 Bacteria 2561
60 Ga0070681_10316519 3300005458 Bacteria 1470
61 Ga0070685_10020753 3300005466 Bacteria 3559
62 Ga0070707_101116055 3300005468 Bacteria 755
63 Ga0070698_100004067 3300005471 Bacteria 16076
64 Ga0070698_100015147 3300005471 Bacteria 8153
65 Ga0070698_100742138 3300005471 Unclassified 925
66 Ga0070679_100002586 3300005530 Bacteria 16447
67 Ga0070679_100002759 3300005530 Bacteria 15976
68 Ga0070679_100045791 3300005530 Bacteria 4359
69 Ga0070679_100389001 3300005530 Bacteria 1341
70 Ga0070679_100765132 3300005530 Bacteria 909
71 Ga0070684_100064203 3300005535 Bacteria 3220
72 Ga0070684_100955125 3300005535 Bacteria 804
73 Ga0068853_100018010 3300005539 Bacteria 5839
74 Ga0070672_100050698 3300005543 Bacteria 3234
75 Ga0070672_100220740 3300005543 Bacteria 1590
76 Ga0070672_100434671 3300005543 Unclassified 1129
77 Ga0070686_100066079 3300005544 Bacteria 2351
78 Ga0070686_100451044 3300005544 Bacteria 989
79 Ga0070693_100310212 3300005547 Bacteria 1067
80 Ga0070665_100005092 3300005548 Bacteria 13634
81 Ga0070665_100360029 3300005548 Bacteria 1461
82 Ga0070665_100839713 3300005548 Bacteria 932
83 Ga0070665_100890438 3300005548 Bacteria 903
84 Ga0070704_100155710 3300005549 Bacteria 1802
85 Ga0070704_100422311 3300005549 Bacteria 1142
86 Ga0070704_101210924 3300005549 Bacteria 689
87 Ga0070704_101486948 3300005549 Unclassified 623
88 Ga0068855_100042142 3300005563 Bacteria 5409
89 Ga0068855_100044129 3300005563 Bacteria 5277
90 Ga0068855_100099652 3300005563 Bacteria 3346
91 Ga0068855_100396082 3300005563 Bacteria 1514
92 Ga0068855_100854693 3300005563 Unclassified 964
93 Ga0068857_101110367 3300005577 Unclassified 764
94 Ga0068854_100925076 3300005578 Bacteria 768
95 Ga0068856_100071957 3300005614 Bacteria 3423
96 Ga0068856_100099460 3300005614 Bacteria 2900
97 Ga0068856_100266013 3300005614 Bacteria 1730
98 Ga0070702_100144811 3300005615 Unclassified 1518
99 Ga0070702_100451483 3300005615 Bacteria 933
100 Ga0068852_100100836 3300005616 Bacteria 2606
101 Ga0068852_100128954 3300005616 Bacteria 2327
102 Ga0068859_100003886 3300005617 Bacteria 15256
103 Ga0068859_100145292 3300005617 Bacteria 2446
104 Ga0068859_100478174 3300005617 Bacteria 1341
105 Ga0068859_101510063 3300005617 Unclassified 741
106 Ga0068864_100285349 3300005618 Unclassified 1542
107 Ga0068864_101321523 3300005618 Unclassified 722
108 Ga0068866_10068111 3300005718 Bacteria 1871
109 Ga0068866_10234842 3300005718 Unclassified 1114
110 Ga0068861_100047232 3300005719 Bacteria 3249
111 Ga0068863_100110103 3300005841 Bacteria 2622
112 Ga0068858_100061393 3300005842 Bacteria 3475
113 Ga0068860_100331999 3300005843 Bacteria 1494
114 Ga0068860_100829599 3300005843 Bacteria 939
115 Ga0068862_100127217 3300005844 Bacteria 2250
116 Ga0068862_100897036 3300005844 Bacteria 871
117 Ga0081455_10057468 3300005937 Bacteria 3296
118 Ga0081538_10218608 3300005981 Unclassified 758
119 Ga0081538_10236316 3300005981 Bacteria 709
120 Ga0070717_10044568 3300006028 Bacteria 3623
121 Ga0070717_10047790 3300006028 Bacteria 3507
122 Ga0070716_100027828 3300006173 Bacteria 3041
123 Ga0070712_100664917 3300006175 Bacteria 886
124 Ga0097621_100224434 3300006237 Bacteria 1638
125 Ga0097621_100290742 3300006237 Unclassified 1441
126 Ga0097621_100329530 3300006237 Bacteria 1354
127 Ga0097621_100391454 3300006237 Unclassified 1243
128 Ga0068871_100862035 3300006358 Unclassified 838
129 Ga0075430_100069851 3300006846 Bacteria 2946
130 Ga0075430_100724475 3300006846 Unclassified 820
131 Ga0075433_11192576 3300006852 Unclassified 661
132 Ga0075429_100002168 3300006880 Bacteria 16391
133 Ga0075429_100053377 3300006880 Bacteria 3517
134 Ga0075429_100548929 3300006880 Bacteria 1013
135 Ga0068865_100004469 3300006881 Bacteria 8438
136 Ga0068865_100162886 3300006881 Bacteria 1703
137 Ga0097620_100003886 3300006931 Bacteria 15256
138 Ga0097620_100145283 3300006931 Bacteria 2446
139 Ga0097620_100478205 3300006931 Bacteria 1341
140 Ga0097620_101510074 3300006931 Unclassified 741
141 Ga0075435_100349275 3300007076 Bacteria 1268
142 Ga0105240_10004581 3300009093 Bacteria 20959
143 Ga0105240_10736817 3300009093 Bacteria 1073
144 Ga0111539_10041391 3300009094 Bacteria 5539
145 Ga0111539_10118985 3300009094 Unclassified 3095
146 Ga0111539_10268651 3300009094 Bacteria 1985
147 Ga0111539_10873641 3300009094 Bacteria 1046
148 Ga0111539_11170879 3300009094 Bacteria 893
149 Ga0105245_10000072 3300009098 Bacteria 105617
150 Ga0105245_10752747 3300009098 Bacteria 1010
151 Ga0105245_11278919 3300009098 Bacteria 782
152 Ga0114129_10174875 3300009147 Bacteria 2925
153 Ga0114129_10622251 3300009147 Unclassified 1396
154 Ga0114129_10913190 3300009147 Bacteria 1112
155 Ga0114129_11109646 3300009147 Bacteria 990
156 Ga0105243_10436838 3300009148 Bacteria 1225
157 Ga0105243_10714723 3300009148 Bacteria 978
158 Ga0105241_10666874 3300009174 Unclassified 946
159 Ga0105241_11491943 3300009174 Unclassified 650
160 Ga0105242_10410989 3300009176 Unclassified 1266
161 Ga0105242_10721372 3300009176 Archaea 978
162 Ga0105248_11157124 3300009177 Bacteria 874
163 Ga0105237_10000014 3300009545 Bacteria 293492
164 Ga0105237_10068855 3300009545 Bacteria 3533
165 Ga0105237_10518793 3300009545 Bacteria 1198
166 Ga0105237_10558821 3300009545 Bacteria 1151
167 Ga0105238_10008178 3300009551 Bacteria 10462
168 Ga0105238_10020007 3300009551 Bacteria 6813
169 Ga0105238_10288280 3300009551 Bacteria 1624
170 Ga0105238_10511480 3300009551 Bacteria 1203
171 Ga0105238_11046936 3300009551 Bacteria 838
172 Ga0105249_10169215 3300009553 Bacteria 2118
173 Ga0105249_10192196 3300009553 Bacteria 1993
174 Ga0105239_10077252 3300010375 Bacteria 3664
175 Ga0105239_10710355 3300010375 Bacteria 1150
176 Ga0105246_11291614 3300011119 Bacteria 676
177 Ga0105246_11450197 3300011119 Unclassified 642
178 Ga0157369_10885145 3300013105 Bacteria 916
179 Ga0157369_11168735 3300013105 Bacteria 786
180 Ga0157374_10044255 3300013296 Bacteria 4115
181 Ga0157374_10096208 3300013296 Bacteria 2832
182 Ga0157374_10953278 3300013296 Unclassified 877
183 Ga0157374_11102220 3300013296 Bacteria 814
184 Ga0157378_10338060 3300013297 Unclassified 1467
185 Ga0157378_10377713 3300013297 Bacteria 1391
186 Ga0157378_11099223 3300013297 Bacteria 832
187 Ga0163162_10495001 3300013306 Bacteria 1353
188 Ga0157372_10064255 3300013307 Bacteria 4118
189 Ga0157372_11358423 3300013307 Bacteria 819
190 Ga0163163_11091899 3300014325 Unclassified 861
191 Ga0157377_10437107 3300014745 Unclassified 900
192 Ga0157379_10237470 3300014968 Bacteria 1653
193 Ga0157379_10808372 3300014968 Bacteria 885
194 Ga0157376_10355224 3300014969 Unclassified 1404
195 Ga0157376_10651438 3300014969 Bacteria 1054
196 Ga0157376_10776662 3300014969 Bacteria 969
197 Ga0157376_10866669 3300014969 Bacteria 919
198 Ga0197907_10644234 3300020069 Bacteria 746
199 Ga0206356_10488560 3300020070 Bacteria 1080
200 Ga0206352_11294615 3300020078 Unclassified 656
201 Ga0206354_11390788 3300020081 Unclassified 1097
202 Ga0207697_10009698 3300025315 Bacteria 4147
203 Ga0207697_10168681 3300025315 Bacteria 957
204 Ga0207692_10052812 3300025898 Bacteria 2067
205 Ga0207692_10289510 3300025898 Bacteria 993
206 Ga0207685_10590573 3300025905 Bacteria 595
207 Ga0207699_10068257 3300025906 Bacteria 2165
208 Ga0207645_10000305 3300025907 Bacteria 41231
209 Ga0207643_10151141 3300025908 Bacteria 1392
210 Ga0207705_10001999 3300025909 Bacteria 15855
211 Ga0207705_10108306 3300025909 Bacteria 2051
212 Ga0207707_10012710 3300025912 Bacteria 7318
213 Ga0207707_10021786 3300025912 Bacteria 5601
214 Ga0207707_10087528 3300025912 Bacteria 2721
215 Ga0207707_10107531 3300025912 Bacteria 2438
216 Ga0207707_10259232 3300025912 Bacteria 1509
217 Ga0207695_10003405 3300025913 Bacteria 22458
218 Ga0207695_10094121 3300025913 Bacteria 3004
219 Ga0207671_10000270 3300025914 Bacteria 77396
220 Ga0207671_10131744 3300025914 Unclassified 1919
221 Ga0207693_10420527 3300025915 Bacteria 1045
222 Ga0207663_10819534 3300025916 Bacteria 742
223 Ga0207660_10023885 3300025917 Bacteria 4133
224 Ga0207660_10159462 3300025917 Bacteria 1739
225 Ga0207660_10159532 3300025917 Bacteria 1739
226 Ga0207660_10212875 3300025917 Bacteria 1514
227 Ga0207662_10001910 3300025918 Bacteria 10272
228 Ga0207662_10046301 3300025918 Unclassified 2573
229 Ga0207662_10047120 3300025918 Bacteria 2553
230 Ga0207662_10072131 3300025918 Bacteria 2092
231 Ga0207662_10082136 3300025918 Bacteria 1968
232 Ga0207662_10578370 3300025918 Bacteria 780
233 Ga0207649_10237412 3300025920 Bacteria 1307
234 Ga0207652_10004517 3300025921 Bacteria 11297
235 Ga0207652_10008761 3300025921 Bacteria 8143
236 Ga0207652_10067593 3300025921 Bacteria 3099
237 Ga0207652_10231423 3300025921 Unclassified 1665
238 Ga0207652_10436937 3300025921 Archaea 1180
239 Ga0207652_10481101 3300025921 Bacteria 1118
240 Ga0207646_10478056 3300025922 Bacteria 1123
241 Ga0207646_10487958 3300025922 Unclassified 1111
242 Ga0207646_11055033 3300025922 Bacteria 716
243 Ga0207681_10002259 3300025923 Bacteria 12251
244 Ga0207694_10010604 3300025924 Bacteria 6957
245 Ga0207694_10013117 3300025924 Bacteria 6239
246 Ga0207694_10118235 3300025924 Bacteria 2114
247 Ga0207694_10504021 3300025924 Bacteria 1014
248 Ga0207650_10008878 3300025925 Bacteria 6866
249 Ga0207650_10138454 3300025925 Bacteria 1911
250 Ga0207650_10194812 3300025925 Unclassified 1621
251 Ga0207659_10016522 3300025926 Bacteria 4804
252 Ga0207659_10026438 3300025926 Bacteria 3916
253 Ga0207659_11165279 3300025926 Bacteria 663
254 Ga0207687_10002588 3300025927 Bacteria 12277
255 Ga0207687_10877173 3300025927 Bacteria 767
256 Ga0207644_10072396 3300025931 Bacteria 2524
257 Ga0207690_10336187 3300025932 Bacteria 1191
258 Ga0207690_10989459 3300025932 Bacteria 699
259 Ga0207686_10314690 3300025934 Archaea 1167
260 Ga0207686_10332352 3300025934 Unclassified 1139
261 Ga0207709_10257805 3300025935 Bacteria 1277
262 Ga0207670_10000001 3300025936 Bacteria 949312
263 Ga0207670_10045655 3300025936 Bacteria 2905
264 Ga0207670_10253605 3300025936 Unclassified 1361
265 Ga0207670_10421693 3300025936 Bacteria 1071
266 Ga0207670_11221515 3300025936 Unclassified 636
267 Ga0207669_10002571 3300025937 Bacteria 7754
268 Ga0207704_10014734 3300025938 Bacteria 3960
269 Ga0207704_10135406 3300025938 Bacteria 1714
270 Ga0207665_10119873 3300025939 Bacteria 1857
271 Ga0207691_10035731 3300025940 Bacteria 4609
272 Ga0207691_10644810 3300025940 Bacteria 895
273 Ga0207689_10061294 3300025942 Unclassified 3093
274 Ga0207689_10190251 3300025942 Unclassified 1693
275 Ga0207689_10243204 3300025942 Bacteria 1488
276 Ga0207689_11271457 3300025942 Bacteria 619
277 Ga0207661_10000960 3300025944 Bacteria 18978
278 Ga0207661_10525690 3300025944 Unclassified 1082
279 Ga0207667_10127810 3300025949 Bacteria 2618
280 Ga0207667_10231031 3300025949 Bacteria 1894
281 Ga0207667_10254992 3300025949 Bacteria 1794
282 Ga0207667_10890483 3300025949 Bacteria 882
283 Ga0207651_10002205 3300025960 Bacteria 9219
284 Ga0207651_10067837 3300025960 Bacteria 2512
285 Ga0207712_10157986 3300025961 Bacteria 1758
286 Ga0207712_10246511 3300025961 Bacteria 1442
287 Ga0207668_10006597 3300025972 Bacteria 6862
288 Ga0207668_10214698 3300025972 Bacteria 1541
289 Ga0207640_10290875 3300025981 Bacteria 1288
290 Ga0207658_10292796 3300025986 Bacteria 1400
291 Ga0207658_10473770 3300025986 Bacteria 1112
292 Ga0207677_10426600 3300026023 Bacteria 1131
293 Ga0207677_11103795 3300026023 Bacteria 723
294 Ga0207703_10064050 3300026035 Bacteria 3016
295 Ga0207703_10625597 3300026035 Bacteria 1020
296 Ga0207639_10017468 3300026041 Bacteria 5086
297 Ga0207639_10708444 3300026041 Bacteria 934
298 Ga0207708_10006083 3300026075 Bacteria 8950
299 Ga0207708_10084489 3300026075 Bacteria 2441
300 Ga0207702_10096229 3300026078 Bacteria 2603
301 Ga0207702_10280958 3300026078 Bacteria 1574
302 Ga0207648_10003927 3300026089 Bacteria 15482
303 Ga0207676_10965426 3300026095 Unclassified 838
304 Ga0207674_10075073 3300026116 Bacteria 3391
305 Ga0207674_10156323 3300026116 Bacteria 2236
306 Ga0207674_10202300 3300026116 Bacteria 1935
307 Ga0207674_10223423 3300026116 Bacteria 1831
308 Ga0207674_10293133 3300026116 Bacteria 1575
309 Ga0207674_10686137 3300026116 Bacteria 989
310 Ga0207675_100013757 3300026118 Bacteria 7547
311 Ga0207675_100037626 3300026118 Bacteria 4513
312 Ga0207675_101205443 3300026118 Bacteria 777
313 Ga0207683_10148526 3300026121 Bacteria 2115
314 Ga0207683_10346262 3300026121 Bacteria 1363
315 Ga0207683_10423630 3300026121 Bacteria 1226
316 Ga0207698_10105753 3300026142 Bacteria 2346
317 Ga0207698_10215000 3300026142 Bacteria 1732
318 Ga0207428_10457821 3300027907 Unclassified 930
319 Ga0268266_10002761 3300028379 Bacteria 18352
320 Ga0268266_10257722 3300028379 Bacteria 1615
321 Ga0268266_10361059 3300028379 Bacteria 1367
322 Ga0268265_10091200 3300028380 Bacteria 2436
323 Ga0268264_10632660 3300028381 Bacteria 1057
324 Ga0265337_1015017 3300028556 Bacteria 2550
325 Ga0265326_10002726 3300028558 Bacteria 5927
326 Ga0265319_1029533 3300028563 Bacteria 1924
327 Ga0265319_1051690 3300028563 Bacteria 1355
328 Ga0265334_10014224 3300028573 Unclassified 3318
329 Ga0265334_10153170 3300028573 Bacteria 812
330 Ga0265334_10211168 3300028573 Unclassified 672
331 Ga0265318_10000001 3300028577 Bacteria 500711
332 Ga0265318_10002071 3300028577 Bacteria 10985
333 Ga0265318_10113314 3300028577 Bacteria 997
334 Ga0265323_10000747 3300028653 Bacteria 17451
335 Ga0265323_10008433 3300028653 Bacteria 4249
336 Ga0265323_10099692 3300028653 Unclassified 962
337 Ga0265322_10034737 3300028654 Unclassified 1436
338 Ga0265336_10007772 3300028666 Bacteria 3800
339 Ga0307517_10019612 3300028786 Bacteria 8665
340 Ga0307515_10010405 3300028794 Bacteria 17822
341 Ga0265338_10001115 3300028800 Bacteria 44587
342 Ga0265338_10018541 3300028800 Bacteria 7445
343 Ga0265338_10031496 3300028800 Bacteria 5199
344 Ga0265338_10142082 3300028800 Bacteria 1879
345 Ga0265338_10162017 3300028800 Bacteria 1726
346 Ga0265338_10174710 3300028800 Bacteria 1643
347 Ga0265338_10358640 3300028800 Bacteria 1046
348 Ga0265324_10000172 3300029957 Bacteria 50391
349 Ga0265330_10000002 3300031235 Bacteria 481237
350 Ga0265330_10000588 3300031235 Bacteria 23647
351 Ga0265330_10000838 3300031235 Bacteria 19299
352 Ga0265330_10001551 3300031235 Bacteria 13211
353 Ga0265330_10002799 3300031235 Bacteria 9339
354 Ga0265330_10003798 3300031235 Bacteria 7786
355 Ga0265330_10004572 3300031235 Bacteria 7004
356 Ga0265330_10043045 3300031235 Unclassified 1999
357 Ga0265330_10121421 3300031235 Bacteria 1113
358 Ga0265332_10000242 3300031238 Bacteria 43401
359 Ga0265332_10000331 3300031238 Bacteria 36017
360 Ga0265332_10004135 3300031238 Bacteria 6879
361 Ga0265332_10064850 3300031238 Bacteria 1560
362 Ga0265332_10102899 3300031238 Bacteria 1204
363 Ga0265328_10000280 3300031239 Bacteria 23796
364 Ga0265328_10000683 3300031239 Bacteria 15763
365 Ga0265328_10012366 3300031239 Unclassified 3397
366 Ga0265320_10000007 3300031240 Bacteria 331219
367 Ga0265320_10002363 3300031240 Bacteria 13201
368 Ga0265320_10011167 3300031240 Bacteria 5297
369 Ga0265320_10011806 3300031240 Bacteria 5120
370 Ga0265320_10288858 3300031240 Bacteria 726
371 Ga0265320_10342532 3300031240 Unclassified 660
372 Ga0265325_10000856 3300031241 Bacteria 21940
373 Ga0265325_10008903 3300031241 Bacteria 5898
374 Ga0265325_10020117 3300031241 Unclassified 3683
375 Ga0265329_10000098 3300031242 Bacteria 41248
376 Ga0265329_10000806 3300031242 Bacteria 15941
377 Ga0265329_10015809 3300031242 Bacteria 2629
378 Ga0265340_10000741 3300031247 Bacteria 18540
379 Ga0265340_10126383 3300031247 Unclassified 1175
380 Ga0265339_10000141 3300031249 Bacteria 60047
381 Ga0265339_10010416 3300031249 Bacteria 5776
382 Ga0265339_10042307 3300031249 Unclassified 2522
383 Ga0265339_10065697 3300031249 Bacteria 1944
384 Ga0265339_10146761 3300031249 Bacteria 1196
385 Ga0265339_10238733 3300031249 Unclassified 883
386 Ga0265339_10306876 3300031249 Bacteria 756
387 Ga0265331_10000001 3300031250 Bacteria 798836
388 Ga0265331_10007316 3300031250 Bacteria 6396
389 Ga0265331_10110045 3300031250 Bacteria 1264
390 Ga0265331_10238382 3300031250 Bacteria 816
391 Ga0265316_10000053 3300031344 Bacteria 125221
392 Ga0265316_10000108 3300031344 Bacteria 88867
393 Ga0265316_10000583 3300031344 Bacteria 40804
394 Ga0265316_10000878 3300031344 Bacteria 32962
395 Ga0265316_10002456 3300031344 Bacteria 19220
396 Ga0265316_10002912 3300031344 Bacteria 17515
397 Ga0265316_10006504 3300031344 Bacteria 11148
398 Ga0265316_10024023 3300031344 Bacteria 5117
399 Ga0265316_10043815 3300031344 Bacteria 3563
400 Ga0265316_10050155 3300031344 Bacteria 3284
401 Ga0265316_10180086 3300031344 Bacteria 1574
402 Ga0265316_10329649 3300031344 Bacteria 1107
403 Ga0307513_10213379 3300031456 Bacteria 1759
404 Ga0307509_10000164 3300031507 Bacteria 104223
405 Ga0307509_10027240 3300031507 Bacteria 6362
406 Ga0307509_10114355 3300031507 Bacteria 2694
407 Ga0265313_10000090 3300031595 Bacteria 90099
408 Ga0265313_10053988 3300031595 Bacteria 1910
409 Ga0265313_10058506 3300031595 Bacteria 1816
410 Ga0265313_10149831 3300031595 Bacteria 998
411 Ga0265313_10288722 3300031595 Unclassified 661
412 Ga0307508_10154304 3300031616 Unclassified 1900
413 Ga0307508_10154665 3300031616 Bacteria 1897
414 Ga0265314_10000006 3300031711 Bacteria 540431
415 Ga0265314_10000009 3300031711 Bacteria 476805
416 Ga0265314_10005265 3300031711 Bacteria 11710
417 Ga0265314_10009719 3300031711 Bacteria 8090
418 Ga0265314_10012976 3300031711 Bacteria 6766
419 Ga0265314_10017512 3300031711 Bacteria 5622
420 Ga0265314_10030286 3300031711 Bacteria 4007
421 Ga0265314_10437368 3300031711 Bacteria 699
422 Ga0265342_10000065 3300031712 Bacteria 112156
423 Ga0265342_10000654 3300031712 Bacteria 36347
424 Ga0265342_10002973 3300031712 Bacteria 14234
425 Ga0265342_10007901 3300031712 Bacteria 7712
426 Ga0265342_10016011 3300031712 Bacteria 4911
427 Ga0265342_10018799 3300031712 Bacteria 4467
428 Ga0265342_10033590 3300031712 Unclassified 3153
429 Ga0265342_10058193 3300031712 Unclassified 2284
430 Ga0265342_10098237 3300031712 Bacteria 1671
431 Ga0265342_10188316 3300031712 Unclassified 1127
432 Ga0265342_10189915 3300031712 Bacteria 1121
433 Ga0265342_10364525 3300031712 Bacteria 750
434 Ga0316576_10000030 3300031727 Bacteria 41956
435 Ga0316576_10127528 3300031727 Bacteria 1913
436 Ga0316576_10657081 3300031727 Unclassified 762
437 Ga0307405_10621681 3300031731 Unclassified 884
438 Ga0307406_10142112 3300031901 Unclassified 1700
439 Ga0307412_10249621 3300031911 Bacteria 1377
440 Ga0307415_100047187 3300032126 Bacteria 2899
441 Ga0307415_100683764 3300032126 Bacteria 924
442 Ga0307507_10342761 3300033179 Bacteria 884
443 Ga0307507_10546470 3300033179 Bacteria 612
444 Ga0373950_0000015 3300034818 Bacteria 281101
445 Ga0373950_0000106 3300034818 Bacteria 18811
446 Ga0373944_0254710 3300035089 Unclassified 649
447 Ga0373949_0000228 3300035090 Bacteria 21254
448 Ga0373923_0195783 3300035111 Bacteria 933
449 Ga0373923_0302451 3300035111 Bacteria 757
450 Ga0373936_0000009 3300035113 Bacteria 263478
451 Ga0373941_0047170 3300035115 Bacteria 1356
452 Ga0373941_0301582 3300035115 Unclassified 640
453 Ga0373945_0012235 3300035116 Bacteria 2847
454 Ga0373953_0050652 3300035117 Bacteria 1678
455 Ga0373954_0027481 3300035118 Bacteria 2612
456 Ga0373954_0248140 3300035118 Unclassified 876
457 Ga0373954_0565668 3300035118 Bacteria 563
458 Ga0373956_0054854 3300035119 Bacteria 1797
459 Ga0373956_0096269 3300035119 Bacteria 1369
460 Ga0373957_0012584 3300035120 Bacteria 2853
461 Ga0373957_0015579 3300035120 Bacteria 2619
462 Ga0373957_0038128 3300035120 Bacteria 1798
463 Ga0373946_0521887 3300035171 Bacteria 611
464 Ga0373955_0045088 3300035172 Bacteria 2378
465 Ga0373955_0093032 3300035172 Bacteria 1721
466 Ga0373955_0200800 3300035172 Bacteria 1187
467 Ga0373955_0234302 3300035172 Bacteria 1099
468 Ga0373961_0000132 3300035241 Bacteria 38247
469 Ga0373933_0000801 3300035724 Bacteria 19152
470 Ga0373933_0045864 3300035724 Bacteria 2593
471 Ga0373933_0191542 3300035724 Bacteria 1306
472 Ga0373933_0382750 3300035724 Bacteria 916
473 Ga0373947_0068533 3300035725 Bacteria 2170
474 Ga0373947_1028996 3300035725 Bacteria 562
475 Ga0373937_0007263 3300036401 Bacteria 9589
476 Ga0373937_0007632 3300036401 Bacteria 9371
477 Ga0373937_0182473 3300036401 Bacteria 1971
478 Ga0373937_0248621 3300036401 Bacteria 1676
479 Ga0373937_0643620 3300036401 Bacteria 1005
480 Ga0316582_0067751 3300036647 Unclassified 2304
481 Ga0316584_0000106 3300036712 Bacteria 34818
482 Ga0373925_0065036 3300037068 Bacteria 2747
483 Ga0373925_0188831 3300037068 Bacteria 1634
484 Ga0395899_0010235 3300037312 Bacteria 7186
485 Ga0395899_0192670 3300037312 Unclassified 1426
486 Ga0395900_0612644 3300037418 Bacteria 1028
487 Ga0395900_0756919 3300037418 Unclassified 901
488 Ga0395898_0082216 3300037466 Bacteria 3105
489 Ga0395898_0964670 3300037466 Unclassified 789
490 Ga0395905_0449008 3300037471 Bacteria 1187
491 Ga0395905_0902289 3300037471 Bacteria 787
492 Ga0395901_0206849 3300038443 Bacteria 2055
493 Ga0436365_1570115 3300039437 Unclassified 1638
494 Ga0436363_0344008 3300039450 Bacteria 1464
495 Ga0451787_397521 3300041441 Unclassified 747
496 Ga0451793_1704137 3300041452 Unclassified 932
497 Ga0451797_0791634 3300041453 Bacteria 665
498 Ga0451802_0260369 3300041460 Bacteria 1774
499 Ga0451804_1020604 3300041463 Unclassified 535
500 Ga0451807_2163525 3300041486 Bacteria 803
501 Ga0451853_1406462 3300041512 Unclassified 1043
502 Ga0451853_3702505 3300041512 Unclassified 642
503 Ga0451577_0028182 3300042876 Bacteria 5081
504 Ga0451577_0452357 3300042876 Bacteria 1166
505 Ga0466972_0124667 3300044658 Bacteria 1214
506 Ga0453684_0000078 3300044712 Bacteria 428794
507 Ga0453684_0050881 3300044712 Bacteria 5441
508 Ga0453684_0189167 3300044712 Bacteria 2409
509 Ga0453684_0339694 3300044712 Unclassified 1696
510 Ga0453684_0654278 3300044712 Unclassified 1146
511 Ga0466957_0307876 3300044842 Bacteria 1066
512 Ga0451576_0155695 3300045051 Bacteria 2384
513 Ga0451576_1592132 3300045051 Unclassified 678
514 Ga0466967_0371022 3300045976 Bacteria 1388
515 Ga0466967_1058577 3300045976 Bacteria 808
516 Ga0495590_0033611 3300046457 Unclassified 1793
517 Ga0495651_0045584 3300046462 Bacteria 3397
518 Ga0495582_0696781 3300046473 Bacteria 588
519 Ga0495662_0337042 3300046476 Unclassified 741
520 Ga0495664_0739567 3300046477 Bacteria 580
521 Ga0495628_0120726 3300046516 Bacteria 2011
522 Ga0495630_0004817 3300046517 Bacteria 9465
523 Ga0495652_0436993 3300046529 Bacteria 919
524 Ga0495586_0657002 3300046535 Unclassified 606
525 Ga0495587_0212397 3300046536 Bacteria 1092
526 Ga0495622_0164321 3300046557 Bacteria 1000
527 Ga0495634_0002302 3300046642 Bacteria 15979
528 Ga0495634_0491710 3300046642 Unclassified 720
529 Ga0495657_0160202 3300046675 Bacteria 1393
530 Ga0495623_0094467 3300046679 Bacteria 1829
531 Ga0495674_0017181 3300047319 Bacteria 6735
532 Ga0495684_0311672 3300047471 Bacteria 1128
533 Ga0495686_0039813 3300047472 Bacteria 3000
534 Ga0495686_0093671 3300047472 Bacteria 1821
535 Ga0496101_0198767 3300048904 Unclassified 1549
536 Ga0496104_0033434 3300048907 Bacteria 4790
537 Ga0496104_0264217 3300048907 Bacteria 1633
538 Ga0496105_1196353 3300048908 Unclassified 560
539 Ga0496106_0537971 3300048909 Unclassified 938
540 Ga0496107_0053616 3300048910 Bacteria 2909
541 Ga0496108_0046394 3300048911 Bacteria 3630
542 Ga0496109_0218006 3300048912 Bacteria 1795
543 Ga0496109_0380206 3300048912 Bacteria 1334
544 Ga0496110_0828207 3300048913 Unclassified 830
545 Ga0496111_0753002 3300048914 Unclassified 707
546 Ga0496112_0211733 3300048915 Bacteria 1895
547 Ga0496114_0002777 3300048917 Bacteria 13405
548 Ga0496114_0019436 3300048917 Bacteria 5503
549 Ga0496114_0059321 3300048917 Bacteria 3196
550 Ga0496114_0077206 3300048917 Bacteria 2808
551 Ga0496114_0106945 3300048917 Bacteria 2394
552 Ga0496114_0404011 3300048917 Bacteria 1210
553 Ga0496114_0899780 3300048917 Bacteria 766
554 Ga0496115_0006149 3300048918 Bacteria 8781
555 Ga0496115_0135818 3300048918 Bacteria 2028
556 Ga0501290_047341 3300049513 Unclassified 661
557 Ga0501292_042245 3300049515 Bacteria 790
558 Ga0501034_0000327 3300049571 Bacteria 83596
559 Ga0501034_0111981 3300049571 Unclassified 2720
560 Ga0501036_0182698 3300049572 Bacteria 1765
561 Ga0501038_0201690 3300049574 Bacteria 1596
562 Ga0501042_0665344 3300049578 Bacteria 757
563 Ga0501043_0000408 3300049579 Bacteria 38659
564 Ga0501043_0373850 3300049579 Unclassified 1080
565 Ga0501046_0000438 3300049580 Bacteria 41879
566 Ga0501046_0404525 3300049580 Bacteria 986
567 Ga0501047_0000008 3300049581 Bacteria 441758
568 Ga0501047_0012216 3300049581 Bacteria 8131
569 Ga0501047_0109014 3300049581 Archaea 2651
570 Ga0501048_0063453 3300049582 Archaea 2613
571 Ga0501067_0000030 3300049583 Bacteria 87924
572 Ga0501067_0083379 3300049583 Unclassified 1773
573 Ga0501068_0007147 3300049584 Bacteria 6180
574 Ga0501068_0044351 3300049584 Unclassified 2678
575 Ga0501068_0731906 3300049584 Unclassified 647
576 Ga0501069_0003625 3300049585 Bacteria 7949
577 Ga0501069_0032569 3300049585 Bacteria 2869
578 Ga0501069_0085107 3300049585 Bacteria 1784
579 Ga0501070_0001091 3300049586 Bacteria 24388
580 Ga0501070_0008109 3300049586 Bacteria 8890
581 Ga0501070_0034368 3300049586 Bacteria 4239
582 Ga0501070_0124778 3300049586 Unclassified 2128
583 Ga0501070_1166252 3300049586 Bacteria 592
584 Ga0501071_0734071 3300049587 Unclassified 761
585 Ga0501072_0000023 3300049588 Bacteria 149177
586 Ga0501072_0159228 3300049588 Unclassified 1801
587 Ga0501073_0000481 3300049589 Bacteria 27721
588 Ga0501073_0000498 3300049589 Bacteria 27426
589 Ga0501073_0000767 3300049589 Bacteria 22755
590 Ga0501073_0104657 3300049589 Bacteria 1964
591 Ga0501073_0284111 3300049589 Unclassified 1142
592 Ga0501074_0000439 3300049590 Bacteria 24841
593 Ga0501074_0027466 3300049590 Bacteria 4127
594 Ga0501076_0805907 3300049592 Bacteria 775
595 Ga0501208_052022 3300049655 Unclassified 783
596 Ga0501216_001541 3300049660 Bacteria 3129
597 Ga0501227_000349 3300049665 Bacteria 9774
598 Ga0501227_002080 3300049665 Bacteria 4435
599 Ga0501230_000461 3300049667 Bacteria 4023
600 Ga0501233_004596 3300049668 Bacteria 2537
601 Ga0501235_019594 3300049669 Bacteria 1501
602 Ga0501260_021073 3300049689 Unclassified 707
603 Ga0501219_015625 3300049703 Unclassified 616
604 Ga0501079_0000031 3300049741 Bacteria 59419
605 Ga0501079_0216961 3300049741 Bacteria 1494
606 Ga0501080_0007570 3300049742 Bacteria 9816
607 Ga0501080_0146816 3300049742 Bacteria 2180
608 Ga0501080_0347191 3300049742 Unclassified 1340
609 Ga0501080_0623077 3300049742 Bacteria 956
610 Ga0501081_0064363 3300049743 Bacteria 2547
611 Ga0501083_0001622 3300049744 Bacteria 15387
612 Ga0501083_0004836 3300049744 Bacteria 9519
613 Ga0501083_0075030 3300049744 Bacteria 2246
614 Ga0501083_0130591 3300049744 Unclassified 1646
615 Ga0501267_004923 3300049764 Bacteria 1253
616 Ga0501035_0042339 3300049822 Bacteria 4108
617 Ga0501044_0049920 3300049823 Bacteria 4318
618 Ga0501220_03393 3300049852 Unclassified 697
619 nmdc:mga03683_345097_c1 3300050489 Bacteria 704
620 nmdc:mga03n38_406597_c1 3300050490 Bacteria 750
621 nmdc:mga05p37_1479769_c1 3300050507 Bacteria 678
622 nmdc:mga05p37_189987_c1 3300050507 Bacteria 2494
623 nmdc:mga09592_3157_c1 3300050508 Bacteria 13383
624 nmdc:mga09592_96549_c1 3300050508 Bacteria 2528
625 nmdc:mga0qj67_144070_c1 3300050509 Bacteria 1932
626 nmdc:mga0qj67_415754_c1 3300050509 Bacteria 1084
627 nmdc:mga0qj67_896508_c1 3300050509 Unclassified 699
628 nmdc:mga08y16_169856_c1 3300050511 Bacteria 2265
629 nmdc:mga08y16_5330_c1 3300050511 Bacteria 13455
630 nmdc:mga08y16_596202_c1 3300050511 Bacteria 1114
631 nmdc:mga08y16_656791_c1 3300050511 Bacteria 1052
632 nmdc:mga08y16_79762_c1 3300050511 Bacteria 3412
633 nmdc:mga08y16_901610_c1 3300050511 Bacteria 870
634 nmdc:mga08y16_941975_c1 3300050511 Unclassified 847
635 nmdc:mga0n895_1090206_c1 3300050512 Bacteria 776
636 nmdc:mga0rr50_214103_c1 3300050513 Unclassified 1588
637 nmdc:mga0rr50_367047_c1 3300050513 Bacteria 1212
638 Ga0500635_0012695 3300053080 Bacteria 2427
639 Ga0495619_0057969 3300053085 Bacteria 2570
640 Ga0500578_0195725 3300053086 Bacteria 1239
641 Ga0500646_0038137 3300053090 Bacteria 1344
642 Ga0500583_0168375 3300053092 Unclassified 1091
643 Ga0500566_0000983 3300053094 Bacteria 16425
644 Ga0500566_0011880 3300053094 Bacteria 5128
645 Ga0500640_001204 3300053095 Bacteria 7593
646 Ga0500554_000512 3300053102 Bacteria 8072
647 Ga0500594_0055888 3300053118 Bacteria 1124
648 Ga0500595_000017 3300053119 Bacteria 206032
649 Ga0500597_074498 3300053120 Bacteria 1469
650 Ga0500597_265858 3300053120 Bacteria 696
651 Ga0500607_174195 3300053121 Bacteria 964
652 Ga0500614_002961 3300053123 Bacteria 3707
653 Ga0500614_035288 3300053123 Bacteria 1245
654 Ga0500642_0020210 3300053130 Bacteria 2613
655 Ga0500642_0139687 3300053130 Bacteria 1136
656 Ga0500559_0006312 3300053136 Bacteria 5357
657 Ga0500568_0107481 3300053139 Bacteria 1044
658 Ga0500585_060518 3300053144 Bacteria 1362
659 Ga0500619_022090 3300053154 Unclassified 1843
660 Ga0500627_0258592 3300053158 Bacteria 769
661 Ga0500639_131510 3300053163 Bacteria 1185
662 Ga0500636_0216542 3300053177 Bacteria 1001
663 Ga0500636_0216971 3300053177 Bacteria 1000
664 Ga0501084_0000002 3300054114 Bacteria 273420
665 Ga0501084_0108988 3300054114 Bacteria 2327
666 Ga0501084_0784512 3300054114 Bacteria 803
667 Ga0501082_0009842 3300060353 Bacteria 8237
668 Ga0501082_0045856 3300060353 Bacteria 3769
669 Ga0501082_0221171 3300060353 Bacteria 1647

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041463 Ga0451804_1020604 Ga0451804_1020604_11_478 155
2 3300005340 Ga0070689_100000018 Ga0070689_10000001825 161
3 3300025936 Ga0207670_10000001 Ga0207670_1000000125 161
4 3300009147 Ga0114129_10913190 Ga0114129_109131901 162
5 3300005340 Ga0070689_100354370 Ga0070689_1003543702 163
6 3300005539 Ga0068853_100018010 Ga0068853_1000180103 163
7 3300005544 Ga0070686_100066079 Ga0070686_1000660794 163
8 3300005563 Ga0068855_100044129 Ga0068855_1000441297 163
9 3300005617 Ga0068859_100003886 Ga0068859_1000038865 163
10 3300005843 Ga0068860_100331999 Ga0068860_1003319992 163
11 3300005843 Ga0068860_100829599 Ga0068860_1008295992 163
12 3300006931 Ga0097620_100003886 Ga0097620_10000388612 163
13 3300009551 Ga0105238_10008178 Ga0105238_100081784 163
14 3300009551 Ga0105238_10020007 Ga0105238_100200077 163
15 3300013297 Ga0157378_11099223 Ga0157378_110992232 163
16 3300025924 Ga0207694_10010604 Ga0207694_100106046 163
17 3300025924 Ga0207694_10013117 Ga0207694_100131177 163
18 3300025949 Ga0207667_10231031 Ga0207667_102310314 163
19 3300026041 Ga0207639_10017468 Ga0207639_100174683 163
20 3300026116 Ga0207674_10156323 Ga0207674_101563232 163
21 3300028381 Ga0268264_10632660 Ga0268264_106326602 163
22 3300028563 Ga0265319_1051690 Ga0265319_10516901 163
23 3300031712 Ga0265342_10189915 Ga0265342_101899152 163
24 3300005327 Ga0070658_10004177 Ga0070658_100041772 164
25 3300005336 Ga0070680_100739847 Ga0070680_1007398472 164
26 3300005337 Ga0070682_100045975 Ga0070682_1000459752 164
27 3300005339 Ga0070660_100417576 Ga0070660_1004175762 164
28 3300005366 Ga0070659_101230173 Ga0070659_1012301731 164
29 3300005458 Ga0070681_10034342 Ga0070681_100343422 164
30 3300005530 Ga0070679_100045791 Ga0070679_1000457912 164
31 3300005563 Ga0068855_100099652 Ga0068855_1000996522 164
32 3300005578 Ga0068854_100925076 Ga0068854_1009250762 164
33 3300009093 Ga0105240_10004581 Ga0105240_100045812 164
34 3300009147 Ga0114129_10622251 Ga0114129_106222512 164
35 3300009545 Ga0105237_10000014 Ga0105237_1000001492 164
36 3300010375 Ga0105239_10077252 Ga0105239_100772522 164
37 3300025909 Ga0207705_10001999 Ga0207705_100019992 164
38 3300025912 Ga0207707_10107531 Ga0207707_101075313 164
39 3300025913 Ga0207695_10003405 Ga0207695_1000340515 164
40 3300025914 Ga0207671_10000270 Ga0207671_1000027040 164
41 3300025917 Ga0207660_10023885 Ga0207660_100238852 164
42 3300025917 Ga0207660_10212875 Ga0207660_102128752 164
43 3300025921 Ga0207652_10004517 Ga0207652_100045172 164
44 3300025921 Ga0207652_10067593 Ga0207652_100675932 164
45 3300025932 Ga0207690_10336187 Ga0207690_103361871 164
46 3300025949 Ga0207667_10127810 Ga0207667_101278102 164
47 3300025981 Ga0207640_10290875 Ga0207640_102908751 164
48 3300026116 Ga0207674_10202300 Ga0207674_102023003 164
49 3300041512 Ga0451853_1406462 Ga0451853_1406462_290_805 164
50 3300003323 rootH1_10113803 rootH1_101138035 170
51 3300003323 rootH1_10113805 rootH1_101138054 170
52 3300005295 Ga0065707_10571873 Ga0065707_105718731 170
53 3300005327 Ga0070658_10250431 Ga0070658_102504313 170
54 3300005327 Ga0070658_10652810 Ga0070658_106528102 170
55 3300005327 Ga0070658_11012103 Ga0070658_110121031 170
56 3300005329 Ga0070683_100001809 Ga0070683_1000018093 170
57 3300005329 Ga0070683_100136278 Ga0070683_1001362782 170
58 3300005329 Ga0070683_100289120 Ga0070683_1002891202 170
59 3300005329 Ga0070683_100567100 Ga0070683_1005671002 170
60 3300005330 Ga0070690_100030672 Ga0070690_1000306721 170
61 3300005330 Ga0070690_100050166 Ga0070690_1000501664 170
62 3300005331 Ga0070670_100007137 Ga0070670_10000713711 170
63 3300005334 Ga0068869_100417443 Ga0068869_1004174432 170
64 3300005335 Ga0070666_10087093 Ga0070666_100870934 170
65 3300005336 Ga0070680_100073940 Ga0070680_1000739401 170
66 3300005337 Ga0070682_100107781 Ga0070682_1001077813 170
67 3300005337 Ga0070682_101553339 Ga0070682_1015533391 170
68 3300005338 Ga0068868_100585841 Ga0068868_1005858412 170
69 3300005338 Ga0068868_100989746 Ga0068868_1009897461 170
70 3300005340 Ga0070689_100064580 Ga0070689_1000645801 170
71 3300005340 Ga0070689_100367332 Ga0070689_1003673321 170
72 3300005340 Ga0070689_100405936 Ga0070689_1004059362 170
73 3300005343 Ga0070687_100000438 Ga0070687_10000043813 170
74 3300005343 Ga0070687_100048081 Ga0070687_1000480812 170
75 3300005343 Ga0070687_100359932 Ga0070687_1003599322 170
76 3300005345 Ga0070692_10188933 Ga0070692_101889332 170
77 3300005347 Ga0070668_100251626 Ga0070668_1002516262 170
78 3300005354 Ga0070675_100110103 Ga0070675_1001101034 170
79 3300005354 Ga0070675_100273051 Ga0070675_1002730513 170
80 3300005354 Ga0070675_101450756 Ga0070675_1014507561 170
81 3300005355 Ga0070671_100186601 Ga0070671_1001866012 170
82 3300005364 Ga0070673_100547232 Ga0070673_1005472322 170
83 3300005365 Ga0070688_100006544 Ga0070688_1000065447 170
84 3300005365 Ga0070688_100092787 Ga0070688_1000927874 170
85 3300005365 Ga0070688_100143873 Ga0070688_1001438732 170
86 3300005365 Ga0070688_100277030 Ga0070688_1002770302 170
87 3300005366 Ga0070659_100078159 Ga0070659_1000781593 170
88 3300005366 Ga0070659_101164292 Ga0070659_1011642921 170
89 3300005434 Ga0070709_10346747 Ga0070709_103467472 170
90 3300005434 Ga0070709_10387247 Ga0070709_103872472 170
91 3300005438 Ga0070701_10164240 Ga0070701_101642401 170
92 3300005439 Ga0070711_100853679 Ga0070711_1008536791 170
93 3300005440 Ga0070705_100269681 Ga0070705_1002696812 170
94 3300005441 Ga0070700_100256787 Ga0070700_1002567871 170
95 3300005444 Ga0070694_100137900 Ga0070694_1001379002 170
96 3300005444 Ga0070694_100621798 Ga0070694_1006217982 170
97 3300005445 Ga0070708_100233490 Ga0070708_1002334903 170
98 3300005456 Ga0070678_100048916 Ga0070678_1000489164 170
99 3300005456 Ga0070678_100312593 Ga0070678_1003125933 170
100 3300005458 Ga0070681_10120316 Ga0070681_101203162 170
101 3300005458 Ga0070681_10316519 Ga0070681_103165192 170
102 3300005466 Ga0070685_10020753 Ga0070685_100207536 170
103 3300005468 Ga0070707_101116055 Ga0070707_1011160551 170
104 3300005471 Ga0070698_100004067 Ga0070698_10000406717 170
105 3300005471 Ga0070698_100015147 Ga0070698_1000151473 170
106 3300005471 Ga0070698_100742138 Ga0070698_1007421382 170
107 3300005530 Ga0070679_100002586 Ga0070679_1000025866 170
108 3300005530 Ga0070679_100002759 Ga0070679_1000027593 170
109 3300005530 Ga0070679_100389001 Ga0070679_1003890012 170
110 3300005530 Ga0070679_100765132 Ga0070679_1007651322 170
111 3300005535 Ga0070684_100064203 Ga0070684_1000642034 170
112 3300005535 Ga0070684_100955125 Ga0070684_1009551251 170
113 3300005543 Ga0070672_100050698 Ga0070672_1000506984 170
114 3300005543 Ga0070672_100220740 Ga0070672_1002207402 170
115 3300005543 Ga0070672_100434671 Ga0070672_1004346712 170
116 3300005544 Ga0070686_100451044 Ga0070686_1004510441 170
117 3300005547 Ga0070693_100310212 Ga0070693_1003102122 170
118 3300005548 Ga0070665_100005092 Ga0070665_1000050924 170
119 3300005548 Ga0070665_100360029 Ga0070665_1003600291 170
120 3300005548 Ga0070665_100839713 Ga0070665_1008397133 170
121 3300005548 Ga0070665_100890438 Ga0070665_1008904381 170
122 3300005549 Ga0070704_100155710 Ga0070704_1001557103 170
123 3300005549 Ga0070704_100422311 Ga0070704_1004223111 170
124 3300005549 Ga0070704_101210924 Ga0070704_1012109241 170
125 3300005549 Ga0070704_101486948 Ga0070704_1014869481 170
126 3300005563 Ga0068855_100042142 Ga0068855_1000421423 170
127 3300005563 Ga0068855_100396082 Ga0068855_1003960822 170
128 3300005563 Ga0068855_100854693 Ga0068855_1008546931 170
129 3300005577 Ga0068857_101110367 Ga0068857_1011103671 170
130 3300005614 Ga0068856_100071957 Ga0068856_1000719572 170
131 3300005614 Ga0068856_100099460 Ga0068856_1000994602 170
132 3300005614 Ga0068856_100266013 Ga0068856_1002660132 170
133 3300005615 Ga0070702_100144811 Ga0070702_1001448112 170
134 3300005615 Ga0070702_100451483 Ga0070702_1004514831 170
135 3300005616 Ga0068852_100100836 Ga0068852_1001008362 170
136 3300005616 Ga0068852_100128954 Ga0068852_1001289542 170
137 3300005617 Ga0068859_100145292 Ga0068859_1001452924 170
138 3300005617 Ga0068859_100478174 Ga0068859_1004781743 170
139 3300005617 Ga0068859_101510063 Ga0068859_1015100632 170
140 3300005618 Ga0068864_100285349 Ga0068864_1002853492 170
141 3300005618 Ga0068864_101321523 Ga0068864_1013215231 170
142 3300005718 Ga0068866_10068111 Ga0068866_100681113 170
143 3300005718 Ga0068866_10234842 Ga0068866_102348422 170
144 3300005719 Ga0068861_100047232 Ga0068861_1000472322 170
145 3300005841 Ga0068863_100110103 Ga0068863_1001101032 170
146 3300005842 Ga0068858_100061393 Ga0068858_1000613932 170
147 3300005844 Ga0068862_100127217 Ga0068862_1001272172 170
148 3300005844 Ga0068862_100897036 Ga0068862_1008970362 170
149 3300005937 Ga0081455_10057468 Ga0081455_100574682 170
150 3300005981 Ga0081538_10218608 Ga0081538_102186082 170
151 3300005981 Ga0081538_10236316 Ga0081538_102363162 170
152 3300006028 Ga0070717_10044568 Ga0070717_100445682 170
153 3300006028 Ga0070717_10047790 Ga0070717_100477904 170
154 3300006173 Ga0070716_100027828 Ga0070716_1000278284 170
155 3300006175 Ga0070712_100664917 Ga0070712_1006649171 170
156 3300006237 Ga0097621_100224434 Ga0097621_1002244342 170
157 3300006237 Ga0097621_100290742 Ga0097621_1002907422 170
158 3300006237 Ga0097621_100329530 Ga0097621_1003295302 170
159 3300006237 Ga0097621_100391454 Ga0097621_1003914542 170
160 3300006358 Ga0068871_100862035 Ga0068871_1008620352 170
161 3300006846 Ga0075430_100069851 Ga0075430_1000698514 170
162 3300006846 Ga0075430_100724475 Ga0075430_1007244751 170
163 3300006852 Ga0075433_11192576 Ga0075433_111925761 170
164 3300006880 Ga0075429_100002168 Ga0075429_10000216816 170
165 3300006880 Ga0075429_100053377 Ga0075429_1000533773 170
166 3300006880 Ga0075429_100548929 Ga0075429_1005489292 170
167 3300006881 Ga0068865_100004469 Ga0068865_1000044698 170
168 3300006881 Ga0068865_100162886 Ga0068865_1001628862 170
169 3300006931 Ga0097620_100145283 Ga0097620_1001452834 170
170 3300006931 Ga0097620_100478205 Ga0097620_1004782053 170
171 3300006931 Ga0097620_101510074 Ga0097620_1015100742 170
172 3300007076 Ga0075435_100349275 Ga0075435_1003492752 170
173 3300009093 Ga0105240_10736817 Ga0105240_107368171 170
174 3300009094 Ga0111539_10041391 Ga0111539_100413914 170
175 3300009094 Ga0111539_10118985 Ga0111539_101189852 170
176 3300009094 Ga0111539_10268651 Ga0111539_102686512 170
177 3300009094 Ga0111539_10873641 Ga0111539_108736412 170
178 3300009094 Ga0111539_11170879 Ga0111539_111708792 170
179 3300009098 Ga0105245_10000072 Ga0105245_1000007229 170
180 3300009098 Ga0105245_10752747 Ga0105245_107527472 170
181 3300009098 Ga0105245_11278919 Ga0105245_112789191 170
182 3300009147 Ga0114129_10174875 Ga0114129_101748755 170
183 3300009147 Ga0114129_11109646 Ga0114129_111096462 170
184 3300009148 Ga0105243_10436838 Ga0105243_104368382 170
185 3300009148 Ga0105243_10714723 Ga0105243_107147232 170
186 3300009174 Ga0105241_10666874 Ga0105241_106668741 170
187 3300009174 Ga0105241_11491943 Ga0105241_114919431 170
188 3300009176 Ga0105242_10410989 Ga0105242_104109891 170
189 3300009176 Ga0105242_10721372 Ga0105242_107213721 170
190 3300009177 Ga0105248_11157124 Ga0105248_111571242 170
191 3300009545 Ga0105237_10068855 Ga0105237_100688552 170
192 3300009545 Ga0105237_10518793 Ga0105237_105187932 170
193 3300009545 Ga0105237_10558821 Ga0105237_105588211 170
194 3300009551 Ga0105238_10288280 Ga0105238_102882801 170
195 3300009551 Ga0105238_10511480 Ga0105238_105114801 170
196 3300009551 Ga0105238_11046936 Ga0105238_110469361 170
197 3300009553 Ga0105249_10169215 Ga0105249_101692153 170
198 3300009553 Ga0105249_10192196 Ga0105249_101921963 170
199 3300010375 Ga0105239_10710355 Ga0105239_107103552 170
200 3300011119 Ga0105246_11291614 Ga0105246_112916141 170
201 3300011119 Ga0105246_11450197 Ga0105246_114501971 170
202 3300013105 Ga0157369_10885145 Ga0157369_108851452 170
203 3300013105 Ga0157369_11168735 Ga0157369_111687352 170
204 3300013296 Ga0157374_10044255 Ga0157374_100442553 170
205 3300013296 Ga0157374_10096208 Ga0157374_100962085 170
206 3300013296 Ga0157374_10953278 Ga0157374_109532782 170
207 3300013296 Ga0157374_11102220 Ga0157374_111022202 170
208 3300013297 Ga0157378_10338060 Ga0157378_103380603 170
209 3300013297 Ga0157378_10377713 Ga0157378_103777132 170
210 3300013306 Ga0163162_10495001 Ga0163162_104950012 170
211 3300013307 Ga0157372_10064255 Ga0157372_100642553 170
212 3300013307 Ga0157372_11358423 Ga0157372_113584232 170
213 3300014325 Ga0163163_11091899 Ga0163163_110918991 170
214 3300014745 Ga0157377_10437107 Ga0157377_104371071 170
215 3300014968 Ga0157379_10237470 Ga0157379_102374702 170
216 3300014968 Ga0157379_10808372 Ga0157379_108083721 170
217 3300014969 Ga0157376_10355224 Ga0157376_103552242 170
218 3300014969 Ga0157376_10651438 Ga0157376_106514381 170
219 3300014969 Ga0157376_10776662 Ga0157376_107766622 170
220 3300014969 Ga0157376_10866669 Ga0157376_108666691 170
221 3300020069 Ga0197907_10644234 Ga0197907_106442342 170
222 3300020070 Ga0206356_10488560 Ga0206356_104885602 170
223 3300020078 Ga0206352_11294615 Ga0206352_112946151 170
224 3300020081 Ga0206354_11390788 Ga0206354_113907882 170
225 3300025315 Ga0207697_10009698 Ga0207697_100096987 170
226 3300025315 Ga0207697_10168681 Ga0207697_101686812 170
227 3300025898 Ga0207692_10052812 Ga0207692_100528122 170
228 3300025898 Ga0207692_10289510 Ga0207692_102895102 170
229 3300025905 Ga0207685_10590573 Ga0207685_105905731 170
230 3300025906 Ga0207699_10068257 Ga0207699_100682573 170
231 3300025907 Ga0207645_10000305 Ga0207645_1000030530 170
232 3300025908 Ga0207643_10151141 Ga0207643_101511412 170
233 3300025909 Ga0207705_10108306 Ga0207705_101083063 170
234 3300025912 Ga0207707_10012710 Ga0207707_100127101 170
235 3300025912 Ga0207707_10021786 Ga0207707_100217865 170
236 3300025912 Ga0207707_10087528 Ga0207707_100875283 170
237 3300025912 Ga0207707_10259232 Ga0207707_102592322 170
238 3300025913 Ga0207695_10094121 Ga0207695_100941215 170
239 3300025914 Ga0207671_10131744 Ga0207671_101317443 170
240 3300025915 Ga0207693_10420527 Ga0207693_104205271 170
241 3300025916 Ga0207663_10819534 Ga0207663_108195341 170
242 3300025917 Ga0207660_10159462 Ga0207660_101594622 170
243 3300025917 Ga0207660_10159532 Ga0207660_101595322 170
244 3300025918 Ga0207662_10001910 Ga0207662_100019104 170
245 3300025918 Ga0207662_10046301 Ga0207662_100463012 170
246 3300025918 Ga0207662_10047120 Ga0207662_100471202 170
247 3300025918 Ga0207662_10072131 Ga0207662_100721312 170
248 3300025918 Ga0207662_10082136 Ga0207662_100821362 170
249 3300025918 Ga0207662_10578370 Ga0207662_105783701 170
250 3300025920 Ga0207649_10237412 Ga0207649_102374122 170
251 3300025921 Ga0207652_10008761 Ga0207652_100087618 170
252 3300025921 Ga0207652_10231423 Ga0207652_102314232 170
253 3300025921 Ga0207652_10436937 Ga0207652_104369372 170
254 3300025921 Ga0207652_10481101 Ga0207652_104811011 170
255 3300025922 Ga0207646_10478056 Ga0207646_104780563 170
256 3300025922 Ga0207646_10487958 Ga0207646_104879581 170
257 3300025922 Ga0207646_11055033 Ga0207646_110550331 170
258 3300025923 Ga0207681_10002259 Ga0207681_1000225911 170
259 3300025924 Ga0207694_10118235 Ga0207694_101182353 170
260 3300025924 Ga0207694_10504021 Ga0207694_105040211 170
261 3300025925 Ga0207650_10008878 Ga0207650_100088788 170
262 3300025925 Ga0207650_10138454 Ga0207650_101384544 170
263 3300025925 Ga0207650_10194812 Ga0207650_101948121 170
264 3300025926 Ga0207659_10016522 Ga0207659_100165222 170
265 3300025926 Ga0207659_10026438 Ga0207659_100264382 170
266 3300025926 Ga0207659_11165279 Ga0207659_111652791 170
267 3300025927 Ga0207687_10002588 Ga0207687_100025886 170
268 3300025927 Ga0207687_10877173 Ga0207687_108771731 170
269 3300025931 Ga0207644_10072396 Ga0207644_100723962 170
270 3300025932 Ga0207690_10989459 Ga0207690_109894591 170
271 3300025934 Ga0207686_10314690 Ga0207686_103146902 170
272 3300025934 Ga0207686_10332352 Ga0207686_103323521 170
273 3300025935 Ga0207709_10257805 Ga0207709_102578052 170
274 3300025936 Ga0207670_10045655 Ga0207670_100456551 170
275 3300025936 Ga0207670_10253605 Ga0207670_102536052 170
276 3300025936 Ga0207670_10421693 Ga0207670_104216932 170
277 3300025936 Ga0207670_11221515 Ga0207670_112215151 170
278 3300025937 Ga0207669_10002571 Ga0207669_100025714 170
279 3300025938 Ga0207704_10014734 Ga0207704_100147345 170
280 3300025938 Ga0207704_10135406 Ga0207704_101354062 170
281 3300025939 Ga0207665_10119873 Ga0207665_101198733 170
282 3300025940 Ga0207691_10035731 Ga0207691_100357317 170
283 3300025940 Ga0207691_10644810 Ga0207691_106448102 170
284 3300025942 Ga0207689_10061294 Ga0207689_100612943 170
285 3300025942 Ga0207689_10190251 Ga0207689_101902512 170
286 3300025942 Ga0207689_10243204 Ga0207689_102432043 170
287 3300025942 Ga0207689_11271457 Ga0207689_112714571 170
288 3300025944 Ga0207661_10000960 Ga0207661_1000096017 170
289 3300025944 Ga0207661_10525690 Ga0207661_105256901 170
290 3300025949 Ga0207667_10254992 Ga0207667_102549922 170
291 3300025949 Ga0207667_10890483 Ga0207667_108904831 170
292 3300025960 Ga0207651_10002205 Ga0207651_100022057 170
293 3300025960 Ga0207651_10067837 Ga0207651_100678375 170
294 3300025961 Ga0207712_10157986 Ga0207712_101579861 170
295 3300025961 Ga0207712_10246511 Ga0207712_102465111 170
296 3300025972 Ga0207668_10006597 Ga0207668_100065973 170
297 3300025972 Ga0207668_10214698 Ga0207668_102146982 170
298 3300025986 Ga0207658_10292796 Ga0207658_102927962 170
299 3300025986 Ga0207658_10473770 Ga0207658_104737702 170
300 3300026023 Ga0207677_10426600 Ga0207677_104266002 170
301 3300026023 Ga0207677_11103795 Ga0207677_111037951 170
302 3300026035 Ga0207703_10064050 Ga0207703_100640502 170
303 3300026035 Ga0207703_10625597 Ga0207703_106255972 170
304 3300026041 Ga0207639_10708444 Ga0207639_107084442 170
305 3300026075 Ga0207708_10006083 Ga0207708_100060839 170
306 3300026075 Ga0207708_10084489 Ga0207708_100844893 170
307 3300026078 Ga0207702_10096229 Ga0207702_100962291 170
308 3300026078 Ga0207702_10280958 Ga0207702_102809583 170
309 3300026089 Ga0207648_10003927 Ga0207648_100039279 170
310 3300026095 Ga0207676_10965426 Ga0207676_109654261 170
311 3300026116 Ga0207674_10075073 Ga0207674_100750732 170
312 3300026116 Ga0207674_10223423 Ga0207674_102234232 170
313 3300026116 Ga0207674_10293133 Ga0207674_102931332 170
314 3300026116 Ga0207674_10686137 Ga0207674_106861372 170
315 3300026118 Ga0207675_100013757 Ga0207675_1000137574 170
316 3300026118 Ga0207675_100037626 Ga0207675_1000376263 170
317 3300026118 Ga0207675_101205443 Ga0207675_1012054431 170
318 3300026121 Ga0207683_10148526 Ga0207683_101485263 170
319 3300026121 Ga0207683_10346262 Ga0207683_103462622 170
320 3300026121 Ga0207683_10423630 Ga0207683_104236301 170
321 3300026142 Ga0207698_10105753 Ga0207698_101057532 170
322 3300026142 Ga0207698_10215000 Ga0207698_102150002 170
323 3300027907 Ga0207428_10457821 Ga0207428_104578211 170
324 3300028379 Ga0268266_10002761 Ga0268266_100027617 170
325 3300028379 Ga0268266_10257722 Ga0268266_102577223 170
326 3300028379 Ga0268266_10361059 Ga0268266_103610592 170
327 3300028380 Ga0268265_10091200 Ga0268265_100912002 170
328 3300028556 Ga0265337_1015017 Ga0265337_10150172 170
329 3300028558 Ga0265326_10002726 Ga0265326_100027266 170
330 3300028563 Ga0265319_1029533 Ga0265319_10295333 170
331 3300028573 Ga0265334_10014224 Ga0265334_100142242 170
332 3300028573 Ga0265334_10153170 Ga0265334_101531701 170
333 3300028573 Ga0265334_10211168 Ga0265334_102111681 170
334 3300028577 Ga0265318_10000001 Ga0265318_10000001223 170
335 3300028577 Ga0265318_10002071 Ga0265318_1000207111 170
336 3300028577 Ga0265318_10113314 Ga0265318_101133141 170
337 3300028653 Ga0265323_10000747 Ga0265323_1000074718 170
338 3300028653 Ga0265323_10008433 Ga0265323_100084332 170
339 3300028653 Ga0265323_10099692 Ga0265323_100996922 170
340 3300028654 Ga0265322_10034737 Ga0265322_100347374 170
341 3300028666 Ga0265336_10007772 Ga0265336_100077724 170
342 3300028786 Ga0307517_10019612 Ga0307517_100196124 170
343 3300028794 Ga0307515_10010405 Ga0307515_100104058 170
344 3300028800 Ga0265338_10001115 Ga0265338_100011159 170
345 3300028800 Ga0265338_10018541 Ga0265338_100185417 170
346 3300028800 Ga0265338_10031496 Ga0265338_100314963 170
347 3300028800 Ga0265338_10142082 Ga0265338_101420822 170
348 3300028800 Ga0265338_10162017 Ga0265338_101620172 170
349 3300028800 Ga0265338_10174710 Ga0265338_101747103 170
350 3300028800 Ga0265338_10358640 Ga0265338_103586401 170
351 3300029957 Ga0265324_10000172 Ga0265324_100001728 170
352 3300031235 Ga0265330_10000002 Ga0265330_10000002150 170
353 3300031235 Ga0265330_10000588 Ga0265330_1000058819 170
354 3300031235 Ga0265330_10000838 Ga0265330_1000083810 170
355 3300031235 Ga0265330_10001551 Ga0265330_1000155113 170
356 3300031235 Ga0265330_10002799 Ga0265330_100027999 170
357 3300031235 Ga0265330_10003798 Ga0265330_100037987 170
358 3300031235 Ga0265330_10004572 Ga0265330_100045723 170
359 3300031235 Ga0265330_10043045 Ga0265330_100430452 170
360 3300031235 Ga0265330_10121421 Ga0265330_101214213 170
361 3300031238 Ga0265332_10000242 Ga0265332_1000024210 170
362 3300031238 Ga0265332_10000331 Ga0265332_1000033130 170
363 3300031238 Ga0265332_10004135 Ga0265332_100041352 170
364 3300031238 Ga0265332_10064850 Ga0265332_100648501 170
365 3300031238 Ga0265332_10102899 Ga0265332_101028991 170
366 3300031239 Ga0265328_10000280 Ga0265328_1000028025 170
367 3300031239 Ga0265328_10000683 Ga0265328_100006835 170
368 3300031239 Ga0265328_10012366 Ga0265328_100123662 170
369 3300031240 Ga0265320_10000007 Ga0265320_10000007233 170
370 3300031240 Ga0265320_10002363 Ga0265320_1000236314 170
371 3300031240 Ga0265320_10011167 Ga0265320_100111677 170
372 3300031240 Ga0265320_10011806 Ga0265320_100118066 170
373 3300031240 Ga0265320_10288858 Ga0265320_102888581 170
374 3300031240 Ga0265320_10342532 Ga0265320_103425321 170
375 3300031241 Ga0265325_10000856 Ga0265325_100008569 170
376 3300031241 Ga0265325_10008903 Ga0265325_100089035 170
377 3300031241 Ga0265325_10020117 Ga0265325_100201173 170
378 3300031242 Ga0265329_10000098 Ga0265329_100000984 170
379 3300031242 Ga0265329_10000806 Ga0265329_100008067 170
380 3300031242 Ga0265329_10015809 Ga0265329_100158093 170
381 3300031247 Ga0265340_10000741 Ga0265340_100007413 170
382 3300031247 Ga0265340_10126383 Ga0265340_101263832 170
383 3300031249 Ga0265339_10000141 Ga0265339_1000014144 170
384 3300031249 Ga0265339_10010416 Ga0265339_100104163 170
385 3300031249 Ga0265339_10042307 Ga0265339_100423071 170
386 3300031249 Ga0265339_10065697 Ga0265339_100656973 170
387 3300031249 Ga0265339_10146761 Ga0265339_101467611 170
388 3300031249 Ga0265339_10238733 Ga0265339_102387332 170
389 3300031249 Ga0265339_10306876 Ga0265339_103068761 170
390 3300031250 Ga0265331_10000001 Ga0265331_10000001305 170
391 3300031250 Ga0265331_10007316 Ga0265331_100073167 170
392 3300031250 Ga0265331_10110045 Ga0265331_101100452 170
393 3300031250 Ga0265331_10238382 Ga0265331_102383822 170
394 3300031344 Ga0265316_10000053 Ga0265316_1000005341 170
395 3300031344 Ga0265316_10000108 Ga0265316_1000010824 170
396 3300031344 Ga0265316_10000583 Ga0265316_1000058324 170
397 3300031344 Ga0265316_10000878 Ga0265316_100008783 170
398 3300031344 Ga0265316_10002456 Ga0265316_1000245612 170
399 3300031344 Ga0265316_10002912 Ga0265316_100029126 170
400 3300031344 Ga0265316_10006504 Ga0265316_100065048 170
401 3300031344 Ga0265316_10024023 Ga0265316_100240232 170
402 3300031344 Ga0265316_10043815 Ga0265316_100438154 170
403 3300031344 Ga0265316_10050155 Ga0265316_100501552 170
404 3300031344 Ga0265316_10180086 Ga0265316_101800863 170
405 3300031344 Ga0265316_10329649 Ga0265316_103296492 170
406 3300031456 Ga0307513_10213379 Ga0307513_102133792 170
407 3300031507 Ga0307509_10000164 Ga0307509_1000016430 170
408 3300031507 Ga0307509_10027240 Ga0307509_100272403 170
409 3300031507 Ga0307509_10114355 Ga0307509_101143552 170
410 3300031595 Ga0265313_10000090 Ga0265313_100000907 170
411 3300031595 Ga0265313_10053988 Ga0265313_100539882 170
412 3300031595 Ga0265313_10058506 Ga0265313_100585063 170
413 3300031595 Ga0265313_10149831 Ga0265313_101498312 170
414 3300031595 Ga0265313_10288722 Ga0265313_102887221 170
415 3300031616 Ga0307508_10154304 Ga0307508_101543044 170
416 3300031616 Ga0307508_10154665 Ga0307508_101546652 170
417 3300031711 Ga0265314_10000006 Ga0265314_10000006339 170
418 3300031711 Ga0265314_10000009 Ga0265314_10000009332 170
419 3300031711 Ga0265314_10005265 Ga0265314_100052658 170
420 3300031711 Ga0265314_10009719 Ga0265314_100097193 170
421 3300031711 Ga0265314_10012976 Ga0265314_100129766 170
422 3300031711 Ga0265314_10017512 Ga0265314_100175126 170
423 3300031711 Ga0265314_10030286 Ga0265314_100302864 170
424 3300031711 Ga0265314_10437368 Ga0265314_104373681 170
425 3300031712 Ga0265342_10000065 Ga0265342_1000006530 170
426 3300031712 Ga0265342_10000654 Ga0265342_1000065435 170
427 3300031712 Ga0265342_10002973 Ga0265342_100029738 170
428 3300031712 Ga0265342_10007901 Ga0265342_100079016 170
429 3300031712 Ga0265342_10016011 Ga0265342_100160115 170
430 3300031712 Ga0265342_10018799 Ga0265342_100187993 170
431 3300031712 Ga0265342_10033590 Ga0265342_100335902 170
432 3300031712 Ga0265342_10058193 Ga0265342_100581934 170
433 3300031712 Ga0265342_10098237 Ga0265342_100982372 170
434 3300031712 Ga0265342_10188316 Ga0265342_101883162 170
435 3300031712 Ga0265342_10364525 Ga0265342_103645251 170
436 3300031727 Ga0316576_10000030 Ga0316576_100000308 170
437 3300031727 Ga0316576_10127528 Ga0316576_101275282 170
438 3300031727 Ga0316576_10657081 Ga0316576_106570811 170
439 3300031731 Ga0307405_10621681 Ga0307405_106216812 170
440 3300031901 Ga0307406_10142112 Ga0307406_101421123 170
441 3300031911 Ga0307412_10249621 Ga0307412_102496212 170
442 3300032126 Ga0307415_100047187 Ga0307415_1000471873 170
443 3300032126 Ga0307415_100683764 Ga0307415_1006837641 170
444 3300033179 Ga0307507_10342761 Ga0307507_103427611 170
445 3300033179 Ga0307507_10546470 Ga0307507_105464701 170
446 3300034818 Ga0373950_0000015 Ga0373950_0000015_63652_64167 170
447 3300034818 Ga0373950_0000106 Ga0373950_0000106_11608_12123 170
448 3300035089 Ga0373944_0254710 Ga0373944_0254710_105_620 170
449 3300035090 Ga0373949_0000228 Ga0373949_0000228_2221_2736 170
450 3300035111 Ga0373923_0195783 Ga0373923_0195783_257_772 170
451 3300035111 Ga0373923_0302451 Ga0373923_0302451_167_682 170
452 3300035113 Ga0373936_0000009 Ga0373936_0000009_21022_21537 170
453 3300035115 Ga0373941_0047170 Ga0373941_0047170_494_1009 170
454 3300035115 Ga0373941_0301582 Ga0373941_0301582_25_540 170
455 3300035116 Ga0373945_0012235 Ga0373945_0012235_69_584 170
456 3300035117 Ga0373953_0050652 Ga0373953_0050652_532_1047 170
457 3300035118 Ga0373954_0027481 Ga0373954_0027481_1129_1644 170
458 3300035118 Ga0373954_0248140 Ga0373954_0248140_42_557 170
459 3300035118 Ga0373954_0565668 Ga0373954_0565668_34_549 170
460 3300035119 Ga0373956_0054854 Ga0373956_0054854_1241_1756 170
461 3300035119 Ga0373956_0096269 Ga0373956_0096269_593_1108 170
462 3300035120 Ga0373957_0012584 Ga0373957_0012584_1710_2225 170
463 3300035120 Ga0373957_0015579 Ga0373957_0015579_1279_1794 170
464 3300035120 Ga0373957_0038128 Ga0373957_0038128_304_819 170
465 3300035171 Ga0373946_0521887 Ga0373946_0521887_43_558 170
466 3300035172 Ga0373955_0045088 Ga0373955_0045088_1117_1632 170
467 3300035172 Ga0373955_0093032 Ga0373955_0093032_619_1134 170
468 3300035172 Ga0373955_0200800 Ga0373955_0200800_421_936 170
469 3300035172 Ga0373955_0234302 Ga0373955_0234302_256_771 170
470 3300035241 Ga0373961_0000132 Ga0373961_0000132_11353_11868 170
471 3300035724 Ga0373933_0000801 Ga0373933_0000801_4455_4970 170
472 3300035724 Ga0373933_0045864 Ga0373933_0045864_1635_2150 170
473 3300035724 Ga0373933_0191542 Ga0373933_0191542_459_974 170
474 3300035724 Ga0373933_0382750 Ga0373933_0382750_267_782 170
475 3300035725 Ga0373947_0068533 Ga0373947_0068533_233_748 170
476 3300035725 Ga0373947_1028996 Ga0373947_1028996_20_535 170
477 3300036401 Ga0373937_0007263 Ga0373937_0007263_1084_1599 170
478 3300036401 Ga0373937_0007632 Ga0373937_0007632_12_527 170
479 3300036401 Ga0373937_0182473 Ga0373937_0182473_722_1237 170
480 3300036401 Ga0373937_0248621 Ga0373937_0248621_757_1272 170
481 3300036401 Ga0373937_0643620 Ga0373937_0643620_166_681 170
482 3300036647 Ga0316582_0067751 Ga0316582_0067751_1325_1840 170
483 3300036712 Ga0316584_0000106 Ga0316584_0000106_26934_27449 170
484 3300037068 Ga0373925_0065036 Ga0373925_0065036_593_1108 170
485 3300037068 Ga0373925_0188831 Ga0373925_0188831_745_1260 170
486 3300037312 Ga0395899_0010235 Ga0395899_0010235_6224_6739 170
487 3300037312 Ga0395899_0192670 Ga0395899_0192670_271_786 170
488 3300037418 Ga0395900_0612644 Ga0395900_0612644_330_845 170
489 3300037418 Ga0395900_0756919 Ga0395900_0756919_359_874 170
490 3300037466 Ga0395898_0082216 Ga0395898_0082216_79_594 170
491 3300037466 Ga0395898_0964670 Ga0395898_0964670_205_720 170
492 3300037471 Ga0395905_0449008 Ga0395905_0449008_626_1141 170
493 3300037471 Ga0395905_0902289 Ga0395905_0902289_51_566 170
494 3300038443 Ga0395901_0206849 Ga0395901_0206849_966_1481 170
495 3300039437 Ga0436365_1570115 Ga0436365_1570115_148_663 170
496 3300039450 Ga0436363_0344008 Ga0436363_0344008_817_1329 170
497 3300041441 Ga0451787_397521 Ga0451787_397521_115_630 170
498 3300041452 Ga0451793_1704137 Ga0451793_1704137_131_646 170
499 3300041453 Ga0451797_0791634 Ga0451797_0791634_46_561 170
500 3300041460 Ga0451802_0260369 Ga0451802_0260369_385_897 170
501 3300041486 Ga0451807_2163525 Ga0451807_2163525_242_754 170
502 3300041512 Ga0451853_3702505 Ga0451853_3702505_110_625 170
503 3300042876 Ga0451577_0028182 Ga0451577_0028182_4543_5058 170
504 3300042876 Ga0451577_0452357 Ga0451577_0452357_244_759 170
505 3300044658 Ga0466972_0124667 Ga0466972_0124667_348_887 170
506 3300044712 Ga0453684_0000078 Ga0453684_0000078_222866_223381 170
507 3300044712 Ga0453684_0050881 Ga0453684_0050881_2633_3151 170
508 3300044712 Ga0453684_0189167 Ga0453684_0189167_529_1044 170
509 3300044712 Ga0453684_0339694 Ga0453684_0339694_537_1052 170
510 3300044712 Ga0453684_0654278 Ga0453684_0654278_47_562 170
511 3300044842 Ga0466957_0307876 Ga0466957_0307876_433_948 170
512 3300045051 Ga0451576_0155695 Ga0451576_0155695_1330_1845 170
513 3300045051 Ga0451576_1592132 Ga0451576_1592132_67_582 170
514 3300045976 Ga0466967_0371022 Ga0466967_0371022_781_1296 170
515 3300045976 Ga0466967_1058577 Ga0466967_1058577_196_708 170
516 3300046457 Ga0495590_0033611 Ga0495590_0033611_732_1247 170
517 3300046462 Ga0495651_0045584 Ga0495651_0045584_1072_1587 170
518 3300046473 Ga0495582_0696781 Ga0495582_0696781_47_562 170
519 3300046476 Ga0495662_0337042 Ga0495662_0337042_138_653 170
520 3300046477 Ga0495664_0739567 Ga0495664_0739567_39_554 170
521 3300046516 Ga0495628_0120726 Ga0495628_0120726_1407_1922 170
522 3300046517 Ga0495630_0004817 Ga0495630_0004817_8748_9263 170
523 3300046529 Ga0495652_0436993 Ga0495652_0436993_39_554 170
524 3300046535 Ga0495586_0657002 Ga0495586_0657002_47_562 170
525 3300046536 Ga0495587_0212397 Ga0495587_0212397_301_813 170
526 3300046557 Ga0495622_0164321 Ga0495622_0164321_123_638 170
527 3300046642 Ga0495634_0002302 Ga0495634_0002302_11861_12376 170
528 3300046642 Ga0495634_0491710 Ga0495634_0491710_170_685 170
529 3300046675 Ga0495657_0160202 Ga0495657_0160202_533_1048 170
530 3300046679 Ga0495623_0094467 Ga0495623_0094467_1069_1581 170
531 3300047319 Ga0495674_0017181 Ga0495674_0017181_2346_2861 170
532 3300047471 Ga0495684_0311672 Ga0495684_0311672_190_705 170
533 3300047472 Ga0495686_0039813 Ga0495686_0039813_1398_1913 170
534 3300047472 Ga0495686_0093671 Ga0495686_0093671_838_1353 170
535 3300048904 Ga0496101_0198767 Ga0496101_0198767_167_682 170
536 3300048907 Ga0496104_0033434 Ga0496104_0033434_4003_4518 170
537 3300048907 Ga0496104_0264217 Ga0496104_0264217_366_881 170
538 3300048908 Ga0496105_1196353 Ga0496105_1196353_11_526 170
539 3300048909 Ga0496106_0537971 Ga0496106_0537971_156_671 170
540 3300048910 Ga0496107_0053616 Ga0496107_0053616_724_1239 170
541 3300048911 Ga0496108_0046394 Ga0496108_0046394_530_1045 170
542 3300048912 Ga0496109_0218006 Ga0496109_0218006_503_1018 170
543 3300048912 Ga0496109_0380206 Ga0496109_0380206_548_1063 170
544 3300048913 Ga0496110_0828207 Ga0496110_0828207_125_640 170
545 3300048914 Ga0496111_0753002 Ga0496111_0753002_13_528 170
546 3300048915 Ga0496112_0211733 Ga0496112_0211733_660_1175 170
547 3300048917 Ga0496114_0002777 Ga0496114_0002777_7685_8200 170
548 3300048917 Ga0496114_0019436 Ga0496114_0019436_2172_2687 170
549 3300048917 Ga0496114_0059321 Ga0496114_0059321_784_1299 170
550 3300048917 Ga0496114_0077206 Ga0496114_0077206_2001_2516 170
551 3300048917 Ga0496114_0106945 Ga0496114_0106945_1068_1583 170
552 3300048917 Ga0496114_0404011 Ga0496114_0404011_393_908 170
553 3300048917 Ga0496114_0899780 Ga0496114_0899780_175_690 170
554 3300048918 Ga0496115_0006149 Ga0496115_0006149_1652_2167 170
555 3300048918 Ga0496115_0135818 Ga0496115_0135818_642_1157 170
556 3300049513 Ga0501290_047341 Ga0501290_047341_117_632 170
557 3300049515 Ga0501292_042245 Ga0501292_042245_179_694 170
558 3300049571 Ga0501034_0000327 Ga0501034_0000327_52775_53290 170
559 3300049571 Ga0501034_0111981 Ga0501034_0111981_505_1020 170
560 3300049572 Ga0501036_0182698 Ga0501036_0182698_325_840 170
561 3300049574 Ga0501038_0201690 Ga0501038_0201690_197_712 170
562 3300049578 Ga0501042_0665344 Ga0501042_0665344_162_677 170
563 3300049579 Ga0501043_0000408 Ga0501043_0000408_28376_28891 170
564 3300049579 Ga0501043_0373850 Ga0501043_0373850_326_841 170
565 3300049580 Ga0501046_0000438 Ga0501046_0000438_892_1407 170
566 3300049580 Ga0501046_0404525 Ga0501046_0404525_343_858 170
567 3300049581 Ga0501047_0000008 Ga0501047_0000008_224687_225202 170
568 3300049581 Ga0501047_0012216 Ga0501047_0012216_7249_7764 170
569 3300049581 Ga0501047_0109014 Ga0501047_0109014_1866_2381 170
570 3300049582 Ga0501048_0063453 Ga0501048_0063453_271_786 170
571 3300049583 Ga0501067_0000030 Ga0501067_0000030_83956_84471 170
572 3300049583 Ga0501067_0083379 Ga0501067_0083379_510_1022 170
573 3300049584 Ga0501068_0007147 Ga0501068_0007147_832_1347 170
574 3300049584 Ga0501068_0044351 Ga0501068_0044351_958_1473 170
575 3300049584 Ga0501068_0731906 Ga0501068_0731906_123_635 170
576 3300049585 Ga0501069_0003625 Ga0501069_0003625_4011_4610 170
577 3300049585 Ga0501069_0032569 Ga0501069_0032569_1691_2206 170
578 3300049585 Ga0501069_0085107 Ga0501069_0085107_1205_1720 170
579 3300049586 Ga0501070_0001091 Ga0501070_0001091_11643_12158 170
580 3300049586 Ga0501070_0008109 Ga0501070_0008109_704_1219 170
581 3300049586 Ga0501070_0034368 Ga0501070_0034368_2001_2516 170
582 3300049586 Ga0501070_0124778 Ga0501070_0124778_1129_1644 170
583 3300049586 Ga0501070_1166252 Ga0501070_1166252_26_541 170
584 3300049587 Ga0501071_0734071 Ga0501071_0734071_208_723 170
585 3300049588 Ga0501072_0000023 Ga0501072_0000023_134392_134907 170
586 3300049588 Ga0501072_0159228 Ga0501072_0159228_760_1275 170
587 3300049589 Ga0501073_0000481 Ga0501073_0000481_14152_14745 170
588 3300049589 Ga0501073_0000498 Ga0501073_0000498_11814_12329 170
589 3300049589 Ga0501073_0000767 Ga0501073_0000767_10398_10913 170
590 3300049589 Ga0501073_0104657 Ga0501073_0104657_92_607 170
591 3300049589 Ga0501073_0284111 Ga0501073_0284111_365_880 170
592 3300049590 Ga0501074_0000439 Ga0501074_0000439_9181_9696 170
593 3300049590 Ga0501074_0027466 Ga0501074_0027466_2545_3099 170
594 3300049592 Ga0501076_0805907 Ga0501076_0805907_66_581 170
595 3300049655 Ga0501208_052022 Ga0501208_052022_110_625 170
596 3300049660 Ga0501216_001541 Ga0501216_001541_2297_2812 170
597 3300049665 Ga0501227_000349 Ga0501227_000349_5593_6108 170
598 3300049665 Ga0501227_002080 Ga0501227_002080_946_1461 170
599 3300049667 Ga0501230_000461 Ga0501230_000461_466_981 170
600 3300049668 Ga0501233_004596 Ga0501233_004596_236_751 170
601 3300049669 Ga0501235_019594 Ga0501235_019594_365_880 170
602 3300049689 Ga0501260_021073 Ga0501260_021073_84_599 170
603 3300049703 Ga0501219_015625 Ga0501219_015625_89_604 170
604 3300049741 Ga0501079_0000031 Ga0501079_0000031_892_1407 170
605 3300049741 Ga0501079_0216961 Ga0501079_0216961_412_927 170
606 3300049742 Ga0501080_0007570 Ga0501080_0007570_3158_3673 170
607 3300049742 Ga0501080_0146816 Ga0501080_0146816_1278_1832 170
608 3300049742 Ga0501080_0347191 Ga0501080_0347191_489_1004 170
609 3300049742 Ga0501080_0623077 Ga0501080_0623077_343_858 170
610 3300049743 Ga0501081_0064363 Ga0501081_0064363_610_1125 170
611 3300049744 Ga0501083_0001622 Ga0501083_0001622_6272_6787 170
612 3300049744 Ga0501083_0004836 Ga0501083_0004836_2195_2710 170
613 3300049744 Ga0501083_0075030 Ga0501083_0075030_1629_2183 170
614 3300049744 Ga0501083_0130591 Ga0501083_0130591_827_1342 170
615 3300049764 Ga0501267_004923 Ga0501267_004923_155_670 170
616 3300049822 Ga0501035_0042339 Ga0501035_0042339_12_527 170
617 3300049823 Ga0501044_0049920 Ga0501044_0049920_1192_1707 170
618 3300049852 Ga0501220_03393 Ga0501220_03393_115_630 170
619 3300050489 nmdc:mga03683_345097_c1 nmdc:mga03683_345097_c1_155_670 170
620 3300050490 nmdc:mga03n38_406597_c1 nmdc:mga03n38_406597_c1_27_542 170
621 3300050507 nmdc:mga05p37_1479769_c1 nmdc:mga05p37_1479769_c1_136_651 170
622 3300050507 nmdc:mga05p37_189987_c1 nmdc:mga05p37_189987_c1_340_852 170
623 3300050508 nmdc:mga09592_3157_c1 nmdc:mga09592_3157_c1_7946_8461 170
624 3300050508 nmdc:mga09592_96549_c1 nmdc:mga09592_96549_c1_88_603 170
625 3300050509 nmdc:mga0qj67_144070_c1 nmdc:mga0qj67_144070_c1_1180_1695 170
626 3300050509 nmdc:mga0qj67_415754_c1 nmdc:mga0qj67_415754_c1_465_980 170
627 3300050509 nmdc:mga0qj67_896508_c1 nmdc:mga0qj67_896508_c1_84_614 170
628 3300050511 nmdc:mga08y16_169856_c1 nmdc:mga08y16_169856_c1_571_1086 170
629 3300050511 nmdc:mga08y16_5330_c1 nmdc:mga08y16_5330_c1_12767_13282 170
630 3300050511 nmdc:mga08y16_596202_c1 nmdc:mga08y16_596202_c1_338_853 170
631 3300050511 nmdc:mga08y16_656791_c1 nmdc:mga08y16_656791_c1_287_802 170
632 3300050511 nmdc:mga08y16_79762_c1 nmdc:mga08y16_79762_c1_656_1171 170
633 3300050511 nmdc:mga08y16_901610_c1 nmdc:mga08y16_901610_c1_212_727 170
634 3300050511 nmdc:mga08y16_941975_c1 nmdc:mga08y16_941975_c1_94_606 170
635 3300050512 nmdc:mga0n895_1090206_c1 nmdc:mga0n895_1090206_c1_203_718 170
636 3300050513 nmdc:mga0rr50_214103_c1 nmdc:mga0rr50_214103_c1_425_940 170
637 3300050513 nmdc:mga0rr50_367047_c1 nmdc:mga0rr50_367047_c1_317_832 170
638 3300053080 Ga0500635_0012695 Ga0500635_0012695_1878_2393 170
639 3300053085 Ga0495619_0057969 Ga0495619_0057969_688_1203 170
640 3300053086 Ga0500578_0195725 Ga0500578_0195725_437_952 170
641 3300053090 Ga0500646_0038137 Ga0500646_0038137_539_1054 170
642 3300053092 Ga0500583_0168375 Ga0500583_0168375_529_1044 170
643 3300053094 Ga0500566_0000983 Ga0500566_0000983_10974_11489 170
644 3300053094 Ga0500566_0011880 Ga0500566_0011880_2043_2558 170
645 3300053095 Ga0500640_001204 Ga0500640_001204_2075_2590 170
646 3300053102 Ga0500554_000512 Ga0500554_000512_4980_5495 170
647 3300053118 Ga0500594_0055888 Ga0500594_0055888_264_779 170
648 3300053119 Ga0500595_000017 Ga0500595_000017_149729_150244 170
649 3300053120 Ga0500597_074498 Ga0500597_074498_651_1166 170
650 3300053120 Ga0500597_265858 Ga0500597_265858_162_677 170
651 3300053121 Ga0500607_174195 Ga0500607_174195_109_624 170
652 3300053123 Ga0500614_002961 Ga0500614_002961_615_1130 170
653 3300053123 Ga0500614_035288 Ga0500614_035288_21_536 170
654 3300053130 Ga0500642_0020210 Ga0500642_0020210_1547_2062 170
655 3300053130 Ga0500642_0139687 Ga0500642_0139687_526_1041 170
656 3300053136 Ga0500559_0006312 Ga0500559_0006312_744_1259 170
657 3300053139 Ga0500568_0107481 Ga0500568_0107481_323_838 170
658 3300053144 Ga0500585_060518 Ga0500585_060518_83_598 170
659 3300053154 Ga0500619_022090 Ga0500619_022090_1258_1773 170
660 3300053158 Ga0500627_0258592 Ga0500627_0258592_97_612 170
661 3300053163 Ga0500639_131510 Ga0500639_131510_444_959 170
662 3300053177 Ga0500636_0216542 Ga0500636_0216542_470_985 170
663 3300053177 Ga0500636_0216971 Ga0500636_0216971_342_857 170
664 3300054114 Ga0501084_0000002 Ga0501084_0000002_216557_217072 170
665 3300054114 Ga0501084_0108988 Ga0501084_0108988_663_1178 170
666 3300054114 Ga0501084_0784512 Ga0501084_0784512_41_556 170
667 3300060353 Ga0501082_0009842 Ga0501082_0009842_338_853 170
668 3300060353 Ga0501082_0045856 Ga0501082_0045856_2183_2782 170
669 3300060353 Ga0501082_0221171 Ga0501082_0221171_187_702 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04368

DUF507

Protein of unknown function (DUF507)

39

201

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8t8l-assembly1.cif.gz_A structure of domain of unknown function 507 (duf507) in space group p3(2)21 0.7259 1 170
8t8l-assembly1.cif.gz_A structure of domain of unknown function 507 (duf507) in space group p3(2)21 0.7223 1 170
3of4-assembly2.cif.gz_C-2 crystal structure of a fmn/fad- and nad(p)h-dependent nitroreductase (nfnb, il2077) from idiomarina loihiensis l2tr at 1.90 a resolution 0.4428 51 123
8bqs-assembly1.cif.gz_AF cryo-em structure of the i-ii-iii2-iv2 respiratory supercomplex from tetrahymena thermophila 0.3798 32 101
5fnn-assembly2.cif.gz_B iron and selenomethionine containing iron sulfur cluster repair protein ytfe 0.365 5 129
ID Description Score Start End Superfamily
af_Q8N815_49_172_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.5159 12 125 1.10.472.10
af_Q8N815_49_172_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.4799 12 125 1.10.472.10
af_K7LKA4_9_392_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.4667 8 121 1.20.1530.20
3l8rG00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.4282 29 127 1.20.58.80
af_I1L0X1_75_228_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.3907 5 127 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A7C5Q8F1-F1-model_v4 DUF507 family protein 0.9839 2 170
AF-A0A7C5Q8F1-F1-model_v4 DUF507 family protein 0.9726 2 170
AF-A0A7C4DLI6-F1-model_v4 DUF507 family protein 0.9693 1 127
AF-A0A2N2H1W8-F1-model_v4 DUF507 domain-containing protein 0.9631 1 170
AF-A0A7Y5GZD8-F1-model_v4 DUF507 family protein 0.9599 1 168

Feature Viewer

pLDDT pTM Quality
92.95 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map