F473964

General Info

Members Datasets Scaffolds Average Seq Length
668 575 321 229

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2551306091|2551729546
Length 268
Sequence DAEWTAVRLSLRVATVAMLASLPPALLVSMILARGRFWGKSLLNGLVHMPLILPPVVTGFALLLLFGRRGPVGAFLAENFGLVFSFRWTGAALACAVMGFPFMVRSIRLSIEAVDRKLEEAAGTLGASPAWIFLTVTLPLILPGILAGMVLSFAKAMGEFGATITFVSNIPGETQTLSAAIYTFTQVPGGDAGAMRLAVISVVISMAALMLSEAMASXDRRRLRLGGRGDRSFRPLRLRQDLACQHHRRPPPARSGPRRARRRHDRRQ

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
7 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
8 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
9 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
10 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
11 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
12 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
13 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
14 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
15 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
16 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
17 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
18 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
19 2516143018 Ensifer sp. BR816 Isolate Nodule
20 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
21 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
22 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
23 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
24 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
25 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
26 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
27 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
28 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
29 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
30 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
31 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
32 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
33 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
34 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
35 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
36 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
37 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
38 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
39 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
40 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
41 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
42 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
43 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
44 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
45 2643221557 Ensifer sp. Root558 Isolate Unclassified
46 2643221607 Rhizobium sp. Root73 Isolate Unclassified
47 2643221610 Ensifer sp. Root74 Isolate Unclassified
48 2643221618 Ensifer sp. Root231 Isolate Unclassified
49 2643221626 Ensifer sp. Root31 Isolate Unclassified
50 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
51 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
52 2643221655 Ensifer sp. Root1252 Isolate Unclassified
53 2643221659 Ensifer sp. Root127 Isolate Unclassified
54 2643221668 Ensifer sp. Root423 Isolate Unclassified
55 2643221675 Ensifer sp. Root1298 Isolate Unclassified
56 2643221680 Ensifer sp. Root1312 Isolate Unclassified
57 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
58 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
59 2643221698 Ensifer sp. Root142 Isolate Unclassified
60 2643221712 Ensifer sp. Root258 Isolate Unclassified
61 2643221719 Rhizobium sp. Root274 Isolate Unclassified
62 2643221723 Ensifer sp. Root278 Isolate Unclassified
63 2643221726 Ensifer sp. Root954 Isolate Unclassified
64 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
65 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
66 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
67 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
68 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
69 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
70 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
71 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
72 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
73 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
74 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
75 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
76 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
77 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
78 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
79 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
80 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
81 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
82 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
83 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
84 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
85 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
86 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
87 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
88 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
89 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
90 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
91 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
92 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
93 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
94 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
95 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
96 2844163670 Ensifer sp. 1H6 Isolate Unclassified
97 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
98 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
99 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
100 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
101 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
102 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
103 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
104 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
105 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
106 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
107 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
108 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
109 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
110 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
111 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
112 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
113 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
114 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
115 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
116 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
117 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
118 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
119 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
120 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
121 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
122 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
123 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
124 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
125 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
126 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
127 2902330777 Methylobacterium sp. 2A Isolate Unclassified
128 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
129 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
130 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
131 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
132 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
133 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
134 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
135 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
136 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
137 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
138 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
139 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
140 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
141 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
142 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
143 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
144 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
145 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
146 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
147 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
148 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
149 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
150 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
151 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
152 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
153 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
154 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
155 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
156 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
157 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
158 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
159 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
160 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
161 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
162 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
163 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
164 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
165 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
166 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
167 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
168 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
169 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
170 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
171 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
172 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
173 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
174 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
175 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
176 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
177 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
178 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
179 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
180 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
181 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
182 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
183 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
184 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
185 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
186 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
187 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
188 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
189 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
190 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
191 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
192 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
193 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
194 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
195 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
196 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
197 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
198 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
199 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
200 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
201 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
202 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
203 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
204 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
205 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
206 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
207 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
208 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
209 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
210 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
211 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
212 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
213 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
214 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
215 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
216 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
217 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
218 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
219 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
220 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
221 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
222 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
223 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
224 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
225 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
226 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
227 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
228 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
229 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
230 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
231 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
232 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
233 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
234 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
235 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
236 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
237 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
238 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
239 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
240 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
241 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
242 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
243 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
244 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
245 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
246 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
247 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
248 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
249 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
250 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
251 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
252 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
253 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
254 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
255 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
256 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
257 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
258 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
259 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
260 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
261 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
262 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
263 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
264 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
265 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
266 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
267 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
268 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
269 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
270 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
271 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
272 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
273 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
274 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
275 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
276 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
277 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
278 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
279 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
280 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
281 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
282 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
283 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
284 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
285 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
286 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
287 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
288 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
289 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
290 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
291 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
292 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
293 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
294 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
295 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
296 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
297 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
298 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
299 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
300 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
301 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
302 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
303 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
304 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
305 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
306 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
307 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
308 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
309 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
310 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
311 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
312 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
313 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
314 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
315 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
316 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
317 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
318 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
319 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
320 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
321 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
322 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
323 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
324 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
325 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
326 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
327 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
328 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
329 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
330 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
331 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
332 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
333 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
334 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
335 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
336 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
337 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
338 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
339 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
340 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
341 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
342 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
343 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
344 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
345 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
346 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
347 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
348 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
349 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
350 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
351 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
352 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
353 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
354 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
355 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
356 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
357 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
358 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
359 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
360 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
361 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
362 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
363 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
364 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
365 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
366 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
367 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
368 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
369 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
370 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
371 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
372 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
373 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
374 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
375 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
376 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
377 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
378 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
379 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
380 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
381 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
382 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
383 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
384 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
385 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
386 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
387 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
388 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
389 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
390 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
391 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
392 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
393 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
394 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
395 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
396 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
397 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
398 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
399 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
400 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
401 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
415 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
416 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
417 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
418 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
419 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
420 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
421 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
422 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
423 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
424 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
425 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
426 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
427 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
428 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
429 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
430 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
431 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
432 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
433 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
434 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
435 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
436 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
437 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
438 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
439 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
440 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
441 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
442 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
443 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
444 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
445 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
446 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
447 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
448 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
449 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
450 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
451 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
452 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
453 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
454 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
455 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
456 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
457 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
458 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
459 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
460 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
461 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
462 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
463 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
464 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
465 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
466 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
467 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
468 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
469 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
470 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
471 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
472 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
473 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
474 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
475 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
476 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
477 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
478 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
479 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
480 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
481 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
482 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
483 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
484 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
485 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
486 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
487 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
488 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
489 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
490 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
491 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
492 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
493 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
494 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
495 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
496 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
497 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
498 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
499 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
500 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
501 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
502 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
503 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
504 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
505 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
506 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
507 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
508 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
509 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
510 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
511 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
512 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
513 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
514 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
515 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
516 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
517 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
520 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
521 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
522 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
523 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
524 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
525 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
526 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
527 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
528 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
529 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
530 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
531 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
532 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
533 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
534 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
535 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
536 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
537 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
538 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
539 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
540 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
541 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
542 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
543 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
544 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
545 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
546 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
547 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
548 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
549 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
550 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
551 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
552 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
553 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
554 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
555 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
556 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
557 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
558 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
559 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
560 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
561 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
562 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
563 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
564 641522639 Methylobacterium sp. 4-46 Isolate Nodule
565 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
566 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
567 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
568 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
569 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
570 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
571 8005382845 Rhizobium sp. R634 Isolate Nodule
572 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
573 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
574 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
575 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 48.05
Metatranscriptomes 0
Isolates 51.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.49
Nodule 37.57
Rhizoplane 1.8
Rhizosphere 44.16
Stem 0
Stem Tuber 0
Unclassified 11.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004123 3300001979 Bacteria 6280
2 JGI25162J39368_1000485 3300002737 Bacteria 30412
3 JGI25159J45721_1000092 3300002987 Bacteria 42762
4 JGI25159J45721_1000403 3300002987 Bacteria 20187
5 JGI25165J46597_1000536 3300003214 Bacteria 35271
6 JGI25160J50197_1000134 3300003354 Bacteria 66627
7 JGI25161J50226_1000116 3300003374 Bacteria 62089
8 Ga0055526_1002223 3300003771 Bacteria 13288
9 Ga0055524_1001793 3300003775 Bacteria 11777
10 Ga0055531_10013092 3300003794 Bacteria 3850
11 Ga0055531_10029863 3300003794 Bacteria 1846
12 Ga0058692_1018732 3300003856 Bacteria 1490
13 Ga0055543_1001164 3300004625 Bacteria 11203
14 Ga0065165_1000196 3300005262 Bacteria 104569
15 Ga0070680_100414471 3300005336 Bacteria 1149
16 Ga0070709_10268420 3300005434 Bacteria 1236
17 Ga0070713_100019952 3300005436 Bacteria 5131
18 Ga0070710_10295334 3300005437 Bacteria 1056
19 Ga0068867_100762284 3300005459 Bacteria 860
20 Ga0070679_100091444 3300005530 Bacteria 3031
21 Ga0070679_100311830 3300005530 Bacteria 1523
22 Ga0070684_100224022 3300005535 Bacteria 1716
23 Ga0070697_100000782 3300005536 Bacteria 23898
24 Ga0070696_100172606 3300005546 Bacteria 1599
25 Ga0070696_100402646 3300005546 Bacteria 1071
26 Ga0068864_100574503 3300005618 Bacteria 1092
27 Ga0068858_100050803 3300005842 Bacteria 3837
28 Ga0081455_10262863 3300005937 Bacteria 1256
29 Ga0081538_10002795 3300005981 Bacteria 16716
30 Ga0081539_10002530 3300005985 Bacteria 25517
31 Ga0081539_10110080 3300005985 Bacteria 1388
32 Ga0070712_100002508 3300006175 Bacteria 11319
33 Ga0075428_100002840 3300006844 Bacteria 18885
34 Ga0075430_100009076 3300006846 Bacteria 8403
35 Ga0075430_100041599 3300006846 Bacteria 3888
36 Ga0075431_100001610 3300006847 Bacteria 21067
37 Ga0075431_100030105 3300006847 Bacteria 5589
38 Ga0075431_100409733 3300006847 Bacteria 1356
39 Ga0075433_10037525 3300006852 Bacteria 4181
40 Ga0075434_100004952 3300006871 Bacteria 12080
41 Ga0075434_100034464 3300006871 Bacteria 4999
42 Ga0075429_100002359 3300006880 Bacteria 15888
43 Ga0075436_100000569 3300006914 Bacteria 24112
44 Ga0079104_1001826 3300006946 Bacteria 13092
45 Ga0075435_100012346 3300007076 Bacteria 6320
46 Ga0111539_10003049 3300009094 Bacteria 22198
47 Ga0111539_10216622 3300009094 Bacteria 2230
48 Ga0114129_10001163 3300009147 Bacteria 34882
49 Ga0114129_10078838 3300009147 Bacteria 4581
50 Ga0114129_10430916 3300009147 Bacteria 1733
51 Ga0114129_10456401 3300009147 Bacteria 1675
52 Ga0105243_10698709 3300009148 Bacteria 988
53 Ga0105239_10959659 3300010375 Bacteria 982
54 Ga0171463_1014 3300013249 Bacteria 83917
55 Ga0163162_10050947 3300013306 Bacteria 4153
56 Ga0163162_10254253 3300013306 Bacteria 1889
57 Ga0157376_11105930 3300014969 Bacteria 818
58 Ga0182005_1012908 3300015265 Bacteria 2354
59 Ga0183363_1028 3300015690 Bacteria 50706
60 Ga0213873_10031886 3300021358 Bacteria 1314
61 Ga0213872_10001873 3300021361 Bacteria 12990
62 Ga0213872_10017859 3300021361 Bacteria 3274
63 Ga0209435_100031 3300025206 Bacteria 164115
64 Ga0209436_101037 3300025208 Bacteria 10611
65 Ga0209672_105943 3300025228 Bacteria 2040
66 Ga0209563_105632 3300025230 Bacteria 2242
67 Ga0209437_100179 3300025233 Bacteria 134210
68 Ga0209646_1000102 3300025246 Bacteria 164115
69 Ga0209026_1000096 3300025250 Bacteria 164115
70 Ga0209759_1000090 3300025256 Bacteria 164115
71 Ga0209233_1000185 3300025261 Bacteria 133788
72 Ga0209455_1016486 3300025272 Bacteria 1586
73 Ga0209130_1000198 3300025284 Bacteria 82557
74 Ga0209676_1004562 3300025292 Bacteria 7665
75 Ga0209025_1000339 3300025294 Bacteria 103239
76 Ga0209564_1000353 3300025295 Bacteria 85747
77 Ga0209050_1010702 3300025298 Bacteria 4476
78 Ga0209256_1000368 3300025299 Bacteria 72598
79 Ga0209256_1000456 3300025299 Bacteria 61717
80 Ga0209256_1000884 3300025299 Bacteria 37000
81 Ga0207426_1000048 3300025302 Bacteria 409127
82 Ga0207426_1060775 3300025302 Bacteria 1087
83 Ga0209051_1056724 3300025303 Bacteria 1260
84 Ga0209257_1011520 3300025304 Bacteria 4244
85 Ga0207692_10184715 3300025898 Bacteria 1217
86 Ga0207684_10249225 3300025910 Bacteria 1532
87 Ga0207707_10258637 3300025912 Bacteria 1511
88 Ga0207671_10113883 3300025914 Bacteria 2061
89 Ga0207693_10004810 3300025915 Bacteria 11361
90 Ga0207663_10067007 3300025916 Bacteria 2300
91 Ga0207660_10590855 3300025917 Bacteria 904
92 Ga0207652_10070527 3300025921 Bacteria 3035
93 Ga0207652_10089430 3300025921 Bacteria 2704
94 Ga0207694_10094779 3300025924 Bacteria 2359
95 Ga0207700_10370044 3300025928 Bacteria 1251
96 Ga0207700_10876840 3300025928 Bacteria 803
97 Ga0207665_10071706 3300025939 Bacteria 2365
98 Ga0207703_10042104 3300026035 Bacteria 3662
99 Ga0207702_10689033 3300026078 Bacteria 1007
100 Ga0209281_1000141 3300027111 Bacteria 175634
101 Ga0207428_10015017 3300027907 Bacteria 6709
102 Ga0307515_10000691 3300028794 Bacteria 77788
103 Ga0265338_10559198 3300028800 Bacteria 800
104 Ga0265332_10000898 3300031238 Bacteria 17863
105 Ga0265325_10013858 3300031241 Bacteria 4576
106 Ga0265340_10006446 3300031247 Bacteria 6459
107 Ga0265339_10007156 3300031249 Bacteria 7239
108 Ga0265331_10012639 3300031250 Unclassified 4565
109 Ga0265331_10036374 3300031250 Bacteria 2417
110 Ga0265327_10044168 3300031251 Bacteria 2378
111 Ga0307513_10003481 3300031456 Bacteria 21301
112 Ga0307408_100006657 3300031548 Bacteria 7663
113 Ga0307408_100217508 3300031548 Bacteria 1557
114 Ga0265313_10003198 3300031595 Bacteria 13484
115 Ga0265314_10142523 3300031711 Bacteria 1479
116 Ga0265342_10000291 3300031712 Bacteria 56828
117 Ga0316576_10022936 3300031727 Bacteria 4342
118 Ga0316578_10033702 3300031728 Bacteria 2936
119 Ga0316577_10008945 3300031733 Bacteria 5379
120 Ga0307406_10985237 3300031901 Bacteria 722
121 Ga0307412_10000126 3300031911 Bacteria 56270
122 Ga0307409_100371798 3300031995 Bacteria 1356
123 Ga0307409_100584962 3300031995 Bacteria 1101
124 Ga0307414_10000272 3300032004 Bacteria 31778
125 Ga0316583_10021731 3300032133 Bacteria 2300
126 Ga0373950_0027405 3300034818 Bacteria 1039
127 Ga0373926_0006707 3300035083 Bacteria 3824
128 Ga0373923_0003542 3300035111 Bacteria 5023
129 Ga0373936_0000845 3300035113 Bacteria 10905
130 Ga0373936_0022503 3300035113 Bacteria 2454
131 Ga0373945_0002110 3300035116 Bacteria 6198
132 Ga0373953_0001013 3300035117 Bacteria 7929
133 Ga0373954_0012179 3300035118 Bacteria 3824
134 Ga0373954_0094466 3300035118 Bacteria 1439
135 Ga0373957_0014147 3300035120 Bacteria 2722
136 Ga0373943_0007410 3300035170 Bacteria 4928
137 Ga0373946_0002847 3300035171 Bacteria 6128
138 Ga0373962_0076272 3300035242 Bacteria 1010
139 Ga0316574_0088069 3300035398 Bacteria 1977
140 Ga0373924_0024182 3300035410 Bacteria 2391
141 Ga0373935_0000530 3300035692 Bacteria 19893
142 Ga0373927_0019068 3300035695 Bacteria 4499
143 Ga0373933_0237231 3300035724 Bacteria 1172
144 Ga0373947_0001048 3300035725 Bacteria 16869
145 Ga0373937_0000212 3300036401 Bacteria 55966
146 Ga0373937_0172418 3300036401 Bacteria 2030
147 Ga0316584_0039943 3300036712 Bacteria 3495
148 Ga0316584_0040182 3300036712 Bacteria 3485
149 Ga0316584_0061254 3300036712 Bacteria 2818
150 Ga0373925_0000002 3300037068 Bacteria 368879
151 Ga0395899_0000117 3300037312 Bacteria 130159
152 Ga0395899_0099377 3300037312 Bacteria 2102
153 Ga0395899_0122330 3300037312 Bacteria 1863
154 Ga0395900_0000020 3300037418 Bacteria 353500
155 Ga0395900_0096051 3300037418 Bacteria 3045
156 Ga0395898_0000259 3300037466 Bacteria 130131
157 Ga0395898_0204780 3300037466 Bacteria 1883
158 Ga0395898_0240431 3300037466 Bacteria 1727
159 Ga0395905_0000019 3300037471 Bacteria 353500
160 Ga0395905_0043130 3300037471 Bacteria 4232
161 Ga0395905_0098261 3300037471 Bacteria 2749
162 Ga0395905_0214929 3300037471 Bacteria 1801
163 Ga0395901_0000016 3300038443 Bacteria 354008
164 Ga0395901_0021614 3300038443 Bacteria 6592
165 Ga0395901_0101928 3300038443 Bacteria 3012
166 Ga0395901_0172056 3300038443 Bacteria 2272
167 Ga0400490_04617 3300038726 Bacteria 5498
168 Ga0400485_15017 3300038735 Bacteria 7951
169 Ga0400485_22432 3300038735 Bacteria 12334
170 Ga0400486_16468 3300038742 Bacteria 25660
171 Ga0400486_26222 3300038742 Bacteria 19122
172 Ga0400483_148209 3300039062 Bacteria 1564
173 Ga0400489_68201 3300039093 Bacteria 28552
174 Ga0400487_27113 3300039110 Bacteria 21813
175 Ga0436360_1210668 3300039438 Bacteria 1411
176 Ga0436361_0359765 3300039447 Bacteria 13269
177 Ga0436361_0409724 3300039447 Bacteria 3357
178 Ga0436361_0857330 3300039447 Bacteria 3917
179 Ga0436361_1041257 3300039447 Bacteria 929
180 Ga0436363_0991563 3300039450 Bacteria 7209
181 Ga0436363_1439138 3300039450 Bacteria 1143
182 Ga0436362_1146184 3300039453 Bacteria 944
183 Ga0439436_0004456 3300041404 Bacteria 4292
184 Ga0451807_0654134 3300041486 Bacteria 2482
185 Ga0439449_0017558 3300042007 Bacteria 2687
186 Ga0466966_0133124 3300044684 Bacteria 1521
187 Ga0453684_0043687 3300044712 Bacteria 6018
188 Ga0453684_0100570 3300044712 Bacteria 3538
189 Ga0466968_0038300 3300044735 Bacteria 2014
190 Ga0466957_0433967 3300044842 Bacteria 903
191 Ga0451576_0108662 3300045051 Bacteria 2886
192 Ga0495592_0000046 3300046454 Bacteria 117345
193 Ga0495629_0008176 3300046459 Bacteria 7693
194 Ga0495651_0001007 3300046462 Bacteria 21889
195 Ga0495653_0000006 3300046463 Bacteria 363285
196 Ga0495662_0005844 3300046476 Bacteria 6154
197 Ga0495664_0000002 3300046477 Bacteria 625183
198 Ga0495608_0000006 3300046511 Bacteria 324334
199 Ga0495618_0000282 3300046514 Bacteria 36848
200 Ga0495628_0000002 3300046516 Bacteria 589399
201 Ga0495630_0002024 3300046517 Bacteria 14095
202 Ga0495652_0000004 3300046529 Bacteria 588877
203 Ga0495640_0000007 3300046533 Bacteria 265481
204 Ga0495587_0000031 3300046536 Bacteria 126721
205 Ga0495645_0000003 3300046543 Bacteria 570133
206 Ga0495667_0000002 3300046559 Bacteria 437535
207 Ga0495634_0000110 3300046642 Bacteria 68101
208 Ga0495635_0000022 3300046663 Bacteria 160907
209 Ga0495657_0002481 3300046675 Bacteria 15518
210 Ga0495599_0000001 3300046678 Bacteria 537563
211 Ga0495623_0000898 3300046679 Bacteria 20166
212 Ga0495646_0000007 3300046680 Bacteria 236764
213 Ga0495658_0017800 3300046683 Bacteria 3680
214 Ga0495600_0000033 3300046809 Bacteria 83590
215 Ga0495604_0000005 3300047317 Bacteria 424516
216 Ga0495674_0000003 3300047319 Bacteria 562126
217 Ga0495674_0395620 3300047319 Bacteria 1116
218 Ga0495680_0000091 3300047322 Bacteria 81622
219 Ga0495675_0000133 3300047444 Bacteria 52544
220 Ga0495684_0000035 3300047471 Bacteria 107768
221 Ga0495593_0000184 3300047673 Bacteria 32427
222 Ga0495602_0000029 3300048088 Bacteria 142344
223 Ga0496102_0142636 3300048905 Bacteria 2247
224 Ga0496107_0202987 3300048910 Bacteria 1473
225 Ga0496109_0993859 3300048912 Bacteria 777
226 Ga0496113_0776904 3300048916 Bacteria 762
227 Ga0496115_0313985 3300048918 Bacteria 1283
228 Ga0496122_0057120 3300048925 Bacteria 2902
229 Ga0496122_0059317 3300048925 Bacteria 2825
230 Ga0496124_0148395 3300048927 Bacteria 1843
231 Ga0501031_0000018 3300049568 Bacteria 106734
232 Ga0501032_0000003 3300049569 Bacteria 317700
233 Ga0501032_0431439 3300049569 Bacteria 845
234 Ga0501033_0000132 3300049570 Bacteria 72558
235 Ga0501033_0000971 3300049570 Bacteria 26029
236 Ga0501033_0016719 3300049570 Bacteria 5549
237 Ga0501033_0079452 3300049570 Bacteria 2407
238 Ga0501034_0000005 3300049571 Bacteria 367512
239 Ga0501034_0000606 3300049571 Bacteria 56542
240 Ga0501034_0188473 3300049571 Bacteria 2025
241 Ga0501034_0218585 3300049571 Bacteria 1858
242 Ga0501036_0000005 3300049572 Bacteria 246420
243 Ga0501036_0056094 3300049572 Bacteria 3337
244 Ga0501037_0000045 3300049573 Bacteria 117148
245 Ga0501037_0028098 3300049573 Bacteria 4154
246 Ga0501037_0094236 3300049573 Bacteria 2165
247 Ga0501038_0000001 3300049574 Bacteria 375481
248 Ga0501038_0281757 3300049574 Bacteria 1308
249 Ga0501039_0000007 3300049575 Bacteria 277831
250 Ga0501039_0033895 3300049575 Bacteria 3939
251 Ga0501040_0052467 3300049576 Bacteria 2791
252 Ga0501042_0093845 3300049578 Bacteria 2155
253 Ga0501043_0000333 3300049579 Bacteria 42740
254 Ga0501043_0036331 3300049579 Bacteria 3874
255 Ga0501043_0053193 3300049579 Bacteria 3180
256 Ga0501046_0012495 3300049580 Bacteria 7226
257 Ga0501047_0000708 3300049581 Bacteria 34744
258 Ga0501047_0013999 3300049581 Bacteria 7623
259 Ga0501047_0352215 3300049581 Bacteria 1309
260 Ga0501048_0062705 3300049582 Bacteria 2630
261 Ga0501067_0029052 3300049583 Bacteria 3065
262 Ga0501067_0031074 3300049583 Bacteria 2963
263 Ga0501068_0013700 3300049584 Bacteria 4617
264 Ga0501070_0004880 3300049586 Bacteria 11458
265 Ga0501070_0012303 3300049586 Bacteria 7222
266 Ga0501070_0106791 3300049586 Bacteria 2314
267 Ga0501071_0069129 3300049587 Bacteria 2571
268 Ga0501071_0334363 3300049587 Bacteria 1151
269 Ga0501073_0028070 3300049589 Bacteria 4020
270 Ga0501073_0067036 3300049589 Bacteria 2502
271 Ga0501073_0236345 3300049589 Bacteria 1262
272 Ga0501076_0329176 3300049592 Bacteria 1253
273 Ga0501223_000219 3300049663 Bacteria 14606
274 Ga0501224_000095 3300049664 Bacteria 9322
275 Ga0501233_001666 3300049668 Bacteria 3821
276 Ga0501225_0000253 3300049705 Bacteria 16747
277 Ga0501234_002279 3300049707 Bacteria 3030
278 Ga0501080_0009048 3300049742 Bacteria 9064
279 Ga0501080_0035480 3300049742 Bacteria 4654
280 Ga0501080_0056497 3300049742 Bacteria 3655
281 Ga0501080_0209028 3300049742 Bacteria 1789
282 Ga0501080_0301245 3300049742 Bacteria 1454
283 Ga0501083_0003395 3300049744 Bacteria 11147
284 Ga0501083_0517218 3300049744 Bacteria 777
285 Ga0501035_0000008 3300049822 Bacteria 313425
286 Ga0501035_0016636 3300049822 Bacteria 6782
287 Ga0501035_0019717 3300049822 Bacteria 6195
288 Ga0501035_0194605 3300049822 Bacteria 1742
289 Ga0501044_0000001 3300049823 Bacteria 418087
290 Ga0501044_0017429 3300049823 Bacteria 7705
291 Ga0501044_0239741 3300049823 Bacteria 1757
292 Ga0501045_0081122 3300049824 Bacteria 2392
293 Ga0501226_000212 3300049853 Bacteria 9199
294 nmdc:mga05p37_230219_c1 3300050507 Bacteria 2233
295 nmdc:mga05p37_928_c1 3300050507 Bacteria 33059
296 nmdc:mga05p37_98749_c1 3300050507 Bacteria 3596
297 nmdc:mga09592_3151_c1 3300050508 Bacteria 13393
298 nmdc:mga0qj67_45479_c1 3300050509 Bacteria 3464
299 nmdc:mga06r32_119392_c1 3300050510 Bacteria 2600
300 nmdc:mga06r32_795_c1 3300050510 Bacteria 27918
301 nmdc:mga08y16_180304_c1 3300050511 Bacteria 2193
302 nmdc:mga08y16_2587_c1 3300050511 Bacteria 18610
303 nmdc:mga0n895_2148_c1 3300050512 Bacteria 15220
304 nmdc:mga0n895_29544_c1 3300050512 Bacteria 5230
305 nmdc:mga0n895_509761_c1 3300050512 Bacteria 1211
306 nmdc:mga0n895_91122_c1 3300050512 Bacteria 3050
307 nmdc:mga0rr50_4389_c1 3300050513 Bacteria 8285
308 nmdc:mga0rr50_4923_c1 3300050513 Bacteria 7904
309 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
310 nmdc:mga0a205_465654_c1 3300050515 Bacteria 1123
311 nmdc:mga0a205_47795_c1 3300050515 Bacteria 4129
312 Ga0495601_0000008 3300053077 Bacteria 362152
313 Ga0495612_0000026 3300053078 Bacteria 111627
314 Ga0495595_0000024 3300053084 Bacteria 108008
315 Ga0495619_0000002 3300053085 Bacteria 530226
316 Ga0501084_0837899 3300054114 Bacteria 774
317 Ga0501082_0259597 3300060353 Bacteria 1511
318 Ga0501082_0299273 3300060353 Bacteria 1401
319 Ga0501082_0316118 3300060353 Bacteria 1360
320 Ga0501082_0482095 3300060353 Bacteria 1084
321 Ga0466962_0333172 3300061719 Bacteria 754

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_1041257 Ga0436361_1041257_254_883 193
2 3300049571 Ga0501034_0218585 Ga0501034_0218585_98_796 209
3 3300049572 Ga0501036_0056094 Ga0501036_0056094_460_1158 209
4 3300049573 Ga0501037_0094236 Ga0501037_0094236_506_1204 209
5 3300049574 Ga0501038_0281757 Ga0501038_0281757_339_1037 209
6 3300049579 Ga0501043_0053193 Ga0501043_0053193_2360_3058 209
7 3300049581 Ga0501047_0352215 Ga0501047_0352215_440_1138 209
8 3300049583 Ga0501067_0031074 Ga0501067_0031074_206_904 209
9 3300049589 Ga0501073_0028070 Ga0501073_0028070_3071_3769 209
10 3300049823 Ga0501044_0239741 Ga0501044_0239741_449_1147 209
11 3300021358 Ga0213873_10031886 Ga0213873_100318862 214
12 3300039438 Ga0436360_1210668 Ga0436360_1210668_282_986 214
13 3300039453 Ga0436362_1146184 Ga0436362_1146184_198_899 214
14 3300049570 Ga0501033_0016719 Ga0501033_0016719_4080_4781 214
15 3300049581 Ga0501047_0013999 Ga0501047_0013999_3691_4392 214
16 3300049586 Ga0501070_0004880 Ga0501070_0004880_10141_10842 214
17 3300049742 Ga0501080_0009048 Ga0501080_0009048_340_1041 214
18 3300049822 Ga0501035_0016636 Ga0501035_0016636_5130_5831 214
19 3300049822 Ga0501035_0194605 Ga0501035_0194605_559_1260 214
20 3300049823 Ga0501044_0017429 Ga0501044_0017429_448_1149 214
21 3300060353 Ga0501082_0316118 Ga0501082_0316118_54_752 214
22 3300047319 Ga0495674_0395620 Ga0495674_0395620_410_1099 216
23 iso_pu_bacteria 2510461069 2510842883 216
24 iso_pu_bacteria 2643221653 2644297381 216
25 iso_pu_bacteria 2643221719 2644655634 216
26 3300039447 Ga0436361_0409724 Ga0436361_0409724_479_1183 217
27 3300005535 Ga0070684_100224022 Ga0070684_1002240222 218
28 3300026078 Ga0207702_10689033 Ga0207702_106890331 218
29 3300049583 Ga0501067_0029052 Ga0501067_0029052_372_1070 218
30 3300031595 Ga0265313_10003198 Ga0265313_100031984 219
31 3300049668 Ga0501233_001666 Ga0501233_001666_1954_2655 219
32 3300006946 Ga0079104_1001826 Ga0079104_100182613 220
33 3300027111 Ga0209281_1000141 Ga0209281_1000141117 220
34 3300028794 Ga0307515_10000691 Ga0307515_100006919 220
35 3300028800 Ga0265338_10559198 Ga0265338_105591981 220
36 3300031456 Ga0307513_10003481 Ga0307513_100034816 220
37 3300031548 Ga0307408_100006657 Ga0307408_1000066573 220
38 3300031548 Ga0307408_100217508 Ga0307408_1002175082 220
39 3300031911 Ga0307412_10000126 Ga0307412_1000012651 220
40 3300031995 Ga0307409_100584962 Ga0307409_1005849622 220
41 3300032004 Ga0307414_10000272 Ga0307414_1000027226 220
42 3300042007 Ga0439449_0017558 Ga0439449_0017558_1661_2353 220
43 3300049663 Ga0501223_000219 Ga0501223_000219_2192_2893 220
44 3300049664 Ga0501224_000095 Ga0501224_000095_5926_6627 220
45 3300049705 Ga0501225_0000253 Ga0501225_0000253_11880_12581 220
46 3300049707 Ga0501234_002279 Ga0501234_002279_1553_2254 220
47 3300049853 Ga0501226_000212 Ga0501226_000212_2594_3295 220
48 3300005937 Ga0081455_10262863 Ga0081455_102628632 221
49 3300049742 Ga0501080_0035480 Ga0501080_0035480_859_1557 221
50 3300049744 Ga0501083_0003395 Ga0501083_0003395_9352_10050 221
51 3300060353 Ga0501082_0259597 Ga0501082_0259597_321_1019 221
52 3300005434 Ga0070709_10268420 Ga0070709_102684201 222
53 3300005437 Ga0070710_10295334 Ga0070710_102953341 222
54 3300006846 Ga0075430_100009076 Ga0075430_1000090762 222
55 3300006847 Ga0075431_100030105 Ga0075431_1000301054 222
56 3300009147 Ga0114129_10430916 Ga0114129_104309162 222
57 3300025916 Ga0207663_10067007 Ga0207663_100670071 222
58 3300025928 Ga0207700_10876840 Ga0207700_108768401 222
59 3300035083 Ga0373926_0006707 Ga0373926_0006707_1152_1847 222
60 3300035111 Ga0373923_0003542 Ga0373923_0003542_1755_2450 222
61 3300035113 Ga0373936_0000845 Ga0373936_0000845_10058_10753 222
62 3300035113 Ga0373936_0022503 Ga0373936_0022503_801_1496 222
63 3300035116 Ga0373945_0002110 Ga0373945_0002110_1239_1934 222
64 3300035117 Ga0373953_0001013 Ga0373953_0001013_2098_2793 222
65 3300035118 Ga0373954_0012179 Ga0373954_0012179_3053_3748 222
66 3300035120 Ga0373957_0014147 Ga0373957_0014147_195_890 222
67 3300035170 Ga0373943_0007410 Ga0373943_0007410_351_1046 222
68 3300035171 Ga0373946_0002847 Ga0373946_0002847_5374_6069 222
69 3300035410 Ga0373924_0024182 Ga0373924_0024182_1516_2211 222
70 3300035692 Ga0373935_0000530 Ga0373935_0000530_940_1635 222
71 3300035695 Ga0373927_0019068 Ga0373927_0019068_66_761 222
72 3300035724 Ga0373933_0237231 Ga0373933_0237231_415_1110 222
73 3300035725 Ga0373947_0001048 Ga0373947_0001048_4213_4908 222
74 3300036401 Ga0373937_0000212 Ga0373937_0000212_51570_52265 222
75 3300037068 Ga0373925_0000002 Ga0373925_0000002_74147_74842 222
76 3300046454 Ga0495592_0000046 Ga0495592_0000046_109790_110485 222
77 3300046459 Ga0495629_0008176 Ga0495629_0008176_1117_1812 222
78 3300046462 Ga0495651_0001007 Ga0495651_0001007_8792_9487 222
79 3300046463 Ga0495653_0000006 Ga0495653_0000006_74295_74990 222
80 3300046476 Ga0495662_0005844 Ga0495662_0005844_2722_3417 222
81 3300046477 Ga0495664_0000002 Ga0495664_0000002_109929_110624 222
82 3300046511 Ga0495608_0000006 Ga0495608_0000006_103922_104617 222
83 3300046514 Ga0495618_0000282 Ga0495618_0000282_22799_23494 222
84 3300046516 Ga0495628_0000002 Ga0495628_0000002_74314_75009 222
85 3300046517 Ga0495630_0002024 Ga0495630_0002024_1267_1962 222
86 3300046529 Ga0495652_0000004 Ga0495652_0000004_513874_514569 222
87 3300046533 Ga0495640_0000007 Ga0495640_0000007_51608_52303 222
88 3300046536 Ga0495587_0000031 Ga0495587_0000031_74314_75009 222
89 3300046543 Ga0495645_0000003 Ga0495645_0000003_55565_56260 222
90 3300046559 Ga0495667_0000002 Ga0495667_0000002_362714_363409 222
91 3300046642 Ga0495634_0000110 Ga0495634_0000110_43590_44285 222
92 3300046663 Ga0495635_0000022 Ga0495635_0000022_44597_45292 222
93 3300046675 Ga0495657_0002481 Ga0495657_0002481_13389_14084 222
94 3300046678 Ga0495599_0000001 Ga0495599_0000001_212992_213687 222
95 3300046679 Ga0495623_0000898 Ga0495623_0000898_2150_2845 222
96 3300046680 Ga0495646_0000007 Ga0495646_0000007_23118_23813 222
97 3300046683 Ga0495658_0017800 Ga0495658_0017800_1507_2208 222
98 3300046809 Ga0495600_0000033 Ga0495600_0000033_8678_9373 222
99 3300047317 Ga0495604_0000005 Ga0495604_0000005_99958_100653 222
100 3300047319 Ga0495674_0000003 Ga0495674_0000003_487117_487812 222
101 3300047322 Ga0495680_0000091 Ga0495680_0000091_25459_26154 222
102 3300047444 Ga0495675_0000133 Ga0495675_0000133_299_994 222
103 3300047471 Ga0495684_0000035 Ga0495684_0000035_55467_56162 222
104 3300047673 Ga0495593_0000184 Ga0495593_0000184_27051_27746 222
105 3300048088 Ga0495602_0000029 Ga0495602_0000029_55457_56152 222
106 3300050507 nmdc:mga05p37_230219_c1 nmdc:mga05p37_230219_c1_1222_1920 222
107 3300050509 nmdc:mga0qj67_45479_c1 nmdc:mga0qj67_45479_c1_2627_3325 222
108 3300050510 nmdc:mga06r32_119392_c1 nmdc:mga06r32_119392_c1_369_1067 222
109 3300050512 nmdc:mga0n895_91122_c1 nmdc:mga0n895_91122_c1_1644_2342 222
110 3300050515 nmdc:mga0a205_465654_c1 nmdc:mga0a205_465654_c1_85_783 222
111 3300053077 Ga0495601_0000008 Ga0495601_0000008_247733_248428 222
112 3300053078 Ga0495612_0000026 Ga0495612_0000026_97531_98226 222
113 3300053084 Ga0495595_0000024 Ga0495595_0000024_55574_56269 222
114 3300053085 Ga0495619_0000002 Ga0495619_0000002_74317_75012 222
115 3300005459 Ga0068867_100762284 Ga0068867_1007622841 223
116 3300036401 Ga0373937_0172418 Ga0373937_0172418_565_1287 223
117 iso_pu_bacteria 8057160832 8057160870 224
118 3300006844 Ga0075428_100002840 Ga0075428_10000284019 225
119 3300006846 Ga0075430_100041599 Ga0075430_1000415992 225
120 3300006847 Ga0075431_100001610 Ga0075431_10000161019 225
121 3300006880 Ga0075429_100002359 Ga0075429_10000235916 225
122 3300009094 Ga0111539_10003049 Ga0111539_1000304919 225
123 3300009094 Ga0111539_10216622 Ga0111539_102166222 225
124 3300009147 Ga0114129_10001163 Ga0114129_1000116319 225
125 3300009147 Ga0114129_10078838 Ga0114129_100788384 225
126 3300013249 Ga0171463_1014 Ga0171463_101435 225
127 3300015690 Ga0183363_1028 Ga0183363_102822 225
128 3300027907 Ga0207428_10015017 Ga0207428_100150173 225
129 3300049571 Ga0501034_0188473 Ga0501034_0188473_649_1350 225
130 3300050507 nmdc:mga05p37_928_c1 nmdc:mga05p37_928_c1_13400_14098 225
131 3300050507 nmdc:mga05p37_98749_c1 nmdc:mga05p37_98749_c1_735_1433 225
132 3300050508 nmdc:mga09592_3151_c1 nmdc:mga09592_3151_c1_3731_4429 225
133 3300050510 nmdc:mga06r32_795_c1 nmdc:mga06r32_795_c1_13380_14078 225
134 3300050511 nmdc:mga08y16_180304_c1 nmdc:mga08y16_180304_c1_821_1519 225
135 3300050511 nmdc:mga08y16_2587_c1 nmdc:mga08y16_2587_c1_4513_5211 225
136 iso_pu_bacteria 2512047086 2512534339 225
137 iso_pu_bacteria 2558860983 2561467292 225
138 iso_pu_bacteria 641522639 642486866 225
139 3300049569 Ga0501032_0431439 Ga0501032_0431439_44_742 226
140 3300049571 Ga0501034_0000606 Ga0501034_0000606_30632_31330 226
141 iso_pu_bacteria 2508501122 2509110177 226
142 iso_pu_bacteria 2509276019 2509378910 226
143 iso_pu_bacteria 2510065057 2510303778 226
144 iso_pu_bacteria 2511231052 2511503075 226
145 iso_pu_bacteria 2511231221 2512033180 226
146 iso_pu_bacteria 2513237086 2513585952 226
147 iso_pu_bacteria 2513237091 2513617244 226
148 iso_pu_bacteria 2513237140 2513882985 226
149 iso_pu_bacteria 2513237143 2513903015 226
150 iso_pu_bacteria 2515154107 2515610241 226
151 iso_pu_bacteria 2516653046 2516894479 226
152 iso_pu_bacteria 2524023207 2524451969 226
153 iso_pu_bacteria 2524023250 2524611002 226
154 iso_pu_bacteria 2551306084 2551679890 226
155 iso_pu_bacteria 2551306085 2551689760 226
156 iso_pu_bacteria 2551306089 2551715220 226
157 iso_pu_bacteria 2551306090 2551716371 226
158 iso_pu_bacteria 2551306091 2551729546 226
159 iso_pu_bacteria 2551306093 2551745620 226
160 iso_pu_bacteria 2558860100 2558860495 226
161 iso_pu_bacteria 2595698237 2596374167 226
162 iso_pu_bacteria 2818991272 2819243047 226
163 iso_pu_bacteria 2840878972 2840882990 226
164 iso_pu_bacteria 2842698319 2842701446 226
165 iso_pu_bacteria 2850079185 2850082392 226
166 iso_pu_bacteria 2861691609 2861694900 226
167 iso_pu_bacteria 2889306138 2889307122 226
168 iso_pu_bacteria 2897803580 2897804307 226
169 iso_pu_bacteria 2899803654 2899806207 226
170 iso_pu_bacteria 2902330777 2902333042 226
171 iso_pu_bacteria 2902405164 2902411914 226
172 iso_pu_bacteria 2919408235 2919411410 226
173 iso_pu_bacteria 2928125067 2928129752 226
174 iso_pu_bacteria 2937056579 2937063069 226
175 iso_pu_bacteria 2967714385 2967715862 226
176 iso_pu_bacteria 2970068827 2970069400 226
177 iso_pu_bacteria 2989776772 2989777691 226
178 iso_pu_bacteria 648276728 648735763 226
179 3300005842 Ga0068858_100050803 Ga0068858_1000508033 227
180 3300013306 Ga0163162_10050947 Ga0163162_100509472 227
181 3300026035 Ga0207703_10042104 Ga0207703_100421043 227
182 3300031247 Ga0265340_10006446 Ga0265340_100064462 227
183 3300031250 Ga0265331_10012639 Ga0265331_100126391 227
184 iso_pu_bacteria 2939669807 2939671787 227
185 3300002987 JGI25159J45721_1000092 JGI25159J45721_10000924 228
186 3300002987 JGI25159J45721_1000403 JGI25159J45721_100040318 228
187 3300003354 JGI25160J50197_1000134 JGI25160J50197_100013424 228
188 3300003374 JGI25161J50226_1000116 JGI25161J50226_100011638 228
189 3300003775 Ga0055524_1001793 Ga0055524_10017935 228
190 3300003794 Ga0055531_10013092 Ga0055531_100130922 228
191 3300005262 Ga0065165_1000196 Ga0065165_100019658 228
192 3300044712 Ga0453684_0043687 Ga0453684_0043687_3584_4270 228
193 3300060353 Ga0501082_0482095 Ga0501082_0482095_98_784 228
194 iso_pu_bacteria 2837651117 2837653530 228
195 iso_pu_bacteria 2854681122 2854681827 228
196 iso_pu_bacteria 2883291878 2883294074 228
197 iso_pu_bacteria 2883354860 2883357384 228
198 iso_pu_bacteria 2898795034 2898795843 228
199 iso_pu_bacteria 643348564 643601400 228
200 3300005336 Ga0070680_100414471 Ga0070680_1004144711 229
201 3300015265 Ga0182005_1012908 Ga0182005_10129082 229
202 3300021361 Ga0213872_10001873 Ga0213872_100018736 229
203 3300025230 Ga0209563_105632 Ga0209563_1056322 229
204 3300025302 Ga0207426_1060775 Ga0207426_10607752 229
205 3300025917 Ga0207660_10590855 Ga0207660_105908551 229
206 3300031251 Ga0265327_10044168 Ga0265327_100441683 229
207 3300031733 Ga0316577_10008945 Ga0316577_100089455 229
208 3300031901 Ga0307406_10985237 Ga0307406_109852371 229
209 3300032133 Ga0316583_10021731 Ga0316583_100217312 229
210 3300034818 Ga0373950_0027405 Ga0373950_0027405_40_732 229
211 3300036712 Ga0316584_0040182 Ga0316584_0040182_329_1030 229
212 3300038726 Ga0400490_04617 Ga0400490_04617_2132_2830 229
213 3300038735 Ga0400485_15017 Ga0400485_15017_5812_6510 229
214 3300038735 Ga0400485_22432 Ga0400485_22432_2252_2950 229
215 3300038742 Ga0400486_16468 Ga0400486_16468_11678_12376 229
216 3300038742 Ga0400486_26222 Ga0400486_26222_13422_14120 229
217 3300039062 Ga0400483_148209 Ga0400483_148209_429_1127 229
218 3300039093 Ga0400489_68201 Ga0400489_68201_21832_22530 229
219 3300039110 Ga0400487_27113 Ga0400487_27113_15299_15997 229
220 3300039447 Ga0436361_0359765 Ga0436361_0359765_8139_8831 229
221 3300039447 Ga0436361_0857330 Ga0436361_0857330_2698_3402 229
222 3300041486 Ga0451807_0654134 Ga0451807_0654134_916_1608 229
223 3300044684 Ga0466966_0133124 Ga0466966_0133124_738_1430 229
224 3300044712 Ga0453684_0100570 Ga0453684_0100570_1175_1867 229
225 3300044735 Ga0466968_0038300 Ga0466968_0038300_184_876 229
226 3300044842 Ga0466957_0433967 Ga0466957_0433967_188_880 229
227 3300048910 Ga0496107_0202987 Ga0496107_0202987_187_879 229
228 3300048925 Ga0496122_0059317 Ga0496122_0059317_1875_2570 229
229 3300049570 Ga0501033_0000971 Ga0501033_0000971_9239_9937 229
230 3300049586 Ga0501070_0106791 Ga0501070_0106791_161_853 229
231 3300049742 Ga0501080_0209028 Ga0501080_0209028_802_1494 229
232 3300049742 Ga0501080_0301245 Ga0501080_0301245_207_899 229
233 3300049822 Ga0501035_0019717 Ga0501035_0019717_2425_3123 229
234 3300050512 nmdc:mga0n895_509761_c1 nmdc:mga0n895_509761_c1_503_1201 229
235 iso_pu_bacteria 2510917022 2511135889 229
236 iso_pu_bacteria 2512875026 2512973841 229
237 iso_pu_bacteria 2513237089 2513602442 229
238 iso_pu_bacteria 2513237156 2513985686 229
239 iso_pu_bacteria 2513237160 2514004085 229
240 iso_pu_bacteria 2516143018 2516205339 229
241 iso_pu_bacteria 2517487022 2517571097 229
242 iso_pu_bacteria 2582581283 2585168136 229
243 iso_pu_bacteria 2582581307 2585272022 229
244 iso_pu_bacteria 2585427531 2585563433 229
245 iso_pu_bacteria 2585427608 2585897145 229
246 iso_pu_bacteria 2585427609 2585909060 229
247 iso_pu_bacteria 2585428125 2587984474 229
248 iso_pu_bacteria 2599185352 2600194183 229
249 iso_pu_bacteria 2643221557 2643809676 229
250 iso_pu_bacteria 2643221607 2644048411 229
251 iso_pu_bacteria 2643221610 2644063856 229
252 iso_pu_bacteria 2643221636 2644201772 229
253 iso_pu_bacteria 2643221668 2644381378 229
254 iso_pu_bacteria 2643221675 2644415689 229
255 iso_pu_bacteria 2643221680 2644448729 229
256 iso_pu_bacteria 2643221686 2644481213 229
257 iso_pu_bacteria 2643221689 2644500099 229
258 iso_pu_bacteria 2643221723 2644676650 229
259 iso_pu_bacteria 2643221726 2644686877 229
260 iso_pu_bacteria 2657244999 2657684497 229
261 iso_pu_bacteria 2690316117 2692314413 229
262 iso_pu_bacteria 2738541281 2738744592 229
263 iso_pu_bacteria 2738543032 2739353822 229
264 iso_pu_bacteria 2751185821 2753460998 229
265 iso_pu_bacteria 2767802442 2770199625 229
266 iso_pu_bacteria 2775506902 2776271018 229
267 iso_pu_bacteria 2775506904 2776282910 229
268 iso_pu_bacteria 2791355082 2792582472 229
269 iso_pu_bacteria 2791355091 2792624365 229
270 iso_pu_bacteria 2791355092 2792625633 229
271 iso_pu_bacteria 2791355094 2792643709 229
272 iso_pu_bacteria 2791355253 2793283016 229
273 iso_pu_bacteria 2802428858 2802717813 229
274 iso_pu_bacteria 2802428859 2802725336 229
275 iso_pu_bacteria 2802428860 2802730540 229
276 iso_pu_bacteria 2802428861 2802737887 229
277 iso_pu_bacteria 2802428862 2802744244 229
278 iso_pu_bacteria 2802428863 2802753072 229
279 iso_pu_bacteria 2802429268 2804753398 229
280 iso_pu_bacteria 2818991461 2819682675 229
281 iso_pu_bacteria 2829745981 2829746328 229
282 iso_pu_bacteria 2838029111 2838034211 229
283 iso_pu_bacteria 2840764183 2840768991 229
284 iso_pu_bacteria 2842475841 2842480957 229
285 iso_pu_bacteria 2842502639 2842507568 229
286 iso_pu_bacteria 2842922631 2842925789 229
287 iso_pu_bacteria 2847417321 2847420535 229
288 iso_pu_bacteria 2848992105 2848995407 229
289 iso_pu_bacteria 2854896431 2854899882 229
290 iso_pu_bacteria 2854916844 2854920910 229
291 iso_pu_bacteria 2855825444 2855827115 229
292 iso_pu_bacteria 2855839649 2855842512 229
293 iso_pu_bacteria 2855872281 2855878338 229
294 iso_pu_bacteria 2858800743 2858803328 229
295 iso_pu_bacteria 2861691609 2861695184 229
296 iso_pu_bacteria 2915980308 2915980649 229
297 iso_pu_bacteria 2915986958 2915991055 229
298 iso_pu_bacteria 2915993759 2915997711 229
299 iso_pu_bacteria 2916000859 2916006930 229
300 iso_pu_bacteria 2916007675 2916009464 229
301 iso_pu_bacteria 2916014648 2916019502 229
302 iso_pu_bacteria 2916021584 2916027696 229
303 iso_pu_bacteria 2916028427 2916030291 229
304 iso_pu_bacteria 2916035215 2916036848 229
305 iso_pu_bacteria 2916041962 2916044705 229
306 iso_pu_bacteria 2916048683 2916053906 229
307 iso_pu_bacteria 2916055098 2916058417 229
308 iso_pu_bacteria 2916061851 2916065609 229
309 iso_pu_bacteria 2916068649 2916073780 229
310 iso_pu_bacteria 2916076590 2916077932 229
311 iso_pu_bacteria 2919119836 2919121293 229
312 iso_pu_bacteria 2920760137 2920760667 229
313 iso_pu_bacteria 2920822456 2920828393 229
314 iso_pu_bacteria 2921201388 2921201431 229
315 iso_pu_bacteria 2921208531 2921209588 229
316 iso_pu_bacteria 2921237296 2921237514 229
317 iso_pu_bacteria 2921244191 2921244303 229
318 iso_pu_bacteria 2921250672 2921252588 229
319 iso_pu_bacteria 2921257292 2921260657 229
320 iso_pu_bacteria 2921263974 2921265916 229
321 iso_pu_bacteria 2921282425 2921286313 229
322 iso_pu_bacteria 2921289301 2921293344 229
323 iso_pu_bacteria 2921296804 2921300188 229
324 iso_pu_bacteria 2924144063 2924148734 229
325 iso_pu_bacteria 2924150972 2924154943 229
326 iso_pu_bacteria 2924158325 2924164159 229
327 iso_pu_bacteria 2924165586 2924166584 229
328 iso_pu_bacteria 2924172951 2924174373 229
329 iso_pu_bacteria 2924179722 2924182302 229
330 iso_pu_bacteria 2924186466 2924188514 229
331 iso_pu_bacteria 2924193448 2924193859 229
332 iso_pu_bacteria 2924200457 2924206614 229
333 iso_pu_bacteria 2924207177 2924213046 229
334 iso_pu_bacteria 2924214083 2924221285 229
335 iso_pu_bacteria 2924221636 2924226807 229
336 iso_pu_bacteria 2924228884 2924231996 229
337 iso_pu_bacteria 2928521798 2928523575 229
338 iso_pu_bacteria 2936996657 2937000147 229
339 iso_pu_bacteria 2937002841 2937006904 229
340 iso_pu_bacteria 2937009748 2937015374 229
341 iso_pu_bacteria 2937016420 2937018093 229
342 iso_pu_bacteria 2937023124 2937024297 229
343 iso_pu_bacteria 2937029754 2937032908 229
344 iso_pu_bacteria 2937036028 2937042308 229
345 iso_pu_bacteria 2937042894 2937046644 229
346 iso_pu_bacteria 2937049772 2937052260 229
347 iso_pu_bacteria 2937063883 2937067503 229
348 iso_pu_bacteria 2937071275 2937071318 229
349 iso_pu_bacteria 2937078374 2937078715 229
350 iso_pu_bacteria 2937084907 2937086671 229
351 iso_pu_bacteria 2937091812 2937092975 229
352 iso_pu_bacteria 2937098957 2937104797 229
353 iso_pu_bacteria 2937106411 2937110557 229
354 iso_pu_bacteria 2937113482 2937114491 229
355 iso_pu_bacteria 2937119839 2937123781 229
356 iso_pu_bacteria 2937126314 2937129241 229
357 iso_pu_bacteria 2941499720 2941501600 229
358 iso_pu_bacteria 2954011201 2954015857 229
359 iso_pu_bacteria 2957375807 2957376848 229
360 iso_pu_bacteria 2957382221 2957386002 229
361 iso_pu_bacteria 2957388812 2957390086 229
362 iso_pu_bacteria 2957395598 2957396850 229
363 iso_pu_bacteria 2957402308 2957406183 229
364 iso_pu_bacteria 2957408893 2957408936 229
365 iso_pu_bacteria 2957415311 2957421977 229
366 iso_pu_bacteria 2957430029 2957430614 229
367 iso_pu_bacteria 2957437181 2957441386 229
368 iso_pu_bacteria 2957443900 2957444428 229
369 iso_pu_bacteria 2957450854 2957454462 229
370 iso_pu_bacteria 2957457609 2957459437 229
371 iso_pu_bacteria 2957464669 2957468278 229
372 iso_pu_bacteria 2957471148 2957472012 229
373 iso_pu_bacteria 2957478035 2957480937 229
374 iso_pu_bacteria 2957484790 2957485580 229
375 iso_pu_bacteria 2957491536 2957495190 229
376 iso_pu_bacteria 2957498199 2957500309 229
377 iso_pu_bacteria 2957505466 2957506973 229
378 iso_pu_bacteria 2960584000 2960587535 229
379 iso_pu_bacteria 2960591022 2960591362 229
380 iso_pu_bacteria 2960597568 2960598695 229
381 iso_pu_bacteria 2960603979 2960605054 229
382 iso_pu_bacteria 2960610863 2960617332 229
383 iso_pu_bacteria 2960617483 2960618676 229
384 iso_pu_bacteria 2960624210 2960629607 229
385 iso_pu_bacteria 2960631154 2960632616 229
386 iso_pu_bacteria 2960637947 2960638784 229
387 iso_pu_bacteria 2960645483 2960646665 229
388 iso_pu_bacteria 2960652885 2960659717 229
389 iso_pu_bacteria 2960660292 2960662873 229
390 iso_pu_bacteria 2960667422 2960671415 229
391 iso_pu_bacteria 2960674078 2960675403 229
392 iso_pu_bacteria 2960680706 2960681446 229
393 iso_pu_bacteria 2960687367 2960687851 229
394 iso_pu_bacteria 2960693952 2960694486 229
395 iso_pu_bacteria 2964607997 2964612362 229
396 iso_pu_bacteria 2964615318 2964618542 229
397 iso_pu_bacteria 2964621998 2964624860 229
398 iso_pu_bacteria 2964628898 2964631403 229
399 iso_pu_bacteria 2964636051 2964640521 229
400 iso_pu_bacteria 2964643177 2964647160 229
401 iso_pu_bacteria 2964649959 2964650943 229
402 iso_pu_bacteria 2964656573 2964659055 229
403 iso_pu_bacteria 2964663802 2964668776 229
404 iso_pu_bacteria 2964670856 2964673260 229
405 iso_pu_bacteria 2964678106 2964681710 229
406 iso_pu_bacteria 2964685014 2964689439 229
407 iso_pu_bacteria 2964691889 2964692662 229
408 iso_pu_bacteria 2964698721 2964705111 229
409 iso_pu_bacteria 2964705432 2964706275 229
410 iso_pu_bacteria 2964712639 2964719034 229
411 iso_pu_bacteria 2964719344 2964724303 229
412 iso_pu_bacteria 2967664464 2967666410 229
413 iso_pu_bacteria 2967671571 2967673165 229
414 iso_pu_bacteria 2967678726 2967682964 229
415 iso_pu_bacteria 2967686174 2967686594 229
416 iso_pu_bacteria 2967693043 2967696078 229
417 iso_pu_bacteria 2967699805 2967699944 229
418 iso_pu_bacteria 2967706974 2967708261 229
419 iso_pu_bacteria 2967721400 2967722051 229
420 iso_pu_bacteria 2967728569 2967732402 229
421 iso_pu_bacteria 2967735183 2967735469 229
422 iso_pu_bacteria 2967742019 2967743442 229
423 iso_pu_bacteria 2967748971 2967750175 229
424 iso_pu_bacteria 2967755722 2967760027 229
425 iso_pu_bacteria 2967762386 2967769105 229
426 iso_pu_bacteria 2967769361 2967774506 229
427 iso_pu_bacteria 2967775926 2967777491 229
428 iso_pu_bacteria 2970019648 2970025016 229
429 iso_pu_bacteria 2970026789 2970029397 229
430 iso_pu_bacteria 2970033650 2970040698 229
431 iso_pu_bacteria 2970040964 2970041807 229
432 iso_pu_bacteria 2970047711 2970049505 229
433 iso_pu_bacteria 2970054988 2970061011 229
434 iso_pu_bacteria 2970061556 2970068102 229
435 iso_pu_bacteria 2970076120 2970082614 229
436 iso_pu_bacteria 2970082768 2970084208 229
437 iso_pu_bacteria 2970088815 2970095456 229
438 iso_pu_bacteria 2970095765 2970099038 229
439 iso_pu_bacteria 2970102677 2970108784 229
440 iso_pu_bacteria 2970109326 2970115211 229
441 iso_pu_bacteria 2970116247 2970119273 229
442 iso_pu_bacteria 2970122695 2970126379 229
443 iso_pu_bacteria 2970129317 2970134253 229
444 iso_pu_bacteria 2970136068 2970137430 229
445 iso_pu_bacteria 2970143518 2970144627 229
446 iso_pu_bacteria 2970149975 2970155692 229
447 iso_pu_bacteria 2970156795 2970158290 229
448 iso_pu_bacteria 2970164137 2970165937 229
449 iso_pu_bacteria 2970170962 2970173301 229
450 iso_pu_bacteria 2970177841 2970179794 229
451 iso_pu_bacteria 2970184632 2970186480 229
452 iso_pu_bacteria 2970191845 2970194464 229
453 iso_pu_bacteria 2977516862 2977520738 229
454 iso_pu_bacteria 2977523885 2977530130 229
455 iso_pu_bacteria 2977530762 2977532392 229
456 iso_pu_bacteria 2977537788 2977540923 229
457 iso_pu_bacteria 2977544691 2977551170 229
458 iso_pu_bacteria 2977551784 2977556803 229
459 iso_pu_bacteria 2977558990 2977565552 229
460 iso_pu_bacteria 2977565890 2977569065 229
461 iso_pu_bacteria 2977572785 2977578056 229
462 iso_pu_bacteria 2977579622 2977579666 229
463 iso_pu_bacteria 3005416602 3005416932 229
464 iso_pu_bacteria 8003992118 8003995053 229
465 iso_pu_bacteria 8003999396 8004002815 229
466 iso_pu_bacteria 8005246636 8005247139 229
467 iso_pu_bacteria 8005314921 8005315864 229
468 iso_pu_bacteria 8005382845 8005387653 229
469 iso_pu_bacteria 8049293176 8049296016 229
470 3300005436 Ga0070713_100019952 Ga0070713_1000199522 230
471 3300005530 Ga0070679_100091444 Ga0070679_1000914442 230
472 3300005530 Ga0070679_100311830 Ga0070679_1003118302 230
473 3300005546 Ga0070696_100402646 Ga0070696_1004026461 230
474 3300005618 Ga0068864_100574503 Ga0068864_1005745031 230
475 3300005981 Ga0081538_10002795 Ga0081538_1000279511 230
476 3300006175 Ga0070712_100002508 Ga0070712_1000025088 230
477 3300006847 Ga0075431_100409733 Ga0075431_1004097332 230
478 3300006852 Ga0075433_10037525 Ga0075433_100375253 230
479 3300006871 Ga0075434_100004952 Ga0075434_10000495211 230
480 3300006871 Ga0075434_100034464 Ga0075434_1000344645 230
481 3300007076 Ga0075435_100012346 Ga0075435_1000123462 230
482 3300009147 Ga0114129_10456401 Ga0114129_104564012 230
483 3300013306 Ga0163162_10254253 Ga0163162_102542532 230
484 3300014969 Ga0157376_11105930 Ga0157376_111059301 230
485 3300021361 Ga0213872_10017859 Ga0213872_100178594 230
486 3300025898 Ga0207692_10184715 Ga0207692_101847152 230
487 3300025910 Ga0207684_10249225 Ga0207684_102492252 230
488 3300025915 Ga0207693_10004810 Ga0207693_100048104 230
489 3300025921 Ga0207652_10070527 Ga0207652_100705273 230
490 3300025928 Ga0207700_10370044 Ga0207700_103700442 230
491 3300031238 Ga0265332_10000898 Ga0265332_100008984 230
492 3300031241 Ga0265325_10013858 Ga0265325_100138584 230
493 3300031249 Ga0265339_10007156 Ga0265339_100071567 230
494 3300031250 Ga0265331_10036374 Ga0265331_100363742 230
495 3300031711 Ga0265314_10142523 Ga0265314_101425232 230
496 3300031712 Ga0265342_10000291 Ga0265342_1000029144 230
497 3300031995 Ga0307409_100371798 Ga0307409_1003717982 230
498 3300035118 Ga0373954_0094466 Ga0373954_0094466_143_838 230
499 3300035242 Ga0373962_0076272 Ga0373962_0076272_287_982 230
500 3300036712 Ga0316584_0039943 Ga0316584_0039943_2598_3290 230
501 3300039450 Ga0436363_1439138 Ga0436363_1439138_268_963 230
502 3300045051 Ga0451576_0108662 Ga0451576_0108662_72_785 230
503 3300048912 Ga0496109_0993859 Ga0496109_0993859_37_732 230
504 3300049570 Ga0501033_0079452 Ga0501033_0079452_1000_1695 230
505 3300049587 Ga0501071_0334363 Ga0501071_0334363_305_1000 230
506 3300049589 Ga0501073_0236345 Ga0501073_0236345_311_1006 230
507 3300049592 Ga0501076_0329176 Ga0501076_0329176_361_1056 230
508 3300050512 nmdc:mga0n895_2148_c1 nmdc:mga0n895_2148_c1_601_1296 230
509 3300050512 nmdc:mga0n895_29544_c1 nmdc:mga0n895_29544_c1_3813_4508 230
510 3300050513 nmdc:mga0rr50_4923_c1 nmdc:mga0rr50_4923_c1_5534_6229 230
511 3300050515 nmdc:mga0a205_47795_c1 nmdc:mga0a205_47795_c1_3091_3786 230
512 3300054114 Ga0501084_0837899 Ga0501084_0837899_21_716 230
513 3300060353 Ga0501082_0299273 Ga0501082_0299273_282_977 230
514 iso_pu_bacteria 2599185301 2599936655 230
515 iso_pu_bacteria 2643221551 2643776011 230
516 iso_pu_bacteria 2643221555 2643794458 230
517 iso_pu_bacteria 2857349434 2857351059 230
518 iso_pu_bacteria 2869278585 2869285034 230
519 iso_pu_bacteria 2871495908 2871501302 230
520 iso_pu_bacteria 2874123672 2874130699 230
521 iso_pu_bacteria 2878738818 2878745328 230
522 iso_pu_bacteria 2878760144 2878765282 230
523 iso_pu_bacteria 2878767105 2878772989 230
524 iso_pu_bacteria 2881147464 2881151614 230
525 iso_pu_bacteria 2882632389 2882636368 230
526 iso_pu_bacteria 2888350351 2888355865 230
527 iso_pu_bacteria 2889010040 2889010802 230
528 iso_pu_bacteria 2889016732 2889017503 230
529 iso_pu_bacteria 2903540706 2903546113 230
530 iso_pu_bacteria 2906328253 2906329923 230
531 iso_pu_bacteria 2924776078 2924783572 230
532 iso_pu_bacteria 2937994558 2937999971 230
533 iso_pu_bacteria 2958034702 2958040736 230
534 iso_pu_bacteria 2958041894 2958056818 230
535 iso_pu_bacteria 2958100919 2958102856 230
536 iso_pu_bacteria 2958144490 2958148195 230
537 iso_pu_bacteria 2958165035 2958170435 230
538 iso_pu_bacteria 2958172287 2958178623 230
539 iso_pu_bacteria 2961163497 2961168890 230
540 iso_pu_bacteria 2965018300 2965024177 230
541 iso_pu_bacteria 2965062239 2965064826 230
542 iso_pu_bacteria 2965119406 2965126118 230
543 iso_pu_bacteria 2968117919 2968120722 230
544 iso_pu_bacteria 2968128360 2968129270 230
545 iso_pu_bacteria 2968171901 2968177284 230
546 iso_pu_bacteria 2970554993 2970560130 230
547 iso_pu_bacteria 2970593180 2970599648 230
548 iso_pu_bacteria 2977864932 2977866992 230
549 iso_pu_bacteria 2977971508 2977978651 230
550 iso_pu_bacteria 2979710463 2979714317 230
551 iso_pu_bacteria 2979742915 2979744859 230
552 iso_pu_bacteria 2987636660 2987638244 230
553 iso_pu_bacteria 2987652177 2987652922 230
554 iso_pu_bacteria 2987659509 2987664921 230
555 iso_pu_bacteria 2996336353 2996338048 230
556 iso_pu_bacteria 3003665799 3003669106 230
557 iso_pu_bacteria 3004188549 3004193978 230
558 iso_pu_bacteria 3004203850 3004205512 230
559 3300005536 Ga0070697_100000782 Ga0070697_10000078220 231
560 3300005546 Ga0070696_100172606 Ga0070696_1001726062 231
561 3300006914 Ga0075436_100000569 Ga0075436_10000056916 231
562 3300025206 Ga0209435_100031 Ga0209435_10003133 231
563 3300025246 Ga0209646_1000102 Ga0209646_100010233 231
564 3300025250 Ga0209026_1000096 Ga0209026_100009633 231
565 3300025256 Ga0209759_1000090 Ga0209759_100009033 231
566 3300025912 Ga0207707_10258637 Ga0207707_102586372 231
567 3300025939 Ga0207665_10071706 Ga0207665_100717064 231
568 3300049589 Ga0501073_0067036 Ga0501073_0067036_1757_2455 231
569 3300050513 nmdc:mga0rr50_4389_c1 nmdc:mga0rr50_4389_c1_4328_5026 231
570 3300050514 nmdc:mga08x19_6_c1 nmdc:mga08x19_6_c1_158897_159595 231
571 iso_pu_bacteria 2643221618 2644106654 231
572 iso_pu_bacteria 2643221626 2644149627 231
573 iso_pu_bacteria 2643221655 2644309728 231
574 iso_pu_bacteria 2643221659 2644333399 231
575 iso_pu_bacteria 2643221698 2644543583 231
576 iso_pu_bacteria 2643221712 2644618175 231
577 iso_pu_bacteria 2844163670 2844167632 231
578 3300005985 Ga0081539_10110080 Ga0081539_101100801 232
579 3300025921 Ga0207652_10089430 Ga0207652_100894302 232
580 3300031727 Ga0316576_10022936 Ga0316576_100229363 232
581 3300031728 Ga0316578_10033702 Ga0316578_100337023 232
582 3300035398 Ga0316574_0088069 Ga0316574_0088069_493_1191 232
583 3300036712 Ga0316584_0061254 Ga0316584_0061254_828_1526 232
584 iso_pu_bacteria 2599185156 2599334665 232
585 iso_pu_bacteria 2899259804 2899259872 232
586 3300003771 Ga0055526_1002223 Ga0055526_100222314 233
587 3300003794 Ga0055531_10029863 Ga0055531_100298632 233
588 3300003856 Ga0058692_1018732 Ga0058692_10187322 233
589 3300004625 Ga0055543_1001164 Ga0055543_10011644 233
590 3300009148 Ga0105243_10698709 Ga0105243_106987092 233
591 3300010375 Ga0105239_10959659 Ga0105239_109596591 233
592 3300025208 Ga0209436_101037 Ga0209436_1010376 233
593 3300025284 Ga0209130_1000198 Ga0209130_100019835 233
594 3300025292 Ga0209676_1004562 Ga0209676_10045625 233
595 3300025294 Ga0209025_1000339 Ga0209025_100033956 233
596 3300025295 Ga0209564_1000353 Ga0209564_100035339 233
597 3300025298 Ga0209050_1010702 Ga0209050_10107022 233
598 3300025299 Ga0209256_1000368 Ga0209256_100036868 233
599 3300025299 Ga0209256_1000456 Ga0209256_100045637 233
600 3300025299 Ga0209256_1000884 Ga0209256_10008846 233
601 3300025302 Ga0207426_1000048 Ga0207426_1000048344 233
602 3300025303 Ga0209051_1056724 Ga0209051_10567241 233
603 3300025304 Ga0209257_1011520 Ga0209257_10115205 233
604 3300025914 Ga0207671_10113883 Ga0207671_101138832 233
605 3300025924 Ga0207694_10094779 Ga0207694_100947792 233
606 3300037312 Ga0395899_0000117 Ga0395899_0000117_91705_92409 233
607 3300037312 Ga0395899_0099377 Ga0395899_0099377_476_1180 233
608 3300037312 Ga0395899_0122330 Ga0395899_0122330_460_1164 233
609 3300037418 Ga0395900_0000020 Ga0395900_0000020_91705_92409 233
610 3300037418 Ga0395900_0096051 Ga0395900_0096051_1802_2506 233
611 3300037466 Ga0395898_0000259 Ga0395898_0000259_91705_92409 233
612 3300037466 Ga0395898_0204780 Ga0395898_0204780_885_1589 233
613 3300037466 Ga0395898_0240431 Ga0395898_0240431_282_986 233
614 3300037471 Ga0395905_0000019 Ga0395905_0000019_261092_261796 233
615 3300037471 Ga0395905_0043130 Ga0395905_0043130_3366_4070 233
616 3300037471 Ga0395905_0098261 Ga0395905_0098261_743_1447 233
617 3300037471 Ga0395905_0214929 Ga0395905_0214929_516_1220 233
618 3300038443 Ga0395901_0000016 Ga0395901_0000016_92213_92917 233
619 3300038443 Ga0395901_0021614 Ga0395901_0021614_2919_3623 233
620 3300038443 Ga0395901_0101928 Ga0395901_0101928_656_1360 233
621 3300038443 Ga0395901_0172056 Ga0395901_0172056_150_854 233
622 3300048905 Ga0496102_0142636 Ga0496102_0142636_1448_2152 233
623 3300048916 Ga0496113_0776904 Ga0496113_0776904_34_738 233
624 3300048918 Ga0496115_0313985 Ga0496115_0313985_350_1054 233
625 3300049568 Ga0501031_0000018 Ga0501031_0000018_35135_35839 233
626 3300049569 Ga0501032_0000003 Ga0501032_0000003_295795_296499 233
627 3300049570 Ga0501033_0000132 Ga0501033_0000132_46141_46845 233
628 3300049571 Ga0501034_0000005 Ga0501034_0000005_295795_296499 233
629 3300049572 Ga0501036_0000005 Ga0501036_0000005_174663_175367 233
630 3300049573 Ga0501037_0000045 Ga0501037_0000045_45542_46246 233
631 3300049573 Ga0501037_0028098 Ga0501037_0028098_1939_2643 233
632 3300049574 Ga0501038_0000001 Ga0501038_0000001_295795_296499 233
633 3300049575 Ga0501039_0000007 Ga0501039_0000007_200676_201380 233
634 3300049575 Ga0501039_0033895 Ga0501039_0033895_2817_3521 233
635 3300049576 Ga0501040_0052467 Ga0501040_0052467_486_1190 233
636 3300049578 Ga0501042_0093845 Ga0501042_0093845_1349_2053 233
637 3300049579 Ga0501043_0000333 Ga0501043_0000333_23760_24464 233
638 3300049579 Ga0501043_0036331 Ga0501043_0036331_1719_2423 233
639 3300049580 Ga0501046_0012495 Ga0501046_0012495_1899_2603 233
640 3300049581 Ga0501047_0000708 Ga0501047_0000708_18486_19190 233
641 3300049582 Ga0501048_0062705 Ga0501048_0062705_267_971 233
642 3300049584 Ga0501068_0013700 Ga0501068_0013700_3701_4405 233
643 3300049586 Ga0501070_0012303 Ga0501070_0012303_5841_6545 233
644 3300049587 Ga0501071_0069129 Ga0501071_0069129_540_1244 233
645 3300049742 Ga0501080_0056497 Ga0501080_0056497_1282_1986 233
646 3300049744 Ga0501083_0517218 Ga0501083_0517218_33_734 233
647 3300049822 Ga0501035_0000008 Ga0501035_0000008_241674_242378 233
648 3300049823 Ga0501044_0000001 Ga0501044_0000001_121589_122293 233
649 3300049824 Ga0501045_0081122 Ga0501045_0081122_1506_2210 233
650 3300061719 Ga0466962_0333172 Ga0466962_0333172_11_712 233
651 iso_pu_bacteria 8018150411 8018153471 233
652 iso_pu_bacteria 8045864390 8045866022 233
653 3300005985 Ga0081539_10002530 Ga0081539_1000253023 234
654 iso_pu_bacteria 2511231027 2511391489 235
655 iso_pu_bacteria 2667528174 2671116072 235
656 3300039450 Ga0436363_0991563 Ga0436363_0991563_2110_2853 236
657 iso_pu_bacteria 2937843397 2937846169 237
658 3300001979 JGI24740J21852_10004123 JGI24740J21852_100041237 239
659 3300002737 JGI25162J39368_1000485 JGI25162J39368_100048525 239
660 3300003214 JGI25165J46597_1000536 JGI25165J46597_100053630 239
661 3300025228 Ga0209672_105943 Ga0209672_1059432 239
662 3300025233 Ga0209437_100179 Ga0209437_100179116 239
663 3300025261 Ga0209233_1000185 Ga0209233_1000185115 239
664 3300025272 Ga0209455_1016486 Ga0209455_10164862 239
665 3300041404 Ga0439436_0004456 Ga0439436_0004456_2773_3495 239
666 3300048925 Ga0496122_0057120 Ga0496122_0057120_1670_2389 239
667 3300048927 Ga0496124_0148395 Ga0496124_0148395_144_863 239
668 iso_pu_bacteria 2615840698 2616551049 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

25

218

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.9462 15 224
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.938 16 229
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.859 23 229
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8376 6 229
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8063 16 229
ID Description Score Start End Superfamily
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.977 11 232 1.10.3720.10
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9684 11 232 1.10.3720.10
3d31C00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9462 15 224 1.10.3720.10
af_P16701_14_273_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9436 15 234 1.10.3720.10
af_P9WG13_10_255_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9375 6 226 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A528EAM7-F1-model_v4 Molybdate ABC transporter permease subunit 0.9919 12 179 GO:0005886
GO:0055085
AF-A0A7Y7A4J5-F1-model_v4 deleted 0.9876 12 192
AF-A0A549T5B5-F1-model_v4 Molybdenum transport system permease 0.9871 11 236 GO:0005886
GO:0015098
AF-A0A358LAA4-F1-model_v4 Molybdenum transport system permease 0.9869 11 218 GO:0005886
GO:0015098
AF-A0A3M1JMU9-F1-model_v4 Molybdenum transport system permease 0.986 11 195 GO:0005886
GO:0015098

Feature Viewer

pLDDT pTM Quality
86.37 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map