F473933
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 668 | 408 | 592 | 452 |
Family's Representative Sequence
| Representative Sequence | 3300031456|Ga0307513_10000038|Ga0307513_10000038147 |
| Length | 513 |
| Sequence | MAEFKEISPDAPIAVKAMNWIDNRFPASKLYKEHMSEYYAPKNFNFWYIFGSLAMLVLVIQIVTGIFLTMNYKPDAALAFGSVEYIMRDVPWGWLIRYMHSTGASAFFVVVYLHMFRGLLYGSYRKPRELVWIFGCAIFLCLMAEAFMGYLLPWGQMSYWGAQVIVNLFAAIPFIGPDLALLIRGDYVVGDATLNRFFAFHVIAVPLVLLGLVAAHIIALHEVGSNNPDGVEIKGPNAPKDAAGHPVDGIPFHPYYTVHDIFGVSMFLMIFTAIIFFAPEFGGYFLEYNNFIPADPLKTPAHIAPVWYFTPYYSMLRAITGEMAGALGIIAIVAAVLAARKLKGIFKPAVLVIAIGAALLLGLLPSIANWVGLVAPSAGAGIAKGLDALAKPLAGVPFLGELWGMMVKGIDAKFWGVVXMGGAVIILFFLPWLDHSPVKSIRYRPDWHKYMYGIFVVNFLVLGYLGVQPPSAIGERVSQLGTLFYFGFFLLMPWWSRQGTAKTPPDRIIFHGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 4 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 5 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 6 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 7 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 8 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 9 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 10 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 11 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 12 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 13 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 14 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 15 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 16 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 17 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 18 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 19 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 20 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 21 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 22 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 23 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 24 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 25 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 26 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 27 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 28 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 29 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 30 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 31 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 32 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 33 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 34 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 35 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 36 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 37 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 38 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 39 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 40 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 41 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 42 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 43 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 44 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 45 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 46 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 47 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 48 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 49 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 50 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 51 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 52 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 53 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 54 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 55 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 56 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 57 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 58 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 59 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 60 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 61 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 62 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 63 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 64 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 65 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 66 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 67 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 68 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 69 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 70 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 71 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 72 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 73 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 74 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 75 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 76 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 77 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 78 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 79 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 80 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 81 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 82 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 83 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 84 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 85 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 87 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 88 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 89 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 90 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 91 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 92 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 93 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 94 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 95 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 96 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 97 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 98 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 99 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 102 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 104 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 106 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 121 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 122 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 123 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 126 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 127 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 128 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 130 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 133 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 135 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 136 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 137 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 138 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 139 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 140 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 141 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 142 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 143 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 145 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 146 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 147 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 148 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 149 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 150 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 152 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 153 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 154 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 155 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 156 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 158 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 159 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 170 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 182 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 183 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 189 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 190 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 192 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 251 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 258 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 261 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 262 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 263 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 264 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 265 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 266 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 267 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 268 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 269 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 270 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 271 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 272 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 273 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 274 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 275 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 276 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 277 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 278 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 279 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 280 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 281 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 282 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 283 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 284 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 285 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 286 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 287 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 288 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 289 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 290 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 291 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 292 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 293 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 294 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 295 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 296 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 297 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 298 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 300 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 301 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 302 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 303 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 304 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 305 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 306 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 307 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 308 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 309 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 310 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 311 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 312 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 313 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 314 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 315 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 316 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 317 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 318 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 319 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 320 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 321 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 322 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 351 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 352 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 354 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 355 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 358 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 367 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 368 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 369 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 370 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 371 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 373 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 374 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 375 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 376 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 378 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 379 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 380 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 383 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 386 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 387 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 388 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 389 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 390 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 391 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 392 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 405 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 406 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 407 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 408 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.78 |
| Metatranscriptomes | 2.84 |
| Isolates | 11.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.51 |
| Nodule | 1.65 |
| Rhizoplane | 0.75 |
| Rhizosphere | 66.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002472 | 3300001979 | Bacteria | 8363 |
| 2 | JGI25155J39150_1000022 | 3300002704 | Bacteria | 142950 |
| 3 | JGI25156J39149_1000005 | 3300002705 | Bacteria | 263980 |
| 4 | JGI25154J39366_1000017 | 3300002738 | Bacteria | 252448 |
| 5 | JGI25157J39369_1000003 | 3300002741 | Bacteria | 274935 |
| 6 | JGI25152J39213_1000900 | 3300002773 | Bacteria | 14558 |
| 7 | JGI25150J39212_1003423 | 3300002774 | Bacteria | 3712 |
| 8 | JGI25153J46596_10002128 | 3300003215 | Bacteria | 11587 |
| 9 | JGI25153J46596_10004541 | 3300003215 | Bacteria | 7462 |
| 10 | JGI25160J50197_1000273 | 3300003354 | Bacteria | 38119 |
| 11 | JGI25161J50226_1000095 | 3300003374 | Bacteria | 72343 |
| 12 | Ga0055538_1000038 | 3300003751 | Bacteria | 186588 |
| 13 | Ga0055539_1000049 | 3300003752 | Bacteria | 186588 |
| 14 | Ga0055533_1000060 | 3300003756 | Bacteria | 186588 |
| 15 | Ga0055525_1000068 | 3300003759 | Bacteria | 186588 |
| 16 | Ga0055526_1011045 | 3300003771 | Bacteria | 4122 |
| 17 | Ga0055537_1000205 | 3300003773 | Bacteria | 44266 |
| 18 | Ga0055524_1000013 | 3300003775 | Bacteria | 259850 |
| 19 | Ga0055524_1000073 | 3300003775 | Bacteria | 123033 |
| 20 | Ga0055524_1002736 | 3300003775 | Bacteria | 8906 |
| 21 | Ga0055534_1000363 | 3300003784 | Bacteria | 28579 |
| 22 | Ga0055528_1000289 | 3300003790 | Bacteria | 42964 |
| 23 | Ga0055530_10001804 | 3300003791 | Bacteria | 14848 |
| 24 | Ga0055530_10015037 | 3300003791 | Bacteria | 2548 |
| 25 | Ga0055530_10015857 | 3300003791 | Bacteria | 2436 |
| 26 | Ga0055540_1000001 | 3300003792 | Bacteria | 466834 |
| 27 | Ga0055540_1000037 | 3300003792 | Bacteria | 162957 |
| 28 | Ga0055531_10000257 | 3300003794 | Bacteria | 56547 |
| 29 | Ga0055531_10000261 | 3300003794 | Bacteria | 55661 |
| 30 | Ga0055531_10015203 | 3300003794 | Bacteria | 3410 |
| 31 | Ga0055531_10023264 | 3300003794 | Bacteria | 2331 |
| 32 | Ga0055541_1000036 | 3300003841 | Bacteria | 186588 |
| 33 | Ga0055543_1000218 | 3300004625 | Bacteria | 46120 |
| 34 | Ga0065165_1000080 | 3300005262 | Bacteria | 159638 |
| 35 | Ga0065704_10072859 | 3300005289 | Bacteria | 7918 |
| 36 | Ga0065712_10094921 | 3300005290 | Bacteria | 2235 |
| 37 | Ga0065707_10029034 | 3300005295 | Bacteria | 1592 |
| 38 | Ga0065707_10083392 | 3300005295 | Bacteria | 9339 |
| 39 | Ga0065707_10149697 | 3300005295 | Bacteria | 1673 |
| 40 | Ga0070658_10050285 | 3300005327 | Bacteria | 3378 |
| 41 | Ga0070676_10029646 | 3300005328 | Bacteria | 3114 |
| 42 | Ga0070676_10107330 | 3300005328 | Bacteria | 1733 |
| 43 | Ga0070690_100050185 | 3300005330 | Bacteria | 2661 |
| 44 | Ga0070670_100008472 | 3300005331 | Bacteria | 8769 |
| 45 | Ga0070670_100030450 | 3300005331 | Bacteria | 4647 |
| 46 | Ga0068869_100012628 | 3300005334 | Bacteria | 5586 |
| 47 | Ga0068869_100134325 | 3300005334 | Bacteria | 1905 |
| 48 | Ga0070666_10005194 | 3300005335 | Bacteria | 7975 |
| 49 | Ga0068868_100003181 | 3300005338 | Bacteria | 11428 |
| 50 | Ga0068868_100008545 | 3300005338 | Bacteria | 7332 |
| 51 | Ga0070660_100001068 | 3300005339 | Bacteria | 18415 |
| 52 | Ga0070661_100000809 | 3300005344 | Bacteria | 22476 |
| 53 | Ga0070661_100005897 | 3300005344 | Bacteria | 8430 |
| 54 | Ga0070661_100033267 | 3300005344 | Bacteria | 3734 |
| 55 | Ga0070668_100026664 | 3300005347 | Bacteria | 4386 |
| 56 | Ga0070669_100018739 | 3300005353 | Bacteria | 4947 |
| 57 | Ga0070669_100046001 | 3300005353 | Bacteria | 3182 |
| 58 | Ga0070675_100005641 | 3300005354 | Bacteria | 9582 |
| 59 | Ga0070675_100007798 | 3300005354 | Bacteria | 8291 |
| 60 | Ga0070675_100014444 | 3300005354 | Bacteria | 6226 |
| 61 | Ga0070675_100035528 | 3300005354 | Bacteria | 4050 |
| 62 | Ga0070675_100040468 | 3300005354 | Bacteria | 3805 |
| 63 | Ga0070671_100003392 | 3300005355 | Bacteria | 12430 |
| 64 | Ga0070673_100011026 | 3300005364 | Bacteria | 6156 |
| 65 | Ga0070659_100000649 | 3300005366 | Bacteria | 25413 |
| 66 | Ga0070659_100005068 | 3300005366 | Bacteria | 9444 |
| 67 | Ga0070659_100051985 | 3300005366 | Bacteria | 3222 |
| 68 | Ga0070659_100060202 | 3300005366 | Bacteria | 2999 |
| 69 | Ga0070667_100008422 | 3300005367 | Bacteria | 8553 |
| 70 | Ga0070667_100026749 | 3300005367 | Bacteria | 4800 |
| 71 | Ga0070667_100064801 | 3300005367 | Bacteria | 3101 |
| 72 | Ga0070700_100043345 | 3300005441 | Bacteria | 2767 |
| 73 | Ga0070708_100114460 | 3300005445 | Bacteria | 2482 |
| 74 | Ga0070663_100000477 | 3300005455 | Bacteria | 21034 |
| 75 | Ga0070663_100087827 | 3300005455 | Bacteria | 2298 |
| 76 | Ga0070678_100007358 | 3300005456 | Bacteria | 6525 |
| 77 | Ga0070678_100012914 | 3300005456 | Bacteria | 5214 |
| 78 | Ga0070662_100007162 | 3300005457 | Bacteria | 7224 |
| 79 | Ga0070681_10035645 | 3300005458 | Bacteria | 4997 |
| 80 | Ga0068867_100000081 | 3300005459 | Bacteria | 59361 |
| 81 | Ga0068867_100001379 | 3300005459 | Bacteria | 16789 |
| 82 | Ga0068867_100011430 | 3300005459 | Bacteria | 6264 |
| 83 | Ga0068867_100065911 | 3300005459 | Bacteria | 2696 |
| 84 | Ga0070685_10053663 | 3300005466 | Bacteria | 2336 |
| 85 | Ga0070706_100000463 | 3300005467 | Bacteria | 48079 |
| 86 | Ga0070706_100014985 | 3300005467 | Bacteria | 7159 |
| 87 | Ga0070707_100036188 | 3300005468 | Bacteria | 4710 |
| 88 | Ga0070679_100018152 | 3300005530 | Bacteria | 6822 |
| 89 | Ga0070679_100284990 | 3300005530 | Bacteria | 1604 |
| 90 | Ga0070697_100102024 | 3300005536 | Bacteria | 2384 |
| 91 | Ga0068853_100030634 | 3300005539 | Bacteria | 4546 |
| 92 | Ga0070672_100000327 | 3300005543 | Bacteria | 27160 |
| 93 | Ga0070672_100054812 | 3300005543 | Bacteria | 3122 |
| 94 | Ga0070686_100075387 | 3300005544 | Bacteria | 2219 |
| 95 | Ga0070693_100003345 | 3300005547 | Bacteria | 7454 |
| 96 | Ga0070693_100142925 | 3300005547 | Bacteria | 1508 |
| 97 | Ga0070665_100032591 | 3300005548 | Bacteria | 5244 |
| 98 | Ga0068855_100042416 | 3300005563 | Bacteria | 5391 |
| 99 | Ga0068855_100058788 | 3300005563 | Bacteria | 4500 |
| 100 | Ga0068855_100169978 | 3300005563 | Bacteria | 2469 |
| 101 | Ga0070664_100001243 | 3300005564 | Bacteria | 20374 |
| 102 | Ga0068852_100003754 | 3300005616 | Bacteria | 10652 |
| 103 | Ga0068852_100024397 | 3300005616 | Bacteria | 4886 |
| 104 | Ga0068859_100023273 | 3300005617 | Bacteria | 6217 |
| 105 | Ga0068859_100044728 | 3300005617 | Bacteria | 4448 |
| 106 | Ga0068859_100061816 | 3300005617 | Bacteria | 3774 |
| 107 | Ga0068864_100002065 | 3300005618 | Bacteria | 16597 |
| 108 | Ga0068864_100019420 | 3300005618 | Bacteria | 5682 |
| 109 | Ga0068861_100000694 | 3300005719 | Bacteria | 20156 |
| 110 | Ga0068861_100002250 | 3300005719 | Bacteria | 12540 |
| 111 | Ga0068870_10036066 | 3300005840 | Bacteria | 2542 |
| 112 | Ga0068870_10039650 | 3300005840 | Bacteria | 2438 |
| 113 | Ga0068863_100019244 | 3300005841 | Bacteria | 6532 |
| 114 | Ga0068863_100022738 | 3300005841 | Bacteria | 5989 |
| 115 | Ga0068858_100008614 | 3300005842 | Bacteria | 9799 |
| 116 | Ga0068860_100000823 | 3300005843 | Bacteria | 34706 |
| 117 | Ga0068862_100041306 | 3300005844 | Bacteria | 3923 |
| 118 | Ga0068862_100111189 | 3300005844 | Bacteria | 2405 |
| 119 | Ga0070717_10009296 | 3300006028 | Bacteria | 7386 |
| 120 | Ga0075365_10004820 | 3300006038 | Bacteria | 7197 |
| 121 | Ga0075364_10001078 | 3300006051 | Bacteria | 14541 |
| 122 | Ga0075364_10059950 | 3300006051 | Bacteria | 2495 |
| 123 | Ga0075432_10002101 | 3300006058 | Bacteria | 6636 |
| 124 | Ga0075367_10023144 | 3300006178 | Bacteria | 3492 |
| 125 | Ga0075369_10016987 | 3300006186 | Bacteria | 2944 |
| 126 | Ga0075369_10021842 | 3300006186 | Bacteria | 2635 |
| 127 | Ga0075366_10001536 | 3300006195 | Bacteria | 11547 |
| 128 | Ga0075366_10002629 | 3300006195 | Bacteria | 9242 |
| 129 | Ga0075366_10005340 | 3300006195 | Bacteria | 6964 |
| 130 | Ga0075366_10009338 | 3300006195 | Bacteria | 5474 |
| 131 | Ga0075366_10014023 | 3300006195 | Bacteria | 4572 |
| 132 | Ga0075366_10015652 | 3300006195 | Bacteria | 4352 |
| 133 | Ga0075366_10020818 | 3300006195 | Bacteria | 3808 |
| 134 | Ga0075366_10065892 | 3300006195 | Bacteria | 2154 |
| 135 | Ga0075366_10078163 | 3300006195 | Bacteria | 1975 |
| 136 | Ga0075366_10089416 | 3300006195 | Bacteria | 1844 |
| 137 | Ga0075366_10100929 | 3300006195 | Bacteria | 1732 |
| 138 | Ga0097621_100001917 | 3300006237 | Bacteria | 14212 |
| 139 | Ga0097621_100030577 | 3300006237 | Bacteria | 4264 |
| 140 | Ga0097621_100038182 | 3300006237 | Bacteria | 3853 |
| 141 | Ga0075370_10003930 | 3300006353 | Bacteria | 7134 |
| 142 | Ga0075370_10022105 | 3300006353 | Bacteria | 3489 |
| 143 | Ga0075370_10034699 | 3300006353 | Bacteria | 2828 |
| 144 | Ga0075370_10043922 | 3300006353 | Bacteria | 2526 |
| 145 | Ga0075370_10100824 | 3300006353 | Bacteria | 1671 |
| 146 | Ga0068871_100004794 | 3300006358 | Bacteria | 9457 |
| 147 | Ga0068871_100009237 | 3300006358 | Bacteria | 7131 |
| 148 | Ga0068871_100044841 | 3300006358 | Bacteria | 3557 |
| 149 | Ga0075428_100009793 | 3300006844 | Bacteria | 10650 |
| 150 | Ga0075428_100030466 | 3300006844 | Bacteria | 5966 |
| 151 | Ga0075429_100126991 | 3300006880 | Bacteria | 2230 |
| 152 | Ga0068865_100018189 | 3300006881 | Bacteria | 4532 |
| 153 | Ga0068865_100051619 | 3300006881 | Bacteria | 2847 |
| 154 | Ga0097620_100023272 | 3300006931 | Bacteria | 6217 |
| 155 | Ga0097620_100044728 | 3300006931 | Bacteria | 4448 |
| 156 | Ga0097620_100061816 | 3300006931 | Bacteria | 3774 |
| 157 | Ga0079104_1000055 | 3300006946 | Bacteria | 166522 |
| 158 | Ga0079104_1000070 | 3300006946 | Bacteria | 153879 |
| 159 | Ga0075435_100061728 | 3300007076 | Bacteria | 3041 |
| 160 | Ga0105240_10008945 | 3300009093 | Bacteria | 14239 |
| 161 | Ga0105240_10049342 | 3300009093 | Bacteria | 5313 |
| 162 | Ga0111539_10001740 | 3300009094 | Bacteria | 28934 |
| 163 | Ga0105245_10033383 | 3300009098 | Bacteria | 4561 |
| 164 | Ga0105245_10033877 | 3300009098 | Bacteria | 4526 |
| 165 | Ga0105245_10049512 | 3300009098 | Bacteria | 3763 |
| 166 | Ga0105243_10007445 | 3300009148 | Bacteria | 8414 |
| 167 | Ga0105243_10081100 | 3300009148 | Bacteria | 2648 |
| 168 | Ga0105242_10102667 | 3300009176 | Bacteria | 2425 |
| 169 | Ga0105242_10231415 | 3300009176 | Bacteria | 1656 |
| 170 | Ga0105248_10019961 | 3300009177 | Bacteria | 7419 |
| 171 | Ga0105248_10166687 | 3300009177 | Bacteria | 2483 |
| 172 | Ga0105237_10028275 | 3300009545 | Bacteria | 5713 |
| 173 | Ga0105237_10028578 | 3300009545 | Bacteria | 5678 |
| 174 | Ga0105238_10111489 | 3300009551 | Bacteria | 2716 |
| 175 | Ga0105238_10117685 | 3300009551 | Bacteria | 2637 |
| 176 | Ga0105249_10054347 | 3300009553 | Bacteria | 3662 |
| 177 | Ga0105239_10189383 | 3300010375 | Bacteria | 2303 |
| 178 | Ga0157319_1000003 | 3300012497 | Bacteria | 397199 |
| 179 | Ga0157371_10088006 | 3300013102 | Bacteria | 2199 |
| 180 | Ga0157369_10029192 | 3300013105 | Bacteria | 6097 |
| 181 | Ga0157378_10001703 | 3300013297 | Bacteria | 19776 |
| 182 | Ga0157378_10063456 | 3300013297 | Bacteria | 3301 |
| 183 | Ga0163162_10012566 | 3300013306 | Bacteria | 8270 |
| 184 | Ga0163162_10066510 | 3300013306 | Bacteria | 3653 |
| 185 | Ga0163162_10070976 | 3300013306 | Bacteria | 3535 |
| 186 | Ga0163162_10333169 | 3300013306 | Bacteria | 1650 |
| 187 | Ga0157372_10004423 | 3300013307 | Bacteria | 14987 |
| 188 | Ga0157372_10064423 | 3300013307 | Bacteria | 4112 |
| 189 | Ga0157375_10024841 | 3300013308 | Bacteria | 5553 |
| 190 | Ga0157375_10134369 | 3300013308 | Bacteria | 2596 |
| 191 | Ga0163163_10035273 | 3300014325 | Bacteria | 4852 |
| 192 | Ga0157380_10010044 | 3300014326 | Bacteria | 6794 |
| 193 | Ga0157380_10149440 | 3300014326 | Bacteria | 2017 |
| 194 | Ga0157377_10000048 | 3300014745 | Bacteria | 94061 |
| 195 | Ga0157377_10001539 | 3300014745 | Bacteria | 10025 |
| 196 | Ga0157376_10006686 | 3300014969 | Bacteria | 8161 |
| 197 | Ga0163161_10014566 | 3300017792 | Bacteria | 5473 |
| 198 | Ga0163161_10184612 | 3300017792 | Bacteria | 1601 |
| 199 | Ga0213872_10000007 | 3300021361 | Bacteria | 228206 |
| 200 | Ga0213872_10000313 | 3300021361 | Bacteria | 41306 |
| 201 | Ga0213872_10002128 | 3300021361 | Bacteria | 11902 |
| 202 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 203 | Ga0209784_100021 | 3300025224 | Bacteria | 408534 |
| 204 | Ga0209566_100039 | 3300025225 | Bacteria | 303368 |
| 205 | Ga0209674_100036 | 3300025226 | Bacteria | 408534 |
| 206 | Ga0209563_100040 | 3300025230 | Bacteria | 408534 |
| 207 | Ga0207425_1000691 | 3300025245 | Bacteria | 18293 |
| 208 | Ga0207425_1003670 | 3300025245 | Bacteria | 4832 |
| 209 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 210 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 211 | Ga0209677_100023 | 3300025253 | Bacteria | 408534 |
| 212 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 213 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 214 | Ga0209565_1000128 | 3300025263 | Bacteria | 108959 |
| 215 | Ga0209565_1000574 | 3300025263 | Bacteria | 24961 |
| 216 | Ga0209565_1004707 | 3300025263 | Bacteria | 4099 |
| 217 | Ga0209673_1000008 | 3300025273 | Bacteria | 626013 |
| 218 | Ga0209673_1005215 | 3300025273 | Bacteria | 6625 |
| 219 | Ga0209673_1005777 | 3300025273 | Bacteria | 6155 |
| 220 | Ga0209130_1000072 | 3300025284 | Bacteria | 175726 |
| 221 | Ga0209130_1001611 | 3300025284 | Bacteria | 14009 |
| 222 | Ga0209675_1000099 | 3300025291 | Bacteria | 128911 |
| 223 | Ga0209675_1009287 | 3300025291 | Bacteria | 3489 |
| 224 | Ga0209675_1009484 | 3300025291 | Bacteria | 3434 |
| 225 | Ga0209676_1000023 | 3300025292 | Bacteria | 589732 |
| 226 | Ga0209025_1014674 | 3300025294 | Bacteria | 4795 |
| 227 | Ga0209564_1000139 | 3300025295 | Bacteria | 180328 |
| 228 | Ga0209758_1000281 | 3300025297 | Bacteria | 100826 |
| 229 | Ga0209758_1000310 | 3300025297 | Bacteria | 94307 |
| 230 | Ga0209758_1033741 | 3300025297 | Bacteria | 2049 |
| 231 | Ga0209050_1000022 | 3300025298 | Bacteria | 565239 |
| 232 | Ga0209050_1000730 | 3300025298 | Bacteria | 47896 |
| 233 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 234 | Ga0209256_1000061 | 3300025299 | Bacteria | 260890 |
| 235 | Ga0207426_1000319 | 3300025302 | Bacteria | 92696 |
| 236 | Ga0207426_1013921 | 3300025302 | Bacteria | 2965 |
| 237 | Ga0209051_1000013 | 3300025303 | Bacteria | 565239 |
| 238 | Ga0209051_1000018 | 3300025303 | Bacteria | 527061 |
| 239 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 240 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 241 | Ga0209257_1000042 | 3300025304 | Bacteria | 537149 |
| 242 | Ga0209257_1000047 | 3300025304 | Bacteria | 460507 |
| 243 | Ga0209257_1000461 | 3300025304 | Bacteria | 75360 |
| 244 | Ga0207682_10020532 | 3300025893 | Bacteria | 2593 |
| 245 | Ga0207688_10009652 | 3300025901 | Bacteria | 5254 |
| 246 | Ga0207680_10002711 | 3300025903 | Bacteria | 8272 |
| 247 | Ga0207699_10012699 | 3300025906 | Bacteria | 4288 |
| 248 | Ga0207645_10019522 | 3300025907 | Bacteria | 4443 |
| 249 | Ga0207645_10097305 | 3300025907 | Bacteria | 1897 |
| 250 | Ga0207643_10015716 | 3300025908 | Bacteria | 4123 |
| 251 | Ga0207684_10003939 | 3300025910 | Bacteria | 14206 |
| 252 | Ga0207684_10032412 | 3300025910 | Bacteria | 4443 |
| 253 | Ga0207707_10002239 | 3300025912 | Bacteria | 17488 |
| 254 | Ga0207695_10171046 | 3300025913 | Bacteria | 2098 |
| 255 | Ga0207657_10022456 | 3300025919 | Bacteria | 5901 |
| 256 | Ga0207649_10000774 | 3300025920 | Bacteria | 20745 |
| 257 | Ga0207652_10016076 | 3300025921 | Bacteria | 6103 |
| 258 | Ga0207652_10188737 | 3300025921 | Bacteria | 1853 |
| 259 | Ga0207652_10266755 | 3300025921 | Bacteria | 1544 |
| 260 | Ga0207646_10050732 | 3300025922 | Bacteria | 3713 |
| 261 | Ga0207681_10005856 | 3300025923 | Bacteria | 7535 |
| 262 | Ga0207681_10018545 | 3300025923 | Bacteria | 4385 |
| 263 | Ga0207694_10047253 | 3300025924 | Bacteria | 3329 |
| 264 | Ga0207650_10000149 | 3300025925 | Bacteria | 83837 |
| 265 | Ga0207650_10009624 | 3300025925 | Bacteria | 6609 |
| 266 | Ga0207650_10032150 | 3300025925 | Bacteria | 3795 |
| 267 | Ga0207659_10000394 | 3300025926 | Bacteria | 26304 |
| 268 | Ga0207659_10002170 | 3300025926 | Bacteria | 11657 |
| 269 | Ga0207659_10003684 | 3300025926 | Bacteria | 9239 |
| 270 | Ga0207659_10012392 | 3300025926 | Bacteria | 5423 |
| 271 | Ga0207687_10034232 | 3300025927 | Bacteria | 3449 |
| 272 | Ga0207644_10002319 | 3300025931 | Bacteria | 12312 |
| 273 | Ga0207644_10125541 | 3300025931 | Bacteria | 1958 |
| 274 | Ga0207690_10001407 | 3300025932 | Bacteria | 15134 |
| 275 | Ga0207690_10059207 | 3300025932 | Bacteria | 2594 |
| 276 | Ga0207706_10007947 | 3300025933 | Bacteria | 9793 |
| 277 | Ga0207706_10084841 | 3300025933 | Bacteria | 2785 |
| 278 | Ga0207686_10018138 | 3300025934 | Bacteria | 3979 |
| 279 | Ga0207709_10000111 | 3300025935 | Bacteria | 127580 |
| 280 | Ga0207709_10001074 | 3300025935 | Bacteria | 20124 |
| 281 | Ga0207709_10029590 | 3300025935 | Bacteria | 3178 |
| 282 | Ga0207670_10005748 | 3300025936 | Bacteria | 6843 |
| 283 | Ga0207670_10033210 | 3300025936 | Bacteria | 3324 |
| 284 | Ga0207669_10000874 | 3300025937 | Bacteria | 12794 |
| 285 | Ga0207691_10001736 | 3300025940 | Bacteria | 21490 |
| 286 | Ga0207691_10010760 | 3300025940 | Bacteria | 8782 |
| 287 | Ga0207711_10011339 | 3300025941 | Bacteria | 7404 |
| 288 | Ga0207711_10019236 | 3300025941 | Bacteria | 5686 |
| 289 | Ga0207711_10032072 | 3300025941 | Bacteria | 4440 |
| 290 | Ga0207689_10074760 | 3300025942 | Bacteria | 2784 |
| 291 | Ga0207679_10000325 | 3300025945 | Bacteria | 35612 |
| 292 | Ga0207679_10119382 | 3300025945 | Bacteria | 2096 |
| 293 | Ga0207667_10087589 | 3300025949 | Bacteria | 3221 |
| 294 | Ga0207712_10034996 | 3300025961 | Bacteria | 3407 |
| 295 | Ga0207712_10340970 | 3300025961 | Bacteria | 1243 |
| 296 | Ga0207640_10030610 | 3300025981 | Bacteria | 3317 |
| 297 | Ga0207677_10016673 | 3300026023 | Bacteria | 4358 |
| 298 | Ga0207703_10006064 | 3300026035 | Bacteria | 9665 |
| 299 | Ga0207639_10009019 | 3300026041 | Bacteria | 6869 |
| 300 | Ga0207639_10013695 | 3300026041 | Bacteria | 5685 |
| 301 | Ga0207678_10002065 | 3300026067 | Bacteria | 18220 |
| 302 | Ga0207678_10125670 | 3300026067 | Bacteria | 2188 |
| 303 | Ga0207708_10030164 | 3300026075 | Bacteria | 4112 |
| 304 | Ga0207708_10047600 | 3300026075 | Bacteria | 3264 |
| 305 | Ga0207641_10019502 | 3300026088 | Bacteria | 5567 |
| 306 | Ga0207641_10064069 | 3300026088 | Bacteria | 3141 |
| 307 | Ga0207641_10111650 | 3300026088 | Bacteria | 2424 |
| 308 | Ga0207648_10000179 | 3300026089 | Bacteria | 66602 |
| 309 | Ga0207648_10018438 | 3300026089 | Bacteria | 6319 |
| 310 | Ga0207648_10107784 | 3300026089 | Bacteria | 2445 |
| 311 | Ga0207676_10008819 | 3300026095 | Bacteria | 7179 |
| 312 | Ga0207676_10018678 | 3300026095 | Bacteria | 5045 |
| 313 | Ga0207676_10102551 | 3300026095 | Bacteria | 2375 |
| 314 | Ga0207674_10061556 | 3300026116 | Bacteria | 3793 |
| 315 | Ga0207674_10084059 | 3300026116 | Bacteria | 3181 |
| 316 | Ga0207675_100002243 | 3300026118 | Bacteria | 19223 |
| 317 | Ga0207683_10031145 | 3300026121 | Bacteria | 4628 |
| 318 | Ga0207683_10032225 | 3300026121 | Bacteria | 4553 |
| 319 | Ga0207698_10004036 | 3300026142 | Bacteria | 8910 |
| 320 | Ga0207698_10011836 | 3300026142 | Bacteria | 5679 |
| 321 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 322 | Ga0209281_1000103 | 3300027111 | Bacteria | 221425 |
| 323 | Ga0209981_1002116 | 3300027378 | Bacteria | 2528 |
| 324 | Ga0209981_1002328 | 3300027378 | Bacteria | 2414 |
| 325 | Ga0210000_1007214 | 3300027462 | Bacteria | 1625 |
| 326 | Ga0209970_1000036 | 3300027614 | Bacteria | 17242 |
| 327 | Ga0209971_1001090 | 3300027682 | Bacteria | 6890 |
| 328 | Ga0209813_10021589 | 3300027866 | Bacteria | 1812 |
| 329 | Ga0209974_10007635 | 3300027876 | Bacteria | 3723 |
| 330 | Ga0209974_10014336 | 3300027876 | Bacteria | 2639 |
| 331 | Ga0207428_10010508 | 3300027907 | Bacteria | 8263 |
| 332 | Ga0207428_10094791 | 3300027907 | Bacteria | 2313 |
| 333 | Ga0268265_10089751 | 3300028380 | Bacteria | 2453 |
| 334 | Ga0268264_10000613 | 3300028381 | Bacteria | 42687 |
| 335 | Ga0265334_10000096 | 3300028573 | Bacteria | 62267 |
| 336 | Ga0307515_10000011 | 3300028794 | Bacteria | 633903 |
| 337 | Ga0307515_10000084 | 3300028794 | Bacteria | 221434 |
| 338 | Ga0307515_10000609 | 3300028794 | Bacteria | 83557 |
| 339 | Ga0307515_10000655 | 3300028794 | Bacteria | 79837 |
| 340 | Ga0307515_10001484 | 3300028794 | Bacteria | 52674 |
| 341 | Ga0307515_10003487 | 3300028794 | Bacteria | 33051 |
| 342 | Ga0307515_10003934 | 3300028794 | Bacteria | 31018 |
| 343 | Ga0265338_10000508 | 3300028800 | Bacteria | 68840 |
| 344 | Ga0307512_10028186 | 3300030522 | Bacteria | 4928 |
| 345 | Ga0265330_10000022 | 3300031235 | Bacteria | 154198 |
| 346 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 347 | Ga0265332_10000027 | 3300031238 | Bacteria | 190796 |
| 348 | Ga0265325_10013308 | 3300031241 | Bacteria | 4686 |
| 349 | Ga0265340_10070722 | 3300031247 | Bacteria | 1655 |
| 350 | Ga0265327_10000320 | 3300031251 | Bacteria | 91776 |
| 351 | Ga0265327_10038392 | 3300031251 | Bacteria | 2613 |
| 352 | Ga0265316_10001401 | 3300031344 | Bacteria | 25937 |
| 353 | Ga0307513_10000008 | 3300031456 | Bacteria | 442128 |
| 354 | Ga0307513_10000038 | 3300031456 | Bacteria | 174780 |
| 355 | Ga0307513_10001264 | 3300031456 | Bacteria | 36634 |
| 356 | Ga0307513_10004316 | 3300031456 | Bacteria | 18998 |
| 357 | Ga0307513_10019870 | 3300031456 | Bacteria | 7982 |
| 358 | Ga0307513_10128755 | 3300031456 | Bacteria | 2481 |
| 359 | Ga0307513_10148746 | 3300031456 | Bacteria | 2255 |
| 360 | Ga0307509_10000991 | 3300031507 | Bacteria | 48763 |
| 361 | Ga0307509_10211024 | 3300031507 | Bacteria | 1766 |
| 362 | Ga0307408_100000109 | 3300031548 | Bacteria | 91284 |
| 363 | Ga0307408_100000557 | 3300031548 | Bacteria | 32161 |
| 364 | Ga0307408_100064350 | 3300031548 | Bacteria | 2686 |
| 365 | Ga0307508_10000404 | 3300031616 | Bacteria | 51734 |
| 366 | Ga0307514_10000319 | 3300031649 | Bacteria | 115327 |
| 367 | Ga0307514_10005041 | 3300031649 | Bacteria | 11946 |
| 368 | Ga0307514_10023099 | 3300031649 | Bacteria | 5049 |
| 369 | Ga0265314_10000013 | 3300031711 | Bacteria | 403405 |
| 370 | Ga0265314_10003012 | 3300031711 | Bacteria | 16658 |
| 371 | Ga0265314_10108281 | 3300031711 | Bacteria | 1771 |
| 372 | Ga0265342_10060092 | 3300031712 | Bacteria | 2243 |
| 373 | Ga0307516_10000359 | 3300031730 | Bacteria | 59207 |
| 374 | Ga0307516_10001752 | 3300031730 | Bacteria | 29850 |
| 375 | Ga0307516_10002915 | 3300031730 | Bacteria | 22407 |
| 376 | Ga0307516_10100905 | 3300031730 | Bacteria | 2702 |
| 377 | Ga0307405_10006874 | 3300031731 | Bacteria | 5641 |
| 378 | Ga0307413_10024068 | 3300031824 | Bacteria | 3312 |
| 379 | Ga0307406_10001107 | 3300031901 | Bacteria | 15028 |
| 380 | Ga0307406_10015826 | 3300031901 | Bacteria | 4372 |
| 381 | Ga0307406_10073558 | 3300031901 | Bacteria | 2248 |
| 382 | Ga0307412_10015454 | 3300031911 | Bacteria | 4528 |
| 383 | Ga0307409_100046747 | 3300031995 | Bacteria | 3279 |
| 384 | Ga0307416_100008243 | 3300032002 | Bacteria | 6702 |
| 385 | Ga0307416_100024936 | 3300032002 | Bacteria | 4375 |
| 386 | Ga0307416_100145284 | 3300032002 | Bacteria | 2164 |
| 387 | Ga0307416_100364648 | 3300032002 | Bacteria | 1468 |
| 388 | Ga0307414_10071274 | 3300032004 | Bacteria | 2506 |
| 389 | Ga0307414_10075730 | 3300032004 | Bacteria | 2443 |
| 390 | Ga0307411_10003755 | 3300032005 | Bacteria | 7123 |
| 391 | Ga0307415_100057436 | 3300032126 | Bacteria | 2674 |
| 392 | Ga0307507_10019265 | 3300033179 | Bacteria | 7693 |
| 393 | Ga0307510_10027525 | 3300033180 | Bacteria | 6513 |
| 394 | Ga0307510_10050339 | 3300033180 | Bacteria | 4421 |
| 395 | Ga0373959_0005891 | 3300034820 | Bacteria | 2018 |
| 396 | Ga0373936_0011796 | 3300035113 | Bacteria | 3315 |
| 397 | Ga0373939_0000040 | 3300035114 | Bacteria | 45617 |
| 398 | Ga0373955_0008168 | 3300035172 | Bacteria | 4846 |
| 399 | Ga0373962_0018808 | 3300035242 | Bacteria | 1802 |
| 400 | Ga0373924_0027059 | 3300035410 | Bacteria | 2279 |
| 401 | Ga0373924_0045376 | 3300035410 | Bacteria | 1808 |
| 402 | Ga0373931_0000637 | 3300035691 | Bacteria | 14552 |
| 403 | Ga0373931_0003037 | 3300035691 | Bacteria | 7498 |
| 404 | Ga0373927_0082941 | 3300035695 | Bacteria | 2078 |
| 405 | Ga0373933_0119107 | 3300035724 | Bacteria | 1652 |
| 406 | Ga0373937_0166663 | 3300036401 | Bacteria | 2066 |
| 407 | Ga0395899_0000019 | 3300037312 | Bacteria | 411777 |
| 408 | Ga0395899_0005445 | 3300037312 | Bacteria | 9875 |
| 409 | Ga0395899_0008661 | 3300037312 | Bacteria | 7828 |
| 410 | Ga0395899_0029333 | 3300037312 | Bacteria | 4138 |
| 411 | Ga0395899_0044080 | 3300037312 | Bacteria | 3324 |
| 412 | Ga0395900_0009652 | 3300037418 | Bacteria | 9898 |
| 413 | Ga0395900_0011923 | 3300037418 | Bacteria | 8886 |
| 414 | Ga0395900_0026531 | 3300037418 | Bacteria | 5931 |
| 415 | Ga0395900_0030030 | 3300037418 | Bacteria | 5579 |
| 416 | Ga0395900_0047478 | 3300037418 | Bacteria | 4421 |
| 417 | Ga0395900_0163159 | 3300037418 | Bacteria | 2272 |
| 418 | Ga0395898_0003251 | 3300037466 | Bacteria | 18262 |
| 419 | Ga0395898_0004158 | 3300037466 | Bacteria | 15877 |
| 420 | Ga0395898_0017821 | 3300037466 | Bacteria | 7245 |
| 421 | Ga0395898_0018204 | 3300037466 | Bacteria | 7165 |
| 422 | Ga0395898_0077854 | 3300037466 | Bacteria | 3200 |
| 423 | Ga0395905_0000027 | 3300037471 | Bacteria | 297239 |
| 424 | Ga0395905_0000544 | 3300037471 | Bacteria | 51411 |
| 425 | Ga0395905_0000728 | 3300037471 | Bacteria | 43400 |
| 426 | Ga0395905_0001260 | 3300037471 | Bacteria | 31303 |
| 427 | Ga0395905_0002893 | 3300037471 | Bacteria | 18759 |
| 428 | Ga0395905_0008745 | 3300037471 | Bacteria | 9960 |
| 429 | Ga0395905_0009131 | 3300037471 | Bacteria | 9715 |
| 430 | Ga0395905_0009245 | 3300037471 | Bacteria | 9647 |
| 431 | Ga0395905_0011447 | 3300037471 | Bacteria | 8572 |
| 432 | Ga0395905_0011947 | 3300037471 | Bacteria | 8372 |
| 433 | Ga0395905_0014556 | 3300037471 | Bacteria | 7504 |
| 434 | Ga0395905_0015718 | 3300037471 | Bacteria | 7190 |
| 435 | Ga0395905_0016376 | 3300037471 | Bacteria | 7043 |
| 436 | Ga0395905_0019544 | 3300037471 | Bacteria | 6420 |
| 437 | Ga0395905_0029854 | 3300037471 | Bacteria | 5138 |
| 438 | Ga0395905_0032757 | 3300037471 | Bacteria | 4885 |
| 439 | Ga0395905_0037055 | 3300037471 | Bacteria | 4580 |
| 440 | Ga0395905_0056222 | 3300037471 | Bacteria | 3681 |
| 441 | Ga0395905_0100997 | 3300037471 | Bacteria | 2708 |
| 442 | Ga0395901_0023253 | 3300038443 | Bacteria | 6353 |
| 443 | Ga0395901_0112076 | 3300038443 | Bacteria | 2865 |
| 444 | Ga0395901_0148480 | 3300038443 | Bacteria | 2463 |
| 445 | Ga0395901_0257828 | 3300038443 | Bacteria | 1815 |
| 446 | Ga0400483_261915 | 3300039062 | Bacteria | 8725 |
| 447 | Ga0436361_0034025 | 3300039447 | Bacteria | 3332 |
| 448 | Ga0436361_0094944 | 3300039447 | Bacteria | 20715 |
| 449 | Ga0436361_0163583 | 3300039447 | Bacteria | 173204 |
| 450 | Ga0436361_0260752 | 3300039447 | Bacteria | 7985 |
| 451 | Ga0436361_0704696 | 3300039447 | Bacteria | 13555 |
| 452 | Ga0439449_0001504 | 3300042007 | Bacteria | 9128 |
| 453 | Ga0450888_000167 | 3300042126 | Bacteria | 5667 |
| 454 | Ga0450890_001430 | 3300042127 | Bacteria | 3441 |
| 455 | Ga0450889_000101 | 3300042144 | Bacteria | 8249 |
| 456 | Ga0439446_0024221 | 3300042156 | Bacteria | 1731 |
| 457 | Ga0439459_0000706 | 3300042438 | Bacteria | 4549 |
| 458 | Ga0450918_000127 | 3300042531 | Bacteria | 16320 |
| 459 | Ga0450893_0004553 | 3300042532 | Bacteria | 2208 |
| 460 | Ga0451577_0000276 | 3300042876 | Bacteria | 99531 |
| 461 | Ga0451577_0003533 | 3300042876 | Bacteria | 17291 |
| 462 | Ga0466969_0002206 | 3300044656 | Bacteria | 10412 |
| 463 | Ga0453683_0005431 | 3300044673 | Bacteria | 8894 |
| 464 | Ga0466966_0015692 | 3300044684 | Bacteria | 5008 |
| 465 | Ga0453684_0000891 | 3300044712 | Bacteria | 99637 |
| 466 | Ga0453684_0005216 | 3300044712 | Bacteria | 26063 |
| 467 | Ga0453684_0070122 | 3300044712 | Bacteria | 4440 |
| 468 | Ga0453684_0287000 | 3300044712 | Bacteria | 1875 |
| 469 | Ga0466959_0006104 | 3300045049 | Bacteria | 8320 |
| 470 | Ga0451576_0000060 | 3300045051 | Bacteria | 290345 |
| 471 | Ga0451576_0002533 | 3300045051 | Bacteria | 27062 |
| 472 | Ga0451576_0010377 | 3300045051 | Bacteria | 10695 |
| 473 | Ga0451576_0012835 | 3300045051 | Bacteria | 9398 |
| 474 | Ga0451576_0039620 | 3300045051 | Bacteria | 4987 |
| 475 | Ga0451576_0464535 | 3300045051 | Bacteria | 1329 |
| 476 | Ga0466958_0021627 | 3300045836 | Bacteria | 3762 |
| 477 | Ga0495592_0000083 | 3300046454 | Bacteria | 83092 |
| 478 | Ga0495590_0010768 | 3300046457 | Bacteria | 3427 |
| 479 | Ga0495653_0058295 | 3300046463 | Bacteria | 2936 |
| 480 | Ga0495650_0000084 | 3300046471 | Bacteria | 235690 |
| 481 | Ga0495580_0005567 | 3300046472 | Bacteria | 10387 |
| 482 | Ga0495580_0073408 | 3300046472 | Bacteria | 2389 |
| 483 | Ga0495639_0002158 | 3300046475 | Bacteria | 8677 |
| 484 | Ga0495596_0000706 | 3300046500 | Bacteria | 20710 |
| 485 | Ga0495607_0020881 | 3300046501 | Bacteria | 4129 |
| 486 | Ga0495607_0025099 | 3300046501 | Bacteria | 3711 |
| 487 | Ga0495606_0000400 | 3300046507 | Bacteria | 73341 |
| 488 | Ga0495606_0000589 | 3300046507 | Bacteria | 57638 |
| 489 | Ga0495606_0007197 | 3300046507 | Bacteria | 10037 |
| 490 | Ga0495606_0009174 | 3300046507 | Bacteria | 8412 |
| 491 | Ga0495608_0059363 | 3300046511 | Bacteria | 2520 |
| 492 | Ga0495632_0002315 | 3300046519 | Bacteria | 14654 |
| 493 | Ga0495648_0006247 | 3300046524 | Bacteria | 9747 |
| 494 | Ga0495597_0000971 | 3300046542 | Bacteria | 22161 |
| 495 | Ga0495645_0001792 | 3300046543 | Bacteria | 14572 |
| 496 | Ga0495625_0003060 | 3300046660 | Bacteria | 17136 |
| 497 | Ga0495588_0013692 | 3300046674 | Bacteria | 3867 |
| 498 | Ga0495599_0059345 | 3300046678 | Bacteria | 2393 |
| 499 | Ga0495658_0033748 | 3300046683 | Bacteria | 2805 |
| 500 | Ga0495669_0012095 | 3300046684 | Bacteria | 3668 |
| 501 | Ga0495649_0007696 | 3300046694 | Bacteria | 6543 |
| 502 | Ga0495589_0002650 | 3300046794 | Bacteria | 9906 |
| 503 | Ga0495672_0000088 | 3300047320 | Bacteria | 153860 |
| 504 | Ga0495672_0000498 | 3300047320 | Bacteria | 45426 |
| 505 | Ga0495687_000488 | 3300047443 | Bacteria | 47978 |
| 506 | Ga0495673_0000008 | 3300047469 | Bacteria | 752462 |
| 507 | Ga0495684_0052037 | 3300047471 | Bacteria | 3125 |
| 508 | Ga0495686_0000212 | 3300047472 | Bacteria | 107418 |
| 509 | Ga0495686_0025387 | 3300047472 | Bacteria | 3884 |
| 510 | Ga0495602_0074167 | 3300048088 | Bacteria | 2893 |
| 511 | Ga0496101_0134722 | 3300048904 | Bacteria | 1879 |
| 512 | Ga0496104_0074314 | 3300048907 | Bacteria | 3236 |
| 513 | Ga0496107_0035065 | 3300048910 | Bacteria | 3596 |
| 514 | Ga0496108_0096965 | 3300048911 | Bacteria | 2512 |
| 515 | Ga0496111_0039234 | 3300048914 | Bacteria | 3395 |
| 516 | Ga0496125_0000713 | 3300048928 | Bacteria | 54953 |
| 517 | Ga0496125_0010319 | 3300048928 | Bacteria | 9457 |
| 518 | Ga0496125_0068323 | 3300048928 | Bacteria | 2796 |
| 519 | Ga0501308_000594 | 3300049128 | Bacteria | 2454 |
| 520 | Ga0495678_001079 | 3300049459 | Bacteria | 23033 |
| 521 | Ga0501297_000470 | 3300049520 | Bacteria | 3671 |
| 522 | Ga0501034_0068665 | 3300049571 | Bacteria | 3554 |
| 523 | Ga0501037_0027545 | 3300049573 | Bacteria | 4199 |
| 524 | Ga0501043_0000057 | 3300049579 | Bacteria | 103997 |
| 525 | Ga0501046_0000075 | 3300049580 | Bacteria | 104000 |
| 526 | Ga0501047_0000081 | 3300049581 | Bacteria | 122697 |
| 527 | Ga0501047_0034488 | 3300049581 | Bacteria | 4886 |
| 528 | Ga0501070_0097823 | 3300049586 | Bacteria | 2427 |
| 529 | Ga0501074_0011169 | 3300049590 | Bacteria | 6523 |
| 530 | Ga0501075_0014457 | 3300049591 | Bacteria | 5657 |
| 531 | Ga0501198_000012 | 3300049649 | Bacteria | 113529 |
| 532 | Ga0501211_000114 | 3300049658 | Bacteria | 6126 |
| 533 | Ga0501222_000010 | 3300049662 | Bacteria | 113536 |
| 534 | Ga0501223_008703 | 3300049663 | Bacteria | 2067 |
| 535 | Ga0501235_001548 | 3300049669 | Bacteria | 4933 |
| 536 | Ga0501080_0013210 | 3300049742 | Bacteria | 7586 |
| 537 | Ga0501262_000894 | 3300049759 | Bacteria | 3383 |
| 538 | Ga0501267_000410 | 3300049764 | Bacteria | 3285 |
| 539 | Ga0501272_000099 | 3300049769 | Bacteria | 6631 |
| 540 | Ga0501280_000536 | 3300049776 | Bacteria | 8902 |
| 541 | Ga0501035_0044005 | 3300049822 | Bacteria | 4022 |
| 542 | nmdc:mga0k408_10252_c1 | 3300050493 | Bacteria | 5066 |
| 543 | nmdc:mga0k408_1156_c1 | 3300050493 | Bacteria | 14438 |
| 544 | nmdc:mga0k408_12380_c1 | 3300050493 | Bacteria | 4664 |
| 545 | nmdc:mga0k408_16379_c2 | 3300050493 | Bacteria | 3110 |
| 546 | nmdc:mga0k408_18395_c1 | 3300050493 | Bacteria | 3901 |
| 547 | nmdc:mga0k408_19625_c1 | 3300050493 | Bacteria | 3781 |
| 548 | nmdc:mga0k408_2396_c2 | 3300050493 | Bacteria | 4946 |
| 549 | nmdc:mga0k408_27194_c1 | 3300050493 | Bacteria | 3247 |
| 550 | nmdc:mga0k408_287_c1 | 3300050493 | Bacteria | 27526 |
| 551 | nmdc:mga0k408_50129_c1 | 3300050493 | Bacteria | 2417 |
| 552 | nmdc:mga0k408_5557_c1 | 3300050493 | Bacteria | 6706 |
| 553 | nmdc:mga0k408_738_c2 | 3300050493 | Bacteria | 8845 |
| 554 | nmdc:mga06z11_32547_c1 | 3300050494 | Bacteria | 2544 |
| 555 | nmdc:mga07m45_16271_c1 | 3300050496 | Bacteria | 3981 |
| 556 | nmdc:mga07m45_30126_c3 | 3300050496 | Bacteria | 1611 |
| 557 | nmdc:mga07m45_3016_c1 | 3300050496 | Bacteria | 8023 |
| 558 | nmdc:mga07m45_57420_c1 | 3300050496 | Bacteria | 2201 |
| 559 | nmdc:mga07m45_6146_c1 | 3300050496 | Bacteria | 6055 |
| 560 | nmdc:mga07m45_77532_c1 | 3300050496 | Bacteria | 1896 |
| 561 | nmdc:mga07m45_824_c1 | 3300050496 | Bacteria | 13393 |
| 562 | nmdc:mga07m45_8869_c1 | 3300050496 | Bacteria | 5191 |
| 563 | nmdc:mga0qj67_21804_c1 | 3300050509 | Bacteria | 4914 |
| 564 | nmdc:mga08x19_10335_c1 | 3300050514 | Bacteria | 5603 |
| 565 | nmdc:mga0sz30_7897_c1 | 3300050516 | Bacteria | 4004 |
| 566 | Ga0495595_0016951 | 3300053084 | Bacteria | 3126 |
| 567 | Ga0495619_0036868 | 3300053085 | Bacteria | 3185 |
| 568 | Ga0500578_0000363 | 3300053086 | Bacteria | 55670 |
| 569 | Ga0500641_0010453 | 3300053096 | Bacteria | 3355 |
| 570 | Ga0500559_0000019 | 3300053136 | Bacteria | 134862 |
| 571 | Ga0500622_0003007 | 3300053156 | Bacteria | 11654 |
| 572 | Ga0500645_001028 | 3300053730 | Bacteria | 15622 |
| 573 | Ga0590071_013562 | 3300059421 | Bacteria | 1908 |
| 574 | Ga0590075_009875 | 3300059424 | Bacteria | 2292 |
| 575 | Ga0587084_000637 | 3300059477 | Bacteria | 2906 |
| 576 | Ga0587084_001346 | 3300059477 | Bacteria | 2310 |
| 577 | Ga0587070_000971 | 3300059491 | Bacteria | 2742 |
| 578 | Ga0587077_000607 | 3300059493 | Bacteria | 3233 |
| 579 | Ga0587077_000886 | 3300059493 | Bacteria | 2941 |
| 580 | Ga0587077_004261 | 3300059493 | Bacteria | 1867 |
| 581 | Ga0587080_002604 | 3300059503 | Bacteria | 2145 |
| 582 | Ga0587090_000538 | 3300059510 | Bacteria | 3238 |
| 583 | Ga0587090_001371 | 3300059510 | Bacteria | 2455 |
| 584 | Ga0587067_003517 | 3300059640 | Bacteria | 1966 |
| 585 | Ga0587075_002533 | 3300059644 | Bacteria | 1942 |
| 586 | Ga0587076_001426 | 3300059645 | Bacteria | 2428 |
| 587 | Ga0587078_000411 | 3300059646 | Bacteria | 3153 |
| 588 | Ga0587079_002927 | 3300059647 | Bacteria | 2169 |
| 589 | Ga0587071_001011 | 3300060344 | Bacteria | 3294 |
| 590 | Ga0587111_0001115 | 3300060346 | Bacteria | 3053 |
| 591 | Ga0587111_0001149 | 3300060346 | Bacteria | 3031 |
| 592 | Ga0587111_0001795 | 3300060346 | Bacteria | 2702 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036401 | Ga0373937_0166663 | Ga0373937_0166663_23_1072 | 310 |
| 2 | 3300053096 | Ga0500641_0010453 | Ga0500641_0010453_2093_3316 | 350 |
| 3 | 3300013307 | Ga0157372_10004423 | Ga0157372_1000442310 | 351 |
| 4 | 3300025961 | Ga0207712_10340970 | Ga0207712_103409701 | 362 |
| 5 | 3300009098 | Ga0105245_10049512 | Ga0105245_100495124 | 369 |
| 6 | 3300035724 | Ga0373933_0119107 | Ga0373933_0119107_27_1256 | 369 |
| 7 | 3300005328 | Ga0070676_10029646 | Ga0070676_100296462 | 370 |
| 8 | 3300005354 | Ga0070675_100040468 | Ga0070675_1000404682 | 370 |
| 9 | 3300005364 | Ga0070673_100011026 | Ga0070673_1000110263 | 370 |
| 10 | 3300005456 | Ga0070678_100007358 | Ga0070678_1000073584 | 370 |
| 11 | 3300005840 | Ga0068870_10036066 | Ga0068870_100360662 | 370 |
| 12 | 3300005841 | Ga0068863_100022738 | Ga0068863_1000227383 | 370 |
| 13 | 3300006237 | Ga0097621_100001917 | Ga0097621_1000019175 | 370 |
| 14 | 3300014326 | Ga0157380_10149440 | Ga0157380_101494402 | 370 |
| 15 | 3300032002 | Ga0307416_100364648 | Ga0307416_1003646481 | 373 |
| 16 | 3300006051 | Ga0075364_10059950 | Ga0075364_100599502 | 374 |
| 17 | 3300006186 | Ga0075369_10021842 | Ga0075369_100218423 | 374 |
| 18 | 3300006195 | Ga0075366_10014023 | Ga0075366_100140239 | 374 |
| 19 | 3300050493 | nmdc:mga0k408_50129_c1 | nmdc:mga0k408_50129_c1_318_1631 | 374 |
| 20 | 3300050516 | nmdc:mga0sz30_7897_c1 | nmdc:mga0sz30_7897_c1_2480_3793 | 374 |
| 21 | 3300046472 | Ga0495580_0073408 | Ga0495580_0073408_846_2111 | 375 |
| 22 | 3300039447 | Ga0436361_0260752 | Ga0436361_0260752_3625_4962 | 376 |
| 23 | 3300005354 | Ga0070675_100035528 | Ga0070675_1000355286 | 377 |
| 24 | 3300005441 | Ga0070700_100043345 | Ga0070700_1000433452 | 377 |
| 25 | 3300005459 | Ga0068867_100011430 | Ga0068867_1000114305 | 377 |
| 26 | 3300005466 | Ga0070685_10053663 | Ga0070685_100536632 | 377 |
| 27 | 3300005543 | Ga0070672_100054812 | Ga0070672_1000548124 | 377 |
| 28 | 3300005840 | Ga0068870_10039650 | Ga0068870_100396502 | 377 |
| 29 | 3300006195 | Ga0075366_10020818 | Ga0075366_100208182 | 377 |
| 30 | 3300006881 | Ga0068865_100051619 | Ga0068865_1000516192 | 377 |
| 31 | 3300025908 | Ga0207643_10015716 | Ga0207643_100157164 | 377 |
| 32 | 3300025926 | Ga0207659_10003684 | Ga0207659_1000368414 | 377 |
| 33 | 3300025940 | Ga0207691_10010760 | Ga0207691_100107602 | 377 |
| 34 | 3300026075 | Ga0207708_10030164 | Ga0207708_100301643 | 377 |
| 35 | 3300026075 | Ga0207708_10047600 | Ga0207708_100476002 | 377 |
| 36 | 3300026089 | Ga0207648_10018438 | Ga0207648_100184383 | 377 |
| 37 | 3300026121 | Ga0207683_10032225 | Ga0207683_100322255 | 377 |
| 38 | 3300039447 | Ga0436361_0034025 | Ga0436361_0034025_1903_3240 | 377 |
| 39 | 3300005366 | Ga0070659_100051985 | Ga0070659_1000519852 | 378 |
| 40 | 3300005547 | Ga0070693_100003345 | Ga0070693_1000033458 | 378 |
| 41 | 3300005548 | Ga0070665_100032591 | Ga0070665_1000325914 | 378 |
| 42 | 3300005563 | Ga0068855_100042416 | Ga0068855_10004241610 | 378 |
| 43 | 3300005616 | Ga0068852_100003754 | Ga0068852_10000375410 | 378 |
| 44 | 3300005616 | Ga0068852_100024397 | Ga0068852_1000243976 | 378 |
| 45 | 3300006844 | Ga0075428_100030466 | Ga0075428_1000304669 | 378 |
| 46 | 3300007076 | Ga0075435_100061728 | Ga0075435_1000617282 | 378 |
| 47 | 3300009094 | Ga0111539_10001740 | Ga0111539_100017409 | 378 |
| 48 | 3300009551 | Ga0105238_10117685 | Ga0105238_101176853 | 378 |
| 49 | 3300013105 | Ga0157369_10029192 | Ga0157369_1002919210 | 378 |
| 50 | 3300026142 | Ga0207698_10011836 | Ga0207698_100118367 | 378 |
| 51 | 3300027907 | Ga0207428_10010508 | Ga0207428_100105089 | 378 |
| 52 | 3300050514 | nmdc:mga08x19_10335_c1 | nmdc:mga08x19_10335_c1_1829_3145 | 378 |
| 53 | 3300025906 | Ga0207699_10012699 | Ga0207699_100126994 | 379 |
| 54 | 3300045051 | Ga0451576_0000060 | Ga0451576_0000060_165925_167163 | 382 |
| 55 | 3300046683 | Ga0495658_0033748 | Ga0495658_0033748_313_1581 | 382 |
| 56 | 3300027462 | Ga0210000_1007214 | Ga0210000_10072142 | 383 |
| 57 | 3300005331 | Ga0070670_100030450 | Ga0070670_1000304505 | 384 |
| 58 | 3300009093 | Ga0105240_10049342 | Ga0105240_100493423 | 384 |
| 59 | 3300009545 | Ga0105237_10028275 | Ga0105237_100282753 | 384 |
| 60 | 3300025925 | Ga0207650_10009624 | Ga0207650_100096245 | 384 |
| 61 | 3300026041 | Ga0207639_10013695 | Ga0207639_100136955 | 384 |
| 62 | 3300025912 | Ga0207707_10002239 | Ga0207707_100022392 | 385 |
| 63 | 3300005295 | Ga0065707_10029034 | Ga0065707_100290342 | 386 |
| 64 | 3300005547 | Ga0070693_100142925 | Ga0070693_1001429252 | 386 |
| 65 | 3300025934 | Ga0207686_10018138 | Ga0207686_100181381 | 386 |
| 66 | 3300027378 | Ga0209981_1002328 | Ga0209981_10023283 | 386 |
| 67 | 3300027907 | Ga0207428_10094791 | Ga0207428_100947912 | 386 |
| 68 | 3300032002 | Ga0307416_100145284 | Ga0307416_1001452842 | 386 |
| 69 | 3300035113 | Ga0373936_0011796 | Ga0373936_0011796_1710_2984 | 386 |
| 70 | 3300035410 | Ga0373924_0027059 | Ga0373924_0027059_820_2103 | 386 |
| 71 | 3300035695 | Ga0373927_0082941 | Ga0373927_0082941_274_1557 | 386 |
| 72 | 3300045051 | Ga0451576_0039620 | Ga0451576_0039620_2419_3702 | 386 |
| 73 | 3300046472 | Ga0495580_0005567 | Ga0495580_0005567_3905_5188 | 386 |
| 74 | 3300048910 | Ga0496107_0035065 | Ga0496107_0035065_28_1326 | 386 |
| 75 | iso_pu_bacteria | 2547132103 | 2547373349 | 386 |
| 76 | iso_pu_bacteria | 2843690924 | 2843694860 | 386 |
| 77 | 3300005458 | Ga0070681_10035645 | Ga0070681_100356455 | 388 |
| 78 | 3300005467 | Ga0070706_100014985 | Ga0070706_1000149859 | 388 |
| 79 | 3300005468 | Ga0070707_100036188 | Ga0070707_1000361884 | 388 |
| 80 | 3300005530 | Ga0070679_100284990 | Ga0070679_1002849902 | 388 |
| 81 | 3300005536 | Ga0070697_100102024 | Ga0070697_1001020243 | 388 |
| 82 | 3300025910 | Ga0207684_10032412 | Ga0207684_100324122 | 388 |
| 83 | 3300025921 | Ga0207652_10266755 | Ga0207652_102667551 | 388 |
| 84 | 3300025922 | Ga0207646_10050732 | Ga0207646_100507323 | 388 |
| 85 | 3300044712 | Ga0453684_0287000 | Ga0453684_0287000_316_1605 | 388 |
| 86 | 3300049573 | Ga0501037_0027545 | Ga0501037_0027545_1433_2659 | 389 |
| 87 | 3300049590 | Ga0501074_0011169 | Ga0501074_0011169_1347_2573 | 389 |
| 88 | 3300049742 | Ga0501080_0013210 | Ga0501080_0013210_1951_3177 | 389 |
| 89 | 3300028573 | Ga0265334_10000096 | Ga0265334_100000967 | 390 |
| 90 | 3300049586 | Ga0501070_0097823 | Ga0501070_0097823_1152_2393 | 391 |
| 91 | 3300005327 | Ga0070658_10050285 | Ga0070658_100502853 | 396 |
| 92 | 3300005563 | Ga0068855_100169978 | Ga0068855_1001699782 | 396 |
| 93 | 3300006195 | Ga0075366_10065892 | Ga0075366_100658922 | 396 |
| 94 | 3300006237 | Ga0097621_100038182 | Ga0097621_1000381822 | 396 |
| 95 | 3300006353 | Ga0075370_10100824 | Ga0075370_101008241 | 396 |
| 96 | 3300006358 | Ga0068871_100044841 | Ga0068871_1000448412 | 396 |
| 97 | 3300006881 | Ga0068865_100018189 | Ga0068865_1000181892 | 396 |
| 98 | 3300009098 | Ga0105245_10033877 | Ga0105245_100338777 | 396 |
| 99 | 3300009176 | Ga0105242_10102667 | Ga0105242_101026673 | 396 |
| 100 | 3300009176 | Ga0105242_10231415 | Ga0105242_102314152 | 396 |
| 101 | 3300009177 | Ga0105248_10166687 | Ga0105248_101666872 | 396 |
| 102 | 3300013297 | Ga0157378_10063456 | Ga0157378_100634563 | 396 |
| 103 | 3300013306 | Ga0163162_10070976 | Ga0163162_100709763 | 396 |
| 104 | 3300013308 | Ga0157375_10024841 | Ga0157375_100248418 | 396 |
| 105 | 3300025927 | Ga0207687_10034232 | Ga0207687_100342326 | 396 |
| 106 | 3300025936 | Ga0207670_10005748 | Ga0207670_1000574810 | 396 |
| 107 | 3300025941 | Ga0207711_10011339 | Ga0207711_100113396 | 396 |
| 108 | 3300025949 | Ga0207667_10087589 | Ga0207667_100875893 | 396 |
| 109 | 3300035172 | Ga0373955_0008168 | Ga0373955_0008168_2411_3727 | 396 |
| 110 | 3300035410 | Ga0373924_0045376 | Ga0373924_0045376_309_1625 | 396 |
| 111 | 3300037471 | Ga0395905_0009131 | Ga0395905_0009131_7276_8592 | 396 |
| 112 | 3300038443 | Ga0395901_0112076 | Ga0395901_0112076_699_2015 | 396 |
| 113 | 3300042156 | Ga0439446_0024221 | Ga0439446_0024221_59_1372 | 396 |
| 114 | 3300045836 | Ga0466958_0021627 | Ga0466958_0021627_40_1356 | 396 |
| 115 | 3300046463 | Ga0495653_0058295 | Ga0495653_0058295_1277_2593 | 396 |
| 116 | 3300046511 | Ga0495608_0059363 | Ga0495608_0059363_220_1536 | 396 |
| 117 | 3300046543 | Ga0495645_0001792 | Ga0495645_0001792_2486_3802 | 396 |
| 118 | 3300046678 | Ga0495599_0059345 | Ga0495599_0059345_550_1866 | 396 |
| 119 | 3300047471 | Ga0495684_0052037 | Ga0495684_0052037_894_2210 | 396 |
| 120 | 3300048088 | Ga0495602_0074167 | Ga0495602_0074167_921_2237 | 396 |
| 121 | 3300049776 | Ga0501280_000536 | Ga0501280_000536_6234_7517 | 396 |
| 122 | 3300050493 | nmdc:mga0k408_27194_c1 | nmdc:mga0k408_27194_c1_1094_2407 | 396 |
| 123 | 3300050496 | nmdc:mga07m45_30126_c3 | nmdc:mga07m45_30126_c3_74_1387 | 396 |
| 124 | 3300053084 | Ga0495595_0016951 | Ga0495595_0016951_592_1908 | 396 |
| 125 | 3300053085 | Ga0495619_0036868 | Ga0495619_0036868_1751_3067 | 396 |
| 126 | 3300006844 | Ga0075428_100009793 | Ga0075428_1000097936 | 400 |
| 127 | 3300026088 | Ga0207641_10064069 | Ga0207641_100640693 | 400 |
| 128 | 3300049591 | Ga0501075_0014457 | Ga0501075_0014457_2408_3670 | 400 |
| 129 | 3300027378 | Ga0209981_1002116 | Ga0209981_10021161 | 401 |
| 130 | 3300037418 | Ga0395900_0163159 | Ga0395900_0163159_935_2260 | 401 |
| 131 | 3300045051 | Ga0451576_0464535 | Ga0451576_0464535_14_1315 | 402 |
| 132 | 3300025921 | Ga0207652_10016076 | Ga0207652_100160762 | 403 |
| 133 | 3300025273 | Ga0209673_1005777 | Ga0209673_10057774 | 407 |
| 134 | 3300044656 | Ga0466969_0002206 | Ga0466969_0002206_5507_6946 | 410 |
| 135 | 3300045049 | Ga0466959_0006104 | Ga0466959_0006104_4785_6224 | 410 |
| 136 | 3300005544 | Ga0070686_100075387 | Ga0070686_1000753872 | 411 |
| 137 | 3300006195 | Ga0075366_10078163 | Ga0075366_100781632 | 411 |
| 138 | 3300032004 | Ga0307414_10075730 | Ga0307414_100757301 | 411 |
| 139 | 3300037471 | Ga0395905_0011947 | Ga0395905_0011947_2202_3641 | 411 |
| 140 | 3300044684 | Ga0466966_0015692 | Ga0466966_0015692_2451_3890 | 411 |
| 141 | 3300050493 | nmdc:mga0k408_2396_c2 | nmdc:mga0k408_2396_c2_3273_4661 | 411 |
| 142 | 3300005295 | Ga0065707_10083392 | Ga0065707_100833924 | 412 |
| 143 | 3300047472 | Ga0495686_0000212 | Ga0495686_0000212_81873_83276 | 413 |
| 144 | 3300037471 | Ga0395905_0032757 | Ga0395905_0032757_2736_4124 | 416 |
| 145 | 3300039062 | Ga0400483_261915 | Ga0400483_261915_3755_5149 | 416 |
| 146 | 3300044712 | Ga0453684_0005216 | Ga0453684_0005216_4872_6275 | 417 |
| 147 | 3300005262 | Ga0065165_1000080 | Ga0065165_100008061 | 418 |
| 148 | 3300031730 | Ga0307516_10002915 | Ga0307516_100029159 | 419 |
| 149 | 3300047320 | Ga0495672_0000088 | Ga0495672_0000088_45914_47323 | 419 |
| 150 | 3300047469 | Ga0495673_0000008 | Ga0495673_0000008_97984_99393 | 419 |
| 151 | 3300048904 | Ga0496101_0134722 | Ga0496101_0134722_215_1618 | 419 |
| 152 | 3300048928 | Ga0496125_0000713 | Ga0496125_0000713_26639_28042 | 419 |
| 153 | 3300005334 | Ga0068869_100012628 | Ga0068869_1000126284 | 420 |
| 154 | 3300005338 | Ga0068868_100003181 | Ga0068868_1000031816 | 420 |
| 155 | 3300005353 | Ga0070669_100046001 | Ga0070669_1000460012 | 420 |
| 156 | 3300005354 | Ga0070675_100014444 | Ga0070675_1000144445 | 420 |
| 157 | 3300005366 | Ga0070659_100060202 | Ga0070659_1000602022 | 420 |
| 158 | 3300005367 | Ga0070667_100026749 | Ga0070667_1000267494 | 420 |
| 159 | 3300005457 | Ga0070662_100007162 | Ga0070662_1000071624 | 420 |
| 160 | 3300005539 | Ga0068853_100030634 | Ga0068853_1000306343 | 420 |
| 161 | 3300005719 | Ga0068861_100000694 | Ga0068861_1000006945 | 420 |
| 162 | 3300006028 | Ga0070717_10009296 | Ga0070717_100092966 | 420 |
| 163 | 3300006358 | Ga0068871_100004794 | Ga0068871_1000047943 | 420 |
| 164 | 3300009551 | Ga0105238_10111489 | Ga0105238_101114892 | 420 |
| 165 | 3300013102 | Ga0157371_10088006 | Ga0157371_100880061 | 420 |
| 166 | 3300013306 | Ga0163162_10012566 | Ga0163162_100125666 | 420 |
| 167 | 3300013307 | Ga0157372_10064423 | Ga0157372_100644233 | 420 |
| 168 | 3300014745 | Ga0157377_10001539 | Ga0157377_100015393 | 420 |
| 169 | 3300014969 | Ga0157376_10006686 | Ga0157376_100066866 | 420 |
| 170 | 3300017792 | Ga0163161_10014566 | Ga0163161_100145664 | 420 |
| 171 | 3300025901 | Ga0207688_10009652 | Ga0207688_100096524 | 420 |
| 172 | 3300025907 | Ga0207645_10019522 | Ga0207645_100195223 | 420 |
| 173 | 3300025923 | Ga0207681_10005856 | Ga0207681_100058564 | 420 |
| 174 | 3300025924 | Ga0207694_10047253 | Ga0207694_100472533 | 420 |
| 175 | 3300025926 | Ga0207659_10012392 | Ga0207659_100123924 | 420 |
| 176 | 3300025932 | Ga0207690_10059207 | Ga0207690_100592073 | 420 |
| 177 | 3300025933 | Ga0207706_10007947 | Ga0207706_100079474 | 420 |
| 178 | 3300025945 | Ga0207679_10119382 | Ga0207679_101193822 | 420 |
| 179 | 3300025981 | Ga0207640_10030610 | Ga0207640_100306103 | 420 |
| 180 | 3300026023 | Ga0207677_10016673 | Ga0207677_100166732 | 420 |
| 181 | 3300026041 | Ga0207639_10009019 | Ga0207639_100090193 | 420 |
| 182 | 3300026088 | Ga0207641_10111650 | Ga0207641_101116502 | 420 |
| 183 | 3300026095 | Ga0207676_10102551 | Ga0207676_101025512 | 420 |
| 184 | 3300026116 | Ga0207674_10061556 | Ga0207674_100615562 | 420 |
| 185 | 3300026142 | Ga0207698_10004036 | Ga0207698_100040366 | 420 |
| 186 | 3300032002 | Ga0307416_100008243 | Ga0307416_1000082432 | 420 |
| 187 | 3300035242 | Ga0373962_0018808 | Ga0373962_0018808_130_1530 | 420 |
| 188 | 3300035691 | Ga0373931_0003037 | Ga0373931_0003037_5053_6453 | 420 |
| 189 | 3300037312 | Ga0395899_0029333 | Ga0395899_0029333_620_2023 | 420 |
| 190 | 3300046457 | Ga0495590_0010768 | Ga0495590_0010768_604_2013 | 420 |
| 191 | 3300046471 | Ga0495650_0000084 | Ga0495650_0000084_144055_145464 | 420 |
| 192 | 3300046500 | Ga0495596_0000706 | Ga0495596_0000706_3305_4714 | 420 |
| 193 | 3300046501 | Ga0495607_0020881 | Ga0495607_0020881_2485_3894 | 420 |
| 194 | 3300046507 | Ga0495606_0000400 | Ga0495606_0000400_67082_68491 | 420 |
| 195 | 3300046524 | Ga0495648_0006247 | Ga0495648_0006247_1151_2560 | 420 |
| 196 | 3300046542 | Ga0495597_0000971 | Ga0495597_0000971_772_2181 | 420 |
| 197 | 3300046794 | Ga0495589_0002650 | Ga0495589_0002650_1334_2743 | 420 |
| 198 | 3300047320 | Ga0495672_0000498 | Ga0495672_0000498_29049_30458 | 420 |
| 199 | 3300047443 | Ga0495687_000488 | Ga0495687_000488_26648_28057 | 420 |
| 200 | 3300047472 | Ga0495686_0025387 | Ga0495686_0025387_2060_3469 | 420 |
| 201 | 3300048911 | Ga0496108_0096965 | Ga0496108_0096965_1026_2426 | 420 |
| 202 | 3300048914 | Ga0496111_0039234 | Ga0496111_0039234_1035_2444 | 420 |
| 203 | 3300049459 | Ga0495678_001079 | Ga0495678_001079_20198_21607 | 420 |
| 204 | 3300005844 | Ga0068862_100041306 | Ga0068862_1000413062 | 421 |
| 205 | 3300017792 | Ga0163161_10184612 | Ga0163161_101846122 | 421 |
| 206 | 3300046694 | Ga0495649_0007696 | Ga0495649_0007696_1331_2731 | 421 |
| 207 | 3300037312 | Ga0395899_0000019 | Ga0395899_0000019_155921_157336 | 422 |
| 208 | 3300037466 | Ga0395898_0077854 | Ga0395898_0077854_1470_2885 | 422 |
| 209 | 3300037471 | Ga0395905_0011447 | Ga0395905_0011447_5779_7164 | 422 |
| 210 | 3300037471 | Ga0395905_0056222 | Ga0395905_0056222_72_1487 | 422 |
| 211 | 3300038443 | Ga0395901_0257828 | Ga0395901_0257828_12_1427 | 422 |
| 212 | 3300046501 | Ga0495607_0025099 | Ga0495607_0025099_1908_3317 | 422 |
| 213 | 3300046507 | Ga0495606_0000589 | Ga0495606_0000589_45619_47031 | 422 |
| 214 | 3300046674 | Ga0495588_0013692 | Ga0495588_0013692_1433_2848 | 422 |
| 215 | 3300046684 | Ga0495669_0012095 | Ga0495669_0012095_1330_2745 | 422 |
| 216 | 3300050493 | nmdc:mga0k408_5557_c1 | nmdc:mga0k408_5557_c1_1526_2926 | 423 |
| 217 | 3300059503 | Ga0587080_002604 | Ga0587080_002604_138_1541 | 423 |
| 218 | 3300059640 | Ga0587067_003517 | Ga0587067_003517_428_1831 | 423 |
| 219 | 3300059644 | Ga0587075_002533 | Ga0587075_002533_383_1786 | 423 |
| 220 | 3300003794 | Ga0055531_10000261 | Ga0055531_100002611 | 424 |
| 221 | 3300005339 | Ga0070660_100001068 | Ga0070660_10000106815 | 424 |
| 222 | 3300005344 | Ga0070661_100005897 | Ga0070661_1000058974 | 424 |
| 223 | 3300005366 | Ga0070659_100005068 | Ga0070659_1000050689 | 424 |
| 224 | 3300025919 | Ga0207657_10022456 | Ga0207657_100224564 | 424 |
| 225 | 3300025932 | Ga0207690_10001407 | Ga0207690_1000140716 | 424 |
| 226 | 3300025933 | Ga0207706_10084841 | Ga0207706_100848413 | 424 |
| 227 | 3300037312 | Ga0395899_0044080 | Ga0395899_0044080_710_2113 | 424 |
| 228 | 3300037418 | Ga0395900_0009652 | Ga0395900_0009652_8108_9511 | 424 |
| 229 | 3300037466 | Ga0395898_0003251 | Ga0395898_0003251_523_1926 | 424 |
| 230 | 3300046475 | Ga0495639_0002158 | Ga0495639_0002158_4999_6432 | 424 |
| 231 | 3300059647 | Ga0587079_002927 | Ga0587079_002927_138_1541 | 424 |
| 232 | iso_pu_bacteria | 2513237166 | 2514050823 | 424 |
| 233 | iso_pu_bacteria | 2818991450 | 2819624242 | 424 |
| 234 | iso_pu_bacteria | 2900634093 | 2900637151 | 424 |
| 235 | iso_pu_bacteria | 2904564687 | 2904569415 | 424 |
| 236 | iso_pu_bacteria | 2904571731 | 2904576748 | 424 |
| 237 | iso_pu_bacteria | 2928108538 | 2928114132 | 424 |
| 238 | iso_pu_bacteria | 2928135762 | 2928141120 | 424 |
| 239 | iso_pu_bacteria | 2928503688 | 2928509127 | 424 |
| 240 | iso_pu_bacteria | 2928536128 | 2928542092 | 424 |
| 241 | iso_pu_bacteria | 642555113 | 642623123 | 424 |
| 242 | iso_pu_bacteria | 8055225921 | 8055228439 | 424 |
| 243 | iso_pu_bacteria | 8055266321 | 8055269505 | 424 |
| 244 | 3300006195 | Ga0075366_10009338 | Ga0075366_100093383 | 425 |
| 245 | 3300050493 | nmdc:mga0k408_19625_c1 | nmdc:mga0k408_19625_c1_519_1922 | 425 |
| 246 | iso_pu_bacteria | 2515154189 | 2516023316 | 425 |
| 247 | 3300006038 | Ga0075365_10004820 | Ga0075365_100048206 | 426 |
| 248 | 3300031548 | Ga0307408_100000109 | Ga0307408_10000010939 | 426 |
| 249 | 3300037466 | Ga0395898_0017821 | Ga0395898_0017821_5453_6883 | 426 |
| 250 | 3300038443 | Ga0395901_0023253 | Ga0395901_0023253_1092_2522 | 426 |
| 251 | 3300042126 | Ga0450888_000167 | Ga0450888_000167_3930_5336 | 426 |
| 252 | 3300042127 | Ga0450890_001430 | Ga0450890_001430_1507_2913 | 426 |
| 253 | 3300042144 | Ga0450889_000101 | Ga0450889_000101_2011_3417 | 426 |
| 254 | 3300042532 | Ga0450893_0004553 | Ga0450893_0004553_471_1877 | 426 |
| 255 | 3300050493 | nmdc:mga0k408_16379_c2 | nmdc:mga0k408_16379_c2_25_1425 | 426 |
| 256 | iso_pu_bacteria | 2515154123 | 2515690866 | 426 |
| 257 | iso_pu_bacteria | 2515154189 | 2516022302 | 426 |
| 258 | iso_pu_bacteria | 2857542790 | 2857543380 | 426 |
| 259 | iso_pu_bacteria | 2883087390 | 2883091365 | 426 |
| 260 | 3300005367 | Ga0070667_100008422 | Ga0070667_1000084222 | 428 |
| 261 | 3300006195 | Ga0075366_10089416 | Ga0075366_100894161 | 428 |
| 262 | 3300028800 | Ga0265338_10000508 | Ga0265338_1000050813 | 428 |
| 263 | 3300031251 | Ga0265327_10038392 | Ga0265327_100383922 | 428 |
| 264 | 3300031456 | Ga0307513_10001264 | Ga0307513_1000126421 | 428 |
| 265 | 3300033180 | Ga0307510_10050339 | Ga0307510_100503392 | 428 |
| 266 | 3300046660 | Ga0495625_0003060 | Ga0495625_0003060_281_1660 | 428 |
| 267 | 3300005344 | Ga0070661_100033267 | Ga0070661_1000332672 | 429 |
| 268 | 3300027614 | Ga0209970_1000036 | Ga0209970_100003619 | 429 |
| 269 | 3300027876 | Ga0209974_10014336 | Ga0209974_100143362 | 429 |
| 270 | 3300031238 | Ga0265332_10000027 | Ga0265332_10000027168 | 429 |
| 271 | 3300031995 | Ga0307409_100046747 | Ga0307409_1000467472 | 429 |
| 272 | 3300042876 | Ga0451577_0003533 | Ga0451577_0003533_5770_7170 | 429 |
| 273 | 3300044673 | Ga0453683_0005431 | Ga0453683_0005431_1807_3207 | 429 |
| 274 | 3300044712 | Ga0453684_0070122 | Ga0453684_0070122_1677_3077 | 429 |
| 275 | 3300045051 | Ga0451576_0010377 | Ga0451576_0010377_312_1712 | 429 |
| 276 | 3300049520 | Ga0501297_000470 | Ga0501297_000470_1060_2466 | 429 |
| 277 | 3300049658 | Ga0501211_000114 | Ga0501211_000114_3776_5182 | 429 |
| 278 | 3300049663 | Ga0501223_008703 | Ga0501223_008703_219_1625 | 429 |
| 279 | 3300049669 | Ga0501235_001548 | Ga0501235_001548_2449_3855 | 429 |
| 280 | 3300049759 | Ga0501262_000894 | Ga0501262_000894_1471_2877 | 429 |
| 281 | 3300049764 | Ga0501267_000410 | Ga0501267_000410_1372_2778 | 429 |
| 282 | 3300049769 | Ga0501272_000099 | Ga0501272_000099_1156_2562 | 429 |
| 283 | iso_pu_bacteria | 2734482258 | 2735817906 | 429 |
| 284 | 3300003775 | Ga0055524_1000013 | Ga0055524_1000013250 | 430 |
| 285 | 3300003791 | Ga0055530_10001804 | Ga0055530_1000180413 | 430 |
| 286 | 3300003791 | Ga0055530_10015037 | Ga0055530_100150371 | 430 |
| 287 | 3300003792 | Ga0055540_1000001 | Ga0055540_100000111 | 430 |
| 288 | 3300003792 | Ga0055540_1000037 | Ga0055540_100003772 | 430 |
| 289 | 3300003794 | Ga0055531_10023264 | Ga0055531_100232641 | 430 |
| 290 | 3300005295 | Ga0065707_10149697 | Ga0065707_101496972 | 430 |
| 291 | 3300005445 | Ga0070708_100114460 | Ga0070708_1001144603 | 430 |
| 292 | 3300005467 | Ga0070706_100000463 | Ga0070706_10000046321 | 430 |
| 293 | 3300006178 | Ga0075367_10023144 | Ga0075367_100231444 | 430 |
| 294 | 3300006195 | Ga0075366_10001536 | Ga0075366_100015363 | 430 |
| 295 | 3300006353 | Ga0075370_10022105 | Ga0075370_100221053 | 430 |
| 296 | 3300025263 | Ga0209565_1004707 | Ga0209565_10047074 | 430 |
| 297 | 3300025284 | Ga0209130_1001611 | Ga0209130_100161114 | 430 |
| 298 | 3300025291 | Ga0209675_1009287 | Ga0209675_10092873 | 430 |
| 299 | 3300025292 | Ga0209676_1000023 | Ga0209676_1000023341 | 430 |
| 300 | 3300025298 | Ga0209050_1000022 | Ga0209050_1000022323 | 430 |
| 301 | 3300025298 | Ga0209050_1000730 | Ga0209050_100073054 | 430 |
| 302 | 3300025299 | Ga0209256_1000061 | Ga0209256_1000061252 | 430 |
| 303 | 3300025302 | Ga0207426_1013921 | Ga0207426_10139212 | 430 |
| 304 | 3300025303 | Ga0209051_1000013 | Ga0209051_1000013323 | 430 |
| 305 | 3300025303 | Ga0209051_1000018 | Ga0209051_1000018439 | 430 |
| 306 | 3300025304 | Ga0209257_1000042 | Ga0209257_1000042164 | 430 |
| 307 | 3300025304 | Ga0209257_1000461 | Ga0209257_100046112 | 430 |
| 308 | 3300025910 | Ga0207684_10003939 | Ga0207684_1000393911 | 430 |
| 309 | 3300031507 | Ga0307509_10211024 | Ga0307509_102110242 | 430 |
| 310 | 3300031901 | Ga0307406_10015826 | Ga0307406_100158264 | 430 |
| 311 | 3300031901 | Ga0307406_10073558 | Ga0307406_100735582 | 430 |
| 312 | 3300037418 | Ga0395900_0011923 | Ga0395900_0011923_2132_3562 | 430 |
| 313 | 3300037471 | Ga0395905_0014556 | Ga0395905_0014556_1283_2713 | 430 |
| 314 | 3300045051 | Ga0451576_0012835 | Ga0451576_0012835_2679_4085 | 430 |
| 315 | 3300046519 | Ga0495632_0002315 | Ga0495632_0002315_11804_13204 | 430 |
| 316 | 3300050493 | nmdc:mga0k408_1156_c1 | nmdc:mga0k408_1156_c1_11730_13133 | 430 |
| 317 | iso_pu_bacteria | 2501025502 | 2501084045 | 430 |
| 318 | iso_pu_bacteria | 2510917013 | 2511093400 | 430 |
| 319 | iso_pu_bacteria | 2513237082 | 2513556073 | 430 |
| 320 | iso_pu_bacteria | 2513237083 | 2513564259 | 430 |
| 321 | iso_pu_bacteria | 2643221603 | 2644027032 | 430 |
| 322 | iso_pu_bacteria | 8003955200 | 8003956751 | 430 |
| 323 | 3300002704 | JGI25155J39150_1000022 | JGI25155J39150_1000022110 | 431 |
| 324 | 3300002705 | JGI25156J39149_1000005 | JGI25156J39149_1000005102 | 431 |
| 325 | 3300002738 | JGI25154J39366_1000017 | JGI25154J39366_100001794 | 431 |
| 326 | 3300002741 | JGI25157J39369_1000003 | JGI25157J39369_1000003110 | 431 |
| 327 | 3300003354 | JGI25160J50197_1000273 | JGI25160J50197_100027339 | 431 |
| 328 | 3300003374 | JGI25161J50226_1000095 | JGI25161J50226_100009549 | 431 |
| 329 | 3300004625 | Ga0055543_1000218 | Ga0055543_100021847 | 431 |
| 330 | 3300006058 | Ga0075432_10002101 | Ga0075432_100021016 | 431 |
| 331 | 3300006195 | Ga0075366_10005340 | Ga0075366_100053405 | 431 |
| 332 | 3300006195 | Ga0075366_10100929 | Ga0075366_101009292 | 431 |
| 333 | 3300006880 | Ga0075429_100126991 | Ga0075429_1001269912 | 431 |
| 334 | 3300006946 | Ga0079104_1000070 | Ga0079104_100007046 | 431 |
| 335 | 3300009177 | Ga0105248_10019961 | Ga0105248_100199615 | 431 |
| 336 | 3300025206 | Ga0209435_100002 | Ga0209435_100002218 | 431 |
| 337 | 3300025245 | Ga0207425_1003670 | Ga0207425_10036701 | 431 |
| 338 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000012361 | 431 |
| 339 | 3300025250 | Ga0209026_1000001 | Ga0209026_10000011018 | 431 |
| 340 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011992 | 431 |
| 341 | 3300025263 | Ga0209565_1000574 | Ga0209565_10005742 | 431 |
| 342 | 3300025284 | Ga0209130_1000072 | Ga0209130_100007253 | 431 |
| 343 | 3300025291 | Ga0209675_1009484 | Ga0209675_10094843 | 431 |
| 344 | 3300025294 | Ga0209025_1014674 | Ga0209025_10146742 | 431 |
| 345 | 3300025297 | Ga0209758_1033741 | Ga0209758_10337412 | 431 |
| 346 | 3300025302 | Ga0207426_1000319 | Ga0207426_100031947 | 431 |
| 347 | 3300025941 | Ga0207711_10032072 | Ga0207711_100320724 | 431 |
| 348 | 3300027111 | Ga0209281_1000103 | Ga0209281_100010346 | 431 |
| 349 | 3300028794 | Ga0307515_10000084 | Ga0307515_10000084154 | 431 |
| 350 | 3300030522 | Ga0307512_10028186 | Ga0307512_100281862 | 431 |
| 351 | 3300031456 | Ga0307513_10148746 | Ga0307513_101487462 | 431 |
| 352 | 3300031649 | Ga0307514_10000319 | Ga0307514_100003198 | 431 |
| 353 | 3300050493 | nmdc:mga0k408_738_c2 | nmdc:mga0k408_738_c2_3421_4830 | 431 |
| 354 | 3300053730 | Ga0500645_001028 | Ga0500645_001028_13404_14813 | 431 |
| 355 | iso_pu_bacteria | 2511231026 | 2511385596 | 431 |
| 356 | iso_pu_bacteria | 2521172590 | 2521560050 | 431 |
| 357 | iso_pu_bacteria | 2551306416 | 2553008080 | 431 |
| 358 | iso_pu_bacteria | 2818991449 | 2819616413 | 431 |
| 359 | iso_pu_bacteria | 2904439833 | 2904440916 | 431 |
| 360 | iso_pu_bacteria | 2904530477 | 2904535518 | 431 |
| 361 | iso_pu_bacteria | 2904584206 | 2904588341 | 431 |
| 362 | iso_pu_bacteria | 2904589729 | 2904594771 | 431 |
| 363 | iso_pu_bacteria | 2904601388 | 2904606034 | 431 |
| 364 | iso_pu_bacteria | 2919046199 | 2919049083 | 431 |
| 365 | iso_pu_bacteria | 2919079590 | 2919084692 | 431 |
| 366 | iso_pu_bacteria | 2919704043 | 2919707110 | 431 |
| 367 | iso_pu_bacteria | 2923510766 | 2923513781 | 431 |
| 368 | iso_pu_bacteria | 2939631187 | 2939635073 | 431 |
| 369 | 3300014326 | Ga0157380_10010044 | Ga0157380_100100445 | 432 |
| 370 | 3300031235 | Ga0265330_10000022 | Ga0265330_1000002233 | 432 |
| 371 | 3300031238 | Ga0265332_10000001 | Ga0265332_10000001542 | 432 |
| 372 | 3300031241 | Ga0265325_10013308 | Ga0265325_100133084 | 432 |
| 373 | 3300031247 | Ga0265340_10070722 | Ga0265340_100707222 | 432 |
| 374 | 3300031548 | Ga0307408_100000557 | Ga0307408_10000055721 | 432 |
| 375 | 3300031711 | Ga0265314_10000013 | Ga0265314_10000013275 | 432 |
| 376 | 3300031901 | Ga0307406_10001107 | Ga0307406_1000110717 | 432 |
| 377 | 3300037471 | Ga0395905_0001260 | Ga0395905_0001260_3292_4695 | 432 |
| 378 | 3300050493 | nmdc:mga0k408_18395_c1 | nmdc:mga0k408_18395_c1_1451_2854 | 432 |
| 379 | iso_pu_bacteria | 2511231002 | 2511244642 | 432 |
| 380 | iso_pu_bacteria | 2585428062 | 2587754201 | 432 |
| 381 | iso_pu_bacteria | 2643221544 | 2643743758 | 432 |
| 382 | iso_pu_bacteria | 2643221585 | 2643936490 | 432 |
| 383 | iso_pu_bacteria | 2643221639 | 2644222326 | 432 |
| 384 | iso_pu_bacteria | 2643221644 | 2644247030 | 432 |
| 385 | iso_pu_bacteria | 2643221646 | 2644256339 | 432 |
| 386 | iso_pu_bacteria | 2643221654 | 2644301379 | 432 |
| 387 | iso_pu_bacteria | 2643221656 | 2644317846 | 432 |
| 388 | iso_pu_bacteria | 2643221660 | 2644341092 | 432 |
| 389 | iso_pu_bacteria | 2738541337 | 2739058421 | 432 |
| 390 | iso_pu_bacteria | 2881101125 | 2881103422 | 432 |
| 391 | 3300002773 | JGI25152J39213_1000900 | JGI25152J39213_10009002 | 433 |
| 392 | 3300002774 | JGI25150J39212_1003423 | JGI25150J39212_10034234 | 433 |
| 393 | 3300003215 | JGI25153J46596_10004541 | JGI25153J46596_100045415 | 433 |
| 394 | 3300003751 | Ga0055538_1000038 | Ga0055538_1000038134 | 433 |
| 395 | 3300003752 | Ga0055539_1000049 | Ga0055539_1000049134 | 433 |
| 396 | 3300003756 | Ga0055533_1000060 | Ga0055533_1000060134 | 433 |
| 397 | 3300003759 | Ga0055525_1000068 | Ga0055525_100006861 | 433 |
| 398 | 3300003771 | Ga0055526_1011045 | Ga0055526_10110454 | 433 |
| 399 | 3300003773 | Ga0055537_1000205 | Ga0055537_100020514 | 433 |
| 400 | 3300003775 | Ga0055524_1000073 | Ga0055524_100007360 | 433 |
| 401 | 3300003784 | Ga0055534_1000363 | Ga0055534_10003637 | 433 |
| 402 | 3300003790 | Ga0055528_1000289 | Ga0055528_100028935 | 433 |
| 403 | 3300003841 | Ga0055541_1000036 | Ga0055541_100003661 | 433 |
| 404 | 3300010375 | Ga0105239_10189383 | Ga0105239_101893832 | 433 |
| 405 | 3300021361 | Ga0213872_10002128 | Ga0213872_100021286 | 433 |
| 406 | 3300025224 | Ga0209784_100021 | Ga0209784_100021234 | 433 |
| 407 | 3300025225 | Ga0209566_100039 | Ga0209566_100039235 | 433 |
| 408 | 3300025226 | Ga0209674_100036 | Ga0209674_100036234 | 433 |
| 409 | 3300025230 | Ga0209563_100040 | Ga0209563_100040234 | 433 |
| 410 | 3300025245 | Ga0207425_1000691 | Ga0207425_10006915 | 433 |
| 411 | 3300025253 | Ga0209677_100023 | Ga0209677_100023234 | 433 |
| 412 | 3300025258 | Ga0209129_1000027 | Ga0209129_1000027126 | 433 |
| 413 | 3300025263 | Ga0209565_1000128 | Ga0209565_100012870 | 433 |
| 414 | 3300025273 | Ga0209673_1000008 | Ga0209673_100000893 | 433 |
| 415 | 3300025291 | Ga0209675_1000099 | Ga0209675_10000993 | 433 |
| 416 | 3300025295 | Ga0209564_1000139 | Ga0209564_1000139117 | 433 |
| 417 | 3300025297 | Ga0209758_1000310 | Ga0209758_100031088 | 433 |
| 418 | 3300025299 | Ga0209256_1000001 | Ga0209256_10000011809 | 433 |
| 419 | 3300025942 | Ga0207689_10074760 | Ga0207689_100747603 | 433 |
| 420 | 3300031456 | Ga0307513_10000008 | Ga0307513_100000089 | 433 |
| 421 | 3300031711 | Ga0265314_10003012 | Ga0265314_100030122 | 433 |
| 422 | 3300037418 | Ga0395900_0030030 | Ga0395900_0030030_2387_3790 | 433 |
| 423 | 3300037471 | Ga0395905_0002893 | Ga0395905_0002893_263_1666 | 433 |
| 424 | 3300037471 | Ga0395905_0008745 | Ga0395905_0008745_6460_7863 | 433 |
| 425 | 3300039447 | Ga0436361_0704696 | Ga0436361_0704696_2011_3417 | 433 |
| 426 | 3300042531 | Ga0450918_000127 | Ga0450918_000127_7543_8943 | 433 |
| 427 | 3300046507 | Ga0495606_0007197 | Ga0495606_0007197_6674_8080 | 433 |
| 428 | 3300050496 | nmdc:mga07m45_824_c1 | nmdc:mga07m45_824_c1_766_2172 | 433 |
| 429 | 3300059477 | Ga0587084_000637 | Ga0587084_000637_717_2120 | 433 |
| 430 | 3300059477 | Ga0587084_001346 | Ga0587084_001346_646_2049 | 433 |
| 431 | 3300059491 | Ga0587070_000971 | Ga0587070_000971_700_2103 | 433 |
| 432 | 3300059493 | Ga0587077_000607 | Ga0587077_000607_620_2023 | 433 |
| 433 | 3300059493 | Ga0587077_000886 | Ga0587077_000886_1232_2635 | 433 |
| 434 | 3300059493 | Ga0587077_004261 | Ga0587077_004261_272_1675 | 433 |
| 435 | 3300059510 | Ga0587090_000538 | Ga0587090_000538_1133_2536 | 433 |
| 436 | 3300059510 | Ga0587090_001371 | Ga0587090_001371_646_2049 | 433 |
| 437 | 3300059645 | Ga0587076_001426 | Ga0587076_001426_679_2082 | 433 |
| 438 | 3300059646 | Ga0587078_000411 | Ga0587078_000411_556_1959 | 433 |
| 439 | 3300060344 | Ga0587071_001011 | Ga0587071_001011_646_2049 | 433 |
| 440 | 3300060346 | Ga0587111_0001115 | Ga0587111_0001115_1005_2408 | 433 |
| 441 | 3300060346 | Ga0587111_0001149 | Ga0587111_0001149_1273_2676 | 433 |
| 442 | 3300060346 | Ga0587111_0001795 | Ga0587111_0001795_639_2042 | 433 |
| 443 | iso_pu_bacteria | 2547132374 | 2548499054 | 433 |
| 444 | iso_pu_bacteria | 2643221570 | 2643867741 | 433 |
| 445 | iso_pu_bacteria | 2643221596 | 2643991604 | 433 |
| 446 | iso_pu_bacteria | 2643221609 | 2644062225 | 433 |
| 447 | iso_pu_bacteria | 2643221611 | 2644071413 | 433 |
| 448 | iso_pu_bacteria | 2643221652 | 2644293350 | 433 |
| 449 | iso_pu_bacteria | 2643221717 | 2644648511 | 433 |
| 450 | iso_pu_bacteria | 2721755523 | 2722881960 | 433 |
| 451 | iso_pu_bacteria | 2738541357 | 2739150397 | 433 |
| 452 | iso_pu_bacteria | 2738543003 | 2739192316 | 433 |
| 453 | iso_pu_bacteria | 2738543012 | 2739245836 | 433 |
| 454 | iso_pu_bacteria | 2738543026 | 2739318793 | 433 |
| 455 | iso_pu_bacteria | 2738543029 | 2739337034 | 433 |
| 456 | iso_pu_bacteria | 2816332133 | 2816470530 | 433 |
| 457 | iso_pu_bacteria | 2839138175 | 2839141853 | 433 |
| 458 | iso_pu_bacteria | 2919476304 | 2919476787 | 433 |
| 459 | iso_pu_bacteria | 2932422444 | 2932424016 | 433 |
| 460 | iso_pu_bacteria | 2990710928 | 2990713950 | 433 |
| 461 | 3300005844 | Ga0068862_100111189 | Ga0068862_1001111892 | 434 |
| 462 | 3300028380 | Ga0268265_10089751 | Ga0268265_100897512 | 434 |
| 463 | 3300031456 | Ga0307513_10000038 | Ga0307513_10000038147 | 434 |
| 464 | 3300031548 | Ga0307408_100064350 | Ga0307408_1000643503 | 434 |
| 465 | 3300037471 | Ga0395905_0016376 | Ga0395905_0016376_728_2134 | 434 |
| 466 | 3300048907 | Ga0496104_0074314 | Ga0496104_0074314_371_1774 | 434 |
| 467 | iso_pu_bacteria | 2643221684 | 2644474552 | 434 |
| 468 | iso_pu_bacteria | 2842718218 | 2842718694 | 434 |
| 469 | iso_pu_bacteria | 2857553236 | 2857556443 | 434 |
| 470 | iso_pu_bacteria | 2857564685 | 2857567829 | 434 |
| 471 | iso_pu_bacteria | 8047673197 | 8047676268 | 434 |
| 472 | 3300005328 | Ga0070676_10107330 | Ga0070676_101073302 | 435 |
| 473 | 3300005334 | Ga0068869_100134325 | Ga0068869_1001343252 | 435 |
| 474 | 3300005335 | Ga0070666_10005194 | Ga0070666_100051946 | 435 |
| 475 | 3300005347 | Ga0070668_100026664 | Ga0070668_1000266642 | 435 |
| 476 | 3300005354 | Ga0070675_100007798 | Ga0070675_1000077984 | 435 |
| 477 | 3300005355 | Ga0070671_100003392 | Ga0070671_1000033926 | 435 |
| 478 | 3300005367 | Ga0070667_100064801 | Ga0070667_1000648013 | 435 |
| 479 | 3300005456 | Ga0070678_100012914 | Ga0070678_1000129142 | 435 |
| 480 | 3300005459 | Ga0068867_100065911 | Ga0068867_1000659111 | 435 |
| 481 | 3300005617 | Ga0068859_100023273 | Ga0068859_1000232734 | 435 |
| 482 | 3300005617 | Ga0068859_100061816 | Ga0068859_1000618164 | 435 |
| 483 | 3300005618 | Ga0068864_100002065 | Ga0068864_1000020653 | 435 |
| 484 | 3300005719 | Ga0068861_100002250 | Ga0068861_1000022507 | 435 |
| 485 | 3300005841 | Ga0068863_100019244 | Ga0068863_1000192444 | 435 |
| 486 | 3300005842 | Ga0068858_100008614 | Ga0068858_1000086147 | 435 |
| 487 | 3300005843 | Ga0068860_100000823 | Ga0068860_10000082332 | 435 |
| 488 | 3300006051 | Ga0075364_10001078 | Ga0075364_1000107816 | 435 |
| 489 | 3300006195 | Ga0075366_10002629 | Ga0075366_100026293 | 435 |
| 490 | 3300006237 | Ga0097621_100030577 | Ga0097621_1000305773 | 435 |
| 491 | 3300006931 | Ga0097620_100023272 | Ga0097620_1000232724 | 435 |
| 492 | 3300006931 | Ga0097620_100061816 | Ga0097620_1000618164 | 435 |
| 493 | 3300009148 | Ga0105243_10081100 | Ga0105243_100811002 | 435 |
| 494 | 3300009553 | Ga0105249_10054347 | Ga0105249_100543472 | 435 |
| 495 | 3300013297 | Ga0157378_10001703 | Ga0157378_100017037 | 435 |
| 496 | 3300013306 | Ga0163162_10066510 | Ga0163162_100665104 | 435 |
| 497 | 3300013306 | Ga0163162_10333169 | Ga0163162_103331691 | 435 |
| 498 | 3300013308 | Ga0157375_10134369 | Ga0157375_101343692 | 435 |
| 499 | 3300014325 | Ga0163163_10035273 | Ga0163163_100352734 | 435 |
| 500 | 3300025903 | Ga0207680_10002711 | Ga0207680_100027114 | 435 |
| 501 | 3300025907 | Ga0207645_10097305 | Ga0207645_100973052 | 435 |
| 502 | 3300025923 | Ga0207681_10018545 | Ga0207681_100185454 | 435 |
| 503 | 3300025925 | Ga0207650_10032150 | Ga0207650_100321504 | 435 |
| 504 | 3300025926 | Ga0207659_10002170 | Ga0207659_100021707 | 435 |
| 505 | 3300025931 | Ga0207644_10002319 | Ga0207644_100023196 | 435 |
| 506 | 3300025935 | Ga0207709_10029590 | Ga0207709_100295903 | 435 |
| 507 | 3300025936 | Ga0207670_10033210 | Ga0207670_100332104 | 435 |
| 508 | 3300025941 | Ga0207711_10019236 | Ga0207711_100192364 | 435 |
| 509 | 3300025961 | Ga0207712_10034996 | Ga0207712_100349964 | 435 |
| 510 | 3300026035 | Ga0207703_10006064 | Ga0207703_100060645 | 435 |
| 511 | 3300026088 | Ga0207641_10019502 | Ga0207641_100195023 | 435 |
| 512 | 3300026089 | Ga0207648_10000179 | Ga0207648_1000017942 | 435 |
| 513 | 3300026095 | Ga0207676_10018678 | Ga0207676_100186783 | 435 |
| 514 | 3300026118 | Ga0207675_100002243 | Ga0207675_10000224314 | 435 |
| 515 | 3300026121 | Ga0207683_10031145 | Ga0207683_100311451 | 435 |
| 516 | 3300028381 | Ga0268264_10000613 | Ga0268264_1000061327 | 435 |
| 517 | 3300031456 | Ga0307513_10128755 | Ga0307513_101287552 | 435 |
| 518 | 3300037312 | Ga0395899_0005445 | Ga0395899_0005445_8242_9672 | 435 |
| 519 | 3300037312 | Ga0395899_0008661 | Ga0395899_0008661_1430_2839 | 435 |
| 520 | 3300037418 | Ga0395900_0026531 | Ga0395900_0026531_2046_3476 | 435 |
| 521 | 3300037418 | Ga0395900_0047478 | Ga0395900_0047478_636_2045 | 435 |
| 522 | 3300037466 | Ga0395898_0004158 | Ga0395898_0004158_12955_14385 | 435 |
| 523 | 3300037466 | Ga0395898_0018204 | Ga0395898_0018204_5526_6935 | 435 |
| 524 | 3300037471 | Ga0395905_0000027 | Ga0395905_0000027_138349_139779 | 435 |
| 525 | 3300037471 | Ga0395905_0000544 | Ga0395905_0000544_24984_26414 | 435 |
| 526 | 3300037471 | Ga0395905_0019544 | Ga0395905_0019544_2463_3875 | 435 |
| 527 | 3300037471 | Ga0395905_0029854 | Ga0395905_0029854_2861_4291 | 435 |
| 528 | 3300037471 | Ga0395905_0037055 | Ga0395905_0037055_2132_3562 | 435 |
| 529 | 3300037471 | Ga0395905_0100997 | Ga0395905_0100997_1138_2568 | 435 |
| 530 | 3300038443 | Ga0395901_0148480 | Ga0395901_0148480_320_1729 | 435 |
| 531 | 3300042007 | Ga0439449_0001504 | Ga0439449_0001504_2930_4336 | 435 |
| 532 | 3300042876 | Ga0451577_0000276 | Ga0451577_0000276_54621_56024 | 435 |
| 533 | 3300044712 | Ga0453684_0000891 | Ga0453684_0000891_43475_44878 | 435 |
| 534 | 3300045051 | Ga0451576_0002533 | Ga0451576_0002533_11432_12835 | 435 |
| 535 | 3300048928 | Ga0496125_0068323 | Ga0496125_0068323_649_2052 | 435 |
| 536 | 3300049128 | Ga0501308_000594 | Ga0501308_000594_897_2300 | 435 |
| 537 | 3300049571 | Ga0501034_0068665 | Ga0501034_0068665_180_1610 | 435 |
| 538 | 3300049579 | Ga0501043_0000057 | Ga0501043_0000057_71625_73025 | 435 |
| 539 | 3300049580 | Ga0501046_0000075 | Ga0501046_0000075_71625_73025 | 435 |
| 540 | 3300049581 | Ga0501047_0000081 | Ga0501047_0000081_71625_73025 | 435 |
| 541 | 3300049581 | Ga0501047_0034488 | Ga0501047_0034488_1479_2909 | 435 |
| 542 | 3300049822 | Ga0501035_0044005 | Ga0501035_0044005_1412_2842 | 435 |
| 543 | 3300050509 | nmdc:mga0qj67_21804_c1 | nmdc:mga0qj67_21804_c1_1660_3060 | 435 |
| 544 | 3300053086 | Ga0500578_0000363 | Ga0500578_0000363_5755_7155 | 435 |
| 545 | iso_pu_bacteria | 2894023352 | 2894024307 | 435 |
| 546 | 3300001979 | JGI24740J21852_10002472 | JGI24740J21852_100024728 | 436 |
| 547 | 3300003215 | JGI25153J46596_10002128 | JGI25153J46596_100021288 | 436 |
| 548 | 3300003775 | Ga0055524_1002736 | Ga0055524_10027367 | 436 |
| 549 | 3300003791 | Ga0055530_10015857 | Ga0055530_100158572 | 436 |
| 550 | 3300003794 | Ga0055531_10000257 | Ga0055531_1000025742 | 436 |
| 551 | 3300003794 | Ga0055531_10015203 | Ga0055531_100152033 | 436 |
| 552 | 3300005289 | Ga0065704_10072859 | Ga0065704_100728598 | 436 |
| 553 | 3300005290 | Ga0065712_10094921 | Ga0065712_100949212 | 436 |
| 554 | 3300005330 | Ga0070690_100050185 | Ga0070690_1000501853 | 436 |
| 555 | 3300005331 | Ga0070670_100008472 | Ga0070670_1000084724 | 436 |
| 556 | 3300005338 | Ga0068868_100008545 | Ga0068868_1000085456 | 436 |
| 557 | 3300005344 | Ga0070661_100000809 | Ga0070661_10000080917 | 436 |
| 558 | 3300005353 | Ga0070669_100018739 | Ga0070669_1000187393 | 436 |
| 559 | 3300005354 | Ga0070675_100005641 | Ga0070675_1000056415 | 436 |
| 560 | 3300005366 | Ga0070659_100000649 | Ga0070659_1000006498 | 436 |
| 561 | 3300005455 | Ga0070663_100000477 | Ga0070663_10000047710 | 436 |
| 562 | 3300005455 | Ga0070663_100087827 | Ga0070663_1000878272 | 436 |
| 563 | 3300005459 | Ga0068867_100000081 | Ga0068867_10000008120 | 436 |
| 564 | 3300005459 | Ga0068867_100001379 | Ga0068867_1000013796 | 436 |
| 565 | 3300005530 | Ga0070679_100018152 | Ga0070679_1000181524 | 436 |
| 566 | 3300005543 | Ga0070672_100000327 | Ga0070672_10000032720 | 436 |
| 567 | 3300005563 | Ga0068855_100058788 | Ga0068855_1000587884 | 436 |
| 568 | 3300005564 | Ga0070664_100001243 | Ga0070664_10000124317 | 436 |
| 569 | 3300005617 | Ga0068859_100044728 | Ga0068859_1000447284 | 436 |
| 570 | 3300005618 | Ga0068864_100019420 | Ga0068864_1000194204 | 436 |
| 571 | 3300006186 | Ga0075369_10016987 | Ga0075369_100169873 | 436 |
| 572 | 3300006195 | Ga0075366_10015652 | Ga0075366_100156522 | 436 |
| 573 | 3300006353 | Ga0075370_10003930 | Ga0075370_100039304 | 436 |
| 574 | 3300006353 | Ga0075370_10034699 | Ga0075370_100346991 | 436 |
| 575 | 3300006353 | Ga0075370_10043922 | Ga0075370_100439222 | 436 |
| 576 | 3300006358 | Ga0068871_100009237 | Ga0068871_1000092374 | 436 |
| 577 | 3300006931 | Ga0097620_100044728 | Ga0097620_1000447282 | 436 |
| 578 | 3300006946 | Ga0079104_1000055 | Ga0079104_100005516 | 436 |
| 579 | 3300009093 | Ga0105240_10008945 | Ga0105240_1000894518 | 436 |
| 580 | 3300009098 | Ga0105245_10033383 | Ga0105245_100333831 | 436 |
| 581 | 3300009148 | Ga0105243_10007445 | Ga0105243_100074456 | 436 |
| 582 | 3300009545 | Ga0105237_10028578 | Ga0105237_100285783 | 436 |
| 583 | 3300012497 | Ga0157319_1000003 | Ga0157319_1000003173 | 436 |
| 584 | 3300014745 | Ga0157377_10000048 | Ga0157377_1000004877 | 436 |
| 585 | 3300021361 | Ga0213872_10000007 | Ga0213872_10000007124 | 436 |
| 586 | 3300021361 | Ga0213872_10000313 | Ga0213872_1000031323 | 436 |
| 587 | 3300025273 | Ga0209673_1005215 | Ga0209673_10052156 | 436 |
| 588 | 3300025297 | Ga0209758_1000281 | Ga0209758_10002818 | 436 |
| 589 | 3300025303 | Ga0209051_1000025 | Ga0209051_100002516 | 436 |
| 590 | 3300025304 | Ga0209257_1000039 | Ga0209257_1000039592 | 436 |
| 591 | 3300025304 | Ga0209257_1000047 | Ga0209257_100004753 | 436 |
| 592 | 3300025893 | Ga0207682_10020532 | Ga0207682_100205323 | 436 |
| 593 | 3300025913 | Ga0207695_10171046 | Ga0207695_101710462 | 436 |
| 594 | 3300025920 | Ga0207649_10000774 | Ga0207649_1000077417 | 436 |
| 595 | 3300025921 | Ga0207652_10188737 | Ga0207652_101887372 | 436 |
| 596 | 3300025925 | Ga0207650_10000149 | Ga0207650_1000014973 | 436 |
| 597 | 3300025926 | Ga0207659_10000394 | Ga0207659_100003945 | 436 |
| 598 | 3300025931 | Ga0207644_10125541 | Ga0207644_101255412 | 436 |
| 599 | 3300025935 | Ga0207709_10000111 | Ga0207709_1000011165 | 436 |
| 600 | 3300025935 | Ga0207709_10001074 | Ga0207709_100010744 | 436 |
| 601 | 3300025937 | Ga0207669_10000874 | Ga0207669_1000087416 | 436 |
| 602 | 3300025940 | Ga0207691_10001736 | Ga0207691_1000173614 | 436 |
| 603 | 3300025945 | Ga0207679_10000325 | Ga0207679_1000032517 | 436 |
| 604 | 3300026067 | Ga0207678_10002065 | Ga0207678_100020657 | 436 |
| 605 | 3300026067 | Ga0207678_10125670 | Ga0207678_101256702 | 436 |
| 606 | 3300026089 | Ga0207648_10107784 | Ga0207648_101077841 | 436 |
| 607 | 3300026095 | Ga0207676_10008819 | Ga0207676_100088194 | 436 |
| 608 | 3300026116 | Ga0207674_10084059 | Ga0207674_100840592 | 436 |
| 609 | 3300027111 | Ga0209281_1000007 | Ga0209281_1000007813 | 436 |
| 610 | 3300027682 | Ga0209971_1001090 | Ga0209971_10010908 | 436 |
| 611 | 3300027866 | Ga0209813_10021589 | Ga0209813_100215892 | 436 |
| 612 | 3300027876 | Ga0209974_10007635 | Ga0209974_100076352 | 436 |
| 613 | 3300028794 | Ga0307515_10000011 | Ga0307515_10000011379 | 436 |
| 614 | 3300028794 | Ga0307515_10000609 | Ga0307515_1000060916 | 436 |
| 615 | 3300028794 | Ga0307515_10000655 | Ga0307515_1000065574 | 436 |
| 616 | 3300028794 | Ga0307515_10001484 | Ga0307515_1000148428 | 436 |
| 617 | 3300028794 | Ga0307515_10003487 | Ga0307515_1000348717 | 436 |
| 618 | 3300028794 | Ga0307515_10003934 | Ga0307515_1000393422 | 436 |
| 619 | 3300031251 | Ga0265327_10000320 | Ga0265327_1000032085 | 436 |
| 620 | 3300031344 | Ga0265316_10001401 | Ga0265316_1000140111 | 436 |
| 621 | 3300031456 | Ga0307513_10004316 | Ga0307513_100043162 | 436 |
| 622 | 3300031456 | Ga0307513_10019870 | Ga0307513_100198704 | 436 |
| 623 | 3300031507 | Ga0307509_10000991 | Ga0307509_1000099110 | 436 |
| 624 | 3300031616 | Ga0307508_10000404 | Ga0307508_1000040429 | 436 |
| 625 | 3300031649 | Ga0307514_10005041 | Ga0307514_100050416 | 436 |
| 626 | 3300031649 | Ga0307514_10023099 | Ga0307514_100230997 | 436 |
| 627 | 3300031711 | Ga0265314_10108281 | Ga0265314_101082811 | 436 |
| 628 | 3300031712 | Ga0265342_10060092 | Ga0265342_100600922 | 436 |
| 629 | 3300031730 | Ga0307516_10000359 | Ga0307516_1000035953 | 436 |
| 630 | 3300031730 | Ga0307516_10001752 | Ga0307516_100017528 | 436 |
| 631 | 3300031730 | Ga0307516_10100905 | Ga0307516_101009052 | 436 |
| 632 | 3300031731 | Ga0307405_10006874 | Ga0307405_100068744 | 436 |
| 633 | 3300031824 | Ga0307413_10024068 | Ga0307413_100240682 | 436 |
| 634 | 3300031911 | Ga0307412_10015454 | Ga0307412_100154546 | 436 |
| 635 | 3300032002 | Ga0307416_100024936 | Ga0307416_1000249366 | 436 |
| 636 | 3300032004 | Ga0307414_10071274 | Ga0307414_100712742 | 436 |
| 637 | 3300032005 | Ga0307411_10003755 | Ga0307411_100037557 | 436 |
| 638 | 3300032126 | Ga0307415_100057436 | Ga0307415_1000574362 | 436 |
| 639 | 3300033179 | Ga0307507_10019265 | Ga0307507_100192654 | 436 |
| 640 | 3300033180 | Ga0307510_10027525 | Ga0307510_100275253 | 436 |
| 641 | 3300034820 | Ga0373959_0005891 | Ga0373959_0005891_93_1535 | 436 |
| 642 | 3300035114 | Ga0373939_0000040 | Ga0373939_0000040_36263_37729 | 436 |
| 643 | 3300035691 | Ga0373931_0000637 | Ga0373931_0000637_9665_11131 | 436 |
| 644 | 3300037471 | Ga0395905_0000728 | Ga0395905_0000728_6421_7824 | 436 |
| 645 | 3300037471 | Ga0395905_0009245 | Ga0395905_0009245_2219_3619 | 436 |
| 646 | 3300037471 | Ga0395905_0015718 | Ga0395905_0015718_2984_4384 | 436 |
| 647 | 3300039447 | Ga0436361_0094944 | Ga0436361_0094944_3291_4754 | 436 |
| 648 | 3300039447 | Ga0436361_0163583 | Ga0436361_0163583_101508_102917 | 436 |
| 649 | 3300042438 | Ga0439459_0000706 | Ga0439459_0000706_1028_2428 | 436 |
| 650 | 3300046454 | Ga0495592_0000083 | Ga0495592_0000083_55161_56561 | 436 |
| 651 | 3300046507 | Ga0495606_0009174 | Ga0495606_0009174_563_1996 | 436 |
| 652 | 3300048928 | Ga0496125_0010319 | Ga0496125_0010319_7012_8427 | 436 |
| 653 | 3300049649 | Ga0501198_000012 | Ga0501198_000012_94171_95571 | 436 |
| 654 | 3300049662 | Ga0501222_000010 | Ga0501222_000010_94177_95577 | 436 |
| 655 | 3300050493 | nmdc:mga0k408_10252_c1 | nmdc:mga0k408_10252_c1_744_2144 | 436 |
| 656 | 3300050493 | nmdc:mga0k408_12380_c1 | nmdc:mga0k408_12380_c1_2211_3611 | 436 |
| 657 | 3300050493 | nmdc:mga0k408_287_c1 | nmdc:mga0k408_287_c1_16374_17774 | 436 |
| 658 | 3300050494 | nmdc:mga06z11_32547_c1 | nmdc:mga06z11_32547_c1_880_2280 | 436 |
| 659 | 3300050496 | nmdc:mga07m45_16271_c1 | nmdc:mga07m45_16271_c1_1708_3108 | 436 |
| 660 | 3300050496 | nmdc:mga07m45_3016_c1 | nmdc:mga07m45_3016_c1_2260_3660 | 436 |
| 661 | 3300050496 | nmdc:mga07m45_57420_c1 | nmdc:mga07m45_57420_c1_636_2063 | 436 |
| 662 | 3300050496 | nmdc:mga07m45_6146_c1 | nmdc:mga07m45_6146_c1_4045_5445 | 436 |
| 663 | 3300050496 | nmdc:mga07m45_77532_c1 | nmdc:mga07m45_77532_c1_233_1633 | 436 |
| 664 | 3300050496 | nmdc:mga07m45_8869_c1 | nmdc:mga07m45_8869_c1_833_2233 | 436 |
| 665 | 3300053136 | Ga0500559_0000019 | Ga0500559_0000019_107524_108924 | 436 |
| 666 | 3300053156 | Ga0500622_0003007 | Ga0500622_0003007_5897_7297 | 436 |
| 667 | 3300059421 | Ga0590071_013562 | Ga0590071_013562_324_1790 | 436 |
| 668 | 3300059424 | Ga0590075_009875 | Ga0590075_009875_182_1582 | 436 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8snh-assembly1.cif.gz_D | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.8824 | 15 | 432 |
| 8snh-assembly1.cif.gz_D | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.8763 | 15 | 432 |
| 8ab6-assembly1.cif.gz_N | complex iii2 from yarrowia lipolytica, combined datasets, consensus refinement | 0.8711 | 21 | 419 |
| 6hu9-assembly1.cif.gz_N | iii2-iv2 mitochondrial respiratory supercomplex from s. cerevisiae | 0.8686 | 20 | 416 |
| 7o3c-assembly1.cif.gz_C | murine supercomplex ciii2civ in the mature unlocked conformation | 0.8672 | 21 | 416 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P03879_1_263_1.20.810.10 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8818 | 22 | 277 | 1.20.810.10 |
| af_Q37311_1_385_1.20.810.10 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8671 | 21 | 416 | 1.20.810.10 |
| 3cwbC00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8606 | 21 | 416 | 1.20.810.10 |
| 1kyoC00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8584 | 20 | 419 | 1.20.810.10 |
| af_P05642_1_215_1.20.810.10 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8524 | 16 | 222 | 1.20.810.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0N9XSA1-F1-model_v4 | Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) | 0.9429 | 26 | 150 |
GO:0005743
GO:0006122 GO:0008121 GO:0046872 |
| AF-Q85SS8-F1-model_v4 | Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) | 0.9417 | 26 | 148 |
GO:0005743
GO:0006122 GO:0008121 GO:0046872 |
| AF-G3LSP3-F1-model_v4 | Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) | 0.9387 | 26 | 144 |
GO:0005743
GO:0006122 GO:0008121 GO:0046872 |
| AF-B9VAV3-F1-model_v4 | Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) | 0.9382 | 26 | 144 |
GO:0005743
GO:0006122 GO:0008121 GO:0046872 |
| AF-Q7GI26-F1-model_v4 | Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) | 0.9378 | 26 | 142 |
GO:0005743
GO:0006122 GO:0008121 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar