F473933

General Info

Members Datasets Scaffolds Average Seq Length
668 408 592 452

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10000038|Ga0307513_10000038147
Length 513
Sequence MAEFKEISPDAPIAVKAMNWIDNRFPASKLYKEHMSEYYAPKNFNFWYIFGSLAMLVLVIQIVTGIFLTMNYKPDAALAFGSVEYIMRDVPWGWLIRYMHSTGASAFFVVVYLHMFRGLLYGSYRKPRELVWIFGCAIFLCLMAEAFMGYLLPWGQMSYWGAQVIVNLFAAIPFIGPDLALLIRGDYVVGDATLNRFFAFHVIAVPLVLLGLVAAHIIALHEVGSNNPDGVEIKGPNAPKDAAGHPVDGIPFHPYYTVHDIFGVSMFLMIFTAIIFFAPEFGGYFLEYNNFIPADPLKTPAHIAPVWYFTPYYSMLRAITGEMAGALGIIAIVAAVLAARKLKGIFKPAVLVIAIGAALLLGLLPSIANWVGLVAPSAGAGIAKGLDALAKPLAGVPFLGELWGMMVKGIDAKFWGVVXMGGAVIILFFLPWLDHSPVKSIRYRPDWHKYMYGIFVVNFLVLGYLGVQPPSAIGERVSQLGTLFYFGFFLLMPWWSRQGTAKTPPDRIIFHGH

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
4 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
5 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
6 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
7 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
8 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
9 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
10 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
11 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
12 2547132374 Acidovorax radicis N35 Isolate Unclassified
13 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
14 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
15 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
16 2643221570 Acidovorax sp. Root568 Isolate Unclassified
17 2643221585 Pelomonas sp. Root662 Isolate Unclassified
18 2643221596 Acidovorax sp. Root70 Isolate Unclassified
19 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
20 2643221609 Acidovorax sp. Root217 Isolate Unclassified
21 2643221611 Acidovorax sp. Root219 Isolate Unclassified
22 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
23 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
24 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
25 2643221652 Acidovorax sp. Root402 Isolate Unclassified
26 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
27 2643221656 Pelomonas sp. Root405 Isolate Unclassified
28 2643221660 Methylibium sp. Root1272 Isolate Unclassified
29 2643221684 Massilia sp. Root133 Isolate Unclassified
30 2643221717 Acidovorax sp. Root267 Isolate Unclassified
31 2721755523 Delftia sp. HK171 Isolate Unclassified
32 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
33 2738541337 Pelomonas sp. BT06 Isolate Unclassified
34 2738541357 Duganella sp. GV053 Isolate Unclassified
35 2738543003 Duganella sp. GV066 Isolate Unclassified
36 2738543012 Acidovorax sp. CF301 Isolate Unclassified
37 2738543026 Duganella sp. GV089 Isolate Unclassified
38 2738543029 Duganella sp. GV039 Isolate Unclassified
39 2816332133 Acidovorax radicis 2721A Isolate Unclassified
40 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
41 2818991450 Burkholderia sp. 604 Isolate Unclassified
42 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
43 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
44 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
45 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
46 2857553236 Duganella sp. R-74557 Isolate Unclassified
47 2857564685 Duganella sp. R-74599 Isolate Unclassified
48 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
49 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
50 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
51 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
52 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
53 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
54 2904564687 Burkholderia sp. 571 Isolate Unclassified
55 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
56 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
57 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
58 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
59 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
60 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
61 2919476304 Duganella sp. 3397 Isolate Unclassified
62 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
63 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
64 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
65 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
66 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
67 2928536128 Burkholderia sola 565 Isolate Unclassified
68 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
69 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
70 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
71 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
72 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
73 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
74 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
75 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
76 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
77 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
78 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
79 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
80 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
81 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
82 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
83 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
84 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
85 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
86 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
87 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
88 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
89 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
90 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
91 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
92 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
93 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
94 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
95 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
96 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
97 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
98 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
99 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
100 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
101 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
102 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
103 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
104 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
105 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
106 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
107 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
108 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
109 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
110 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
111 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
112 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
113 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
114 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
115 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
116 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
117 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
118 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
119 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
120 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
121 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
122 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
123 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
124 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
125 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
126 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
127 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
128 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
129 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
130 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
131 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
132 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
133 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
134 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
135 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
136 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
137 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
138 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
139 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
140 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
141 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
142 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
143 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
144 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
145 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
146 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
147 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
148 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
149 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
150 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
151 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
152 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
153 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
154 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
155 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
156 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
157 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
158 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
159 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
160 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
161 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
162 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
163 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
164 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
165 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
166 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
167 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
168 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
169 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
170 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
171 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
172 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
173 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
174 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
175 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
176 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
177 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
178 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
179 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
180 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
181 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
182 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
183 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
188 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
189 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
190 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
192 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
193 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
196 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
201 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
204 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
251 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
256 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
258 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
261 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
262 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
263 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
264 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
265 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
266 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
267 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
268 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
269 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
270 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
271 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
272 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
273 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
274 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
275 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
276 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
277 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
278 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
279 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
280 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
281 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
282 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
283 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
284 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
285 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
286 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
287 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
288 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
289 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
290 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
291 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
292 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
293 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
294 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
295 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
296 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
297 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
298 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
299 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
300 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
301 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
302 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
303 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
304 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
305 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
306 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
307 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
308 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
309 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
310 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
311 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
312 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
313 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
314 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
315 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
316 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
317 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
318 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
319 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
320 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
321 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
322 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
323 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
324 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
325 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
326 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
327 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
328 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
329 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
330 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
331 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
332 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
333 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
334 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
335 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
336 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
337 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
338 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
339 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
340 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
341 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
342 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
343 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
344 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
345 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
346 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
347 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
348 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
349 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
350 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
351 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
352 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
355 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
357 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
358 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
364 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
365 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
366 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
367 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
368 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
369 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
370 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
373 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
374 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
375 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
376 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
377 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
378 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
379 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
380 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
381 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
382 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
383 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
386 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
387 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
388 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
389 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
390 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
391 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
392 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
405 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
406 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
407 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
408 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.78
Metatranscriptomes 2.84
Isolates 11.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.51
Nodule 1.65
Rhizoplane 0.75
Rhizosphere 66.77
Stem 0
Stem Tuber 0
Unclassified 13.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002472 3300001979 Bacteria 8363
2 JGI25155J39150_1000022 3300002704 Bacteria 142950
3 JGI25156J39149_1000005 3300002705 Bacteria 263980
4 JGI25154J39366_1000017 3300002738 Bacteria 252448
5 JGI25157J39369_1000003 3300002741 Bacteria 274935
6 JGI25152J39213_1000900 3300002773 Bacteria 14558
7 JGI25150J39212_1003423 3300002774 Bacteria 3712
8 JGI25153J46596_10002128 3300003215 Bacteria 11587
9 JGI25153J46596_10004541 3300003215 Bacteria 7462
10 JGI25160J50197_1000273 3300003354 Bacteria 38119
11 JGI25161J50226_1000095 3300003374 Bacteria 72343
12 Ga0055538_1000038 3300003751 Bacteria 186588
13 Ga0055539_1000049 3300003752 Bacteria 186588
14 Ga0055533_1000060 3300003756 Bacteria 186588
15 Ga0055525_1000068 3300003759 Bacteria 186588
16 Ga0055526_1011045 3300003771 Bacteria 4122
17 Ga0055537_1000205 3300003773 Bacteria 44266
18 Ga0055524_1000013 3300003775 Bacteria 259850
19 Ga0055524_1000073 3300003775 Bacteria 123033
20 Ga0055524_1002736 3300003775 Bacteria 8906
21 Ga0055534_1000363 3300003784 Bacteria 28579
22 Ga0055528_1000289 3300003790 Bacteria 42964
23 Ga0055530_10001804 3300003791 Bacteria 14848
24 Ga0055530_10015037 3300003791 Bacteria 2548
25 Ga0055530_10015857 3300003791 Bacteria 2436
26 Ga0055540_1000001 3300003792 Bacteria 466834
27 Ga0055540_1000037 3300003792 Bacteria 162957
28 Ga0055531_10000257 3300003794 Bacteria 56547
29 Ga0055531_10000261 3300003794 Bacteria 55661
30 Ga0055531_10015203 3300003794 Bacteria 3410
31 Ga0055531_10023264 3300003794 Bacteria 2331
32 Ga0055541_1000036 3300003841 Bacteria 186588
33 Ga0055543_1000218 3300004625 Bacteria 46120
34 Ga0065165_1000080 3300005262 Bacteria 159638
35 Ga0065704_10072859 3300005289 Bacteria 7918
36 Ga0065712_10094921 3300005290 Bacteria 2235
37 Ga0065707_10029034 3300005295 Bacteria 1592
38 Ga0065707_10083392 3300005295 Bacteria 9339
39 Ga0065707_10149697 3300005295 Bacteria 1673
40 Ga0070658_10050285 3300005327 Bacteria 3378
41 Ga0070676_10029646 3300005328 Bacteria 3114
42 Ga0070676_10107330 3300005328 Bacteria 1733
43 Ga0070690_100050185 3300005330 Bacteria 2661
44 Ga0070670_100008472 3300005331 Bacteria 8769
45 Ga0070670_100030450 3300005331 Bacteria 4647
46 Ga0068869_100012628 3300005334 Bacteria 5586
47 Ga0068869_100134325 3300005334 Bacteria 1905
48 Ga0070666_10005194 3300005335 Bacteria 7975
49 Ga0068868_100003181 3300005338 Bacteria 11428
50 Ga0068868_100008545 3300005338 Bacteria 7332
51 Ga0070660_100001068 3300005339 Bacteria 18415
52 Ga0070661_100000809 3300005344 Bacteria 22476
53 Ga0070661_100005897 3300005344 Bacteria 8430
54 Ga0070661_100033267 3300005344 Bacteria 3734
55 Ga0070668_100026664 3300005347 Bacteria 4386
56 Ga0070669_100018739 3300005353 Bacteria 4947
57 Ga0070669_100046001 3300005353 Bacteria 3182
58 Ga0070675_100005641 3300005354 Bacteria 9582
59 Ga0070675_100007798 3300005354 Bacteria 8291
60 Ga0070675_100014444 3300005354 Bacteria 6226
61 Ga0070675_100035528 3300005354 Bacteria 4050
62 Ga0070675_100040468 3300005354 Bacteria 3805
63 Ga0070671_100003392 3300005355 Bacteria 12430
64 Ga0070673_100011026 3300005364 Bacteria 6156
65 Ga0070659_100000649 3300005366 Bacteria 25413
66 Ga0070659_100005068 3300005366 Bacteria 9444
67 Ga0070659_100051985 3300005366 Bacteria 3222
68 Ga0070659_100060202 3300005366 Bacteria 2999
69 Ga0070667_100008422 3300005367 Bacteria 8553
70 Ga0070667_100026749 3300005367 Bacteria 4800
71 Ga0070667_100064801 3300005367 Bacteria 3101
72 Ga0070700_100043345 3300005441 Bacteria 2767
73 Ga0070708_100114460 3300005445 Bacteria 2482
74 Ga0070663_100000477 3300005455 Bacteria 21034
75 Ga0070663_100087827 3300005455 Bacteria 2298
76 Ga0070678_100007358 3300005456 Bacteria 6525
77 Ga0070678_100012914 3300005456 Bacteria 5214
78 Ga0070662_100007162 3300005457 Bacteria 7224
79 Ga0070681_10035645 3300005458 Bacteria 4997
80 Ga0068867_100000081 3300005459 Bacteria 59361
81 Ga0068867_100001379 3300005459 Bacteria 16789
82 Ga0068867_100011430 3300005459 Bacteria 6264
83 Ga0068867_100065911 3300005459 Bacteria 2696
84 Ga0070685_10053663 3300005466 Bacteria 2336
85 Ga0070706_100000463 3300005467 Bacteria 48079
86 Ga0070706_100014985 3300005467 Bacteria 7159
87 Ga0070707_100036188 3300005468 Bacteria 4710
88 Ga0070679_100018152 3300005530 Bacteria 6822
89 Ga0070679_100284990 3300005530 Bacteria 1604
90 Ga0070697_100102024 3300005536 Bacteria 2384
91 Ga0068853_100030634 3300005539 Bacteria 4546
92 Ga0070672_100000327 3300005543 Bacteria 27160
93 Ga0070672_100054812 3300005543 Bacteria 3122
94 Ga0070686_100075387 3300005544 Bacteria 2219
95 Ga0070693_100003345 3300005547 Bacteria 7454
96 Ga0070693_100142925 3300005547 Bacteria 1508
97 Ga0070665_100032591 3300005548 Bacteria 5244
98 Ga0068855_100042416 3300005563 Bacteria 5391
99 Ga0068855_100058788 3300005563 Bacteria 4500
100 Ga0068855_100169978 3300005563 Bacteria 2469
101 Ga0070664_100001243 3300005564 Bacteria 20374
102 Ga0068852_100003754 3300005616 Bacteria 10652
103 Ga0068852_100024397 3300005616 Bacteria 4886
104 Ga0068859_100023273 3300005617 Bacteria 6217
105 Ga0068859_100044728 3300005617 Bacteria 4448
106 Ga0068859_100061816 3300005617 Bacteria 3774
107 Ga0068864_100002065 3300005618 Bacteria 16597
108 Ga0068864_100019420 3300005618 Bacteria 5682
109 Ga0068861_100000694 3300005719 Bacteria 20156
110 Ga0068861_100002250 3300005719 Bacteria 12540
111 Ga0068870_10036066 3300005840 Bacteria 2542
112 Ga0068870_10039650 3300005840 Bacteria 2438
113 Ga0068863_100019244 3300005841 Bacteria 6532
114 Ga0068863_100022738 3300005841 Bacteria 5989
115 Ga0068858_100008614 3300005842 Bacteria 9799
116 Ga0068860_100000823 3300005843 Bacteria 34706
117 Ga0068862_100041306 3300005844 Bacteria 3923
118 Ga0068862_100111189 3300005844 Bacteria 2405
119 Ga0070717_10009296 3300006028 Bacteria 7386
120 Ga0075365_10004820 3300006038 Bacteria 7197
121 Ga0075364_10001078 3300006051 Bacteria 14541
122 Ga0075364_10059950 3300006051 Bacteria 2495
123 Ga0075432_10002101 3300006058 Bacteria 6636
124 Ga0075367_10023144 3300006178 Bacteria 3492
125 Ga0075369_10016987 3300006186 Bacteria 2944
126 Ga0075369_10021842 3300006186 Bacteria 2635
127 Ga0075366_10001536 3300006195 Bacteria 11547
128 Ga0075366_10002629 3300006195 Bacteria 9242
129 Ga0075366_10005340 3300006195 Bacteria 6964
130 Ga0075366_10009338 3300006195 Bacteria 5474
131 Ga0075366_10014023 3300006195 Bacteria 4572
132 Ga0075366_10015652 3300006195 Bacteria 4352
133 Ga0075366_10020818 3300006195 Bacteria 3808
134 Ga0075366_10065892 3300006195 Bacteria 2154
135 Ga0075366_10078163 3300006195 Bacteria 1975
136 Ga0075366_10089416 3300006195 Bacteria 1844
137 Ga0075366_10100929 3300006195 Bacteria 1732
138 Ga0097621_100001917 3300006237 Bacteria 14212
139 Ga0097621_100030577 3300006237 Bacteria 4264
140 Ga0097621_100038182 3300006237 Bacteria 3853
141 Ga0075370_10003930 3300006353 Bacteria 7134
142 Ga0075370_10022105 3300006353 Bacteria 3489
143 Ga0075370_10034699 3300006353 Bacteria 2828
144 Ga0075370_10043922 3300006353 Bacteria 2526
145 Ga0075370_10100824 3300006353 Bacteria 1671
146 Ga0068871_100004794 3300006358 Bacteria 9457
147 Ga0068871_100009237 3300006358 Bacteria 7131
148 Ga0068871_100044841 3300006358 Bacteria 3557
149 Ga0075428_100009793 3300006844 Bacteria 10650
150 Ga0075428_100030466 3300006844 Bacteria 5966
151 Ga0075429_100126991 3300006880 Bacteria 2230
152 Ga0068865_100018189 3300006881 Bacteria 4532
153 Ga0068865_100051619 3300006881 Bacteria 2847
154 Ga0097620_100023272 3300006931 Bacteria 6217
155 Ga0097620_100044728 3300006931 Bacteria 4448
156 Ga0097620_100061816 3300006931 Bacteria 3774
157 Ga0079104_1000055 3300006946 Bacteria 166522
158 Ga0079104_1000070 3300006946 Bacteria 153879
159 Ga0075435_100061728 3300007076 Bacteria 3041
160 Ga0105240_10008945 3300009093 Bacteria 14239
161 Ga0105240_10049342 3300009093 Bacteria 5313
162 Ga0111539_10001740 3300009094 Bacteria 28934
163 Ga0105245_10033383 3300009098 Bacteria 4561
164 Ga0105245_10033877 3300009098 Bacteria 4526
165 Ga0105245_10049512 3300009098 Bacteria 3763
166 Ga0105243_10007445 3300009148 Bacteria 8414
167 Ga0105243_10081100 3300009148 Bacteria 2648
168 Ga0105242_10102667 3300009176 Bacteria 2425
169 Ga0105242_10231415 3300009176 Bacteria 1656
170 Ga0105248_10019961 3300009177 Bacteria 7419
171 Ga0105248_10166687 3300009177 Bacteria 2483
172 Ga0105237_10028275 3300009545 Bacteria 5713
173 Ga0105237_10028578 3300009545 Bacteria 5678
174 Ga0105238_10111489 3300009551 Bacteria 2716
175 Ga0105238_10117685 3300009551 Bacteria 2637
176 Ga0105249_10054347 3300009553 Bacteria 3662
177 Ga0105239_10189383 3300010375 Bacteria 2303
178 Ga0157319_1000003 3300012497 Bacteria 397199
179 Ga0157371_10088006 3300013102 Bacteria 2199
180 Ga0157369_10029192 3300013105 Bacteria 6097
181 Ga0157378_10001703 3300013297 Bacteria 19776
182 Ga0157378_10063456 3300013297 Bacteria 3301
183 Ga0163162_10012566 3300013306 Bacteria 8270
184 Ga0163162_10066510 3300013306 Bacteria 3653
185 Ga0163162_10070976 3300013306 Bacteria 3535
186 Ga0163162_10333169 3300013306 Bacteria 1650
187 Ga0157372_10004423 3300013307 Bacteria 14987
188 Ga0157372_10064423 3300013307 Bacteria 4112
189 Ga0157375_10024841 3300013308 Bacteria 5553
190 Ga0157375_10134369 3300013308 Bacteria 2596
191 Ga0163163_10035273 3300014325 Bacteria 4852
192 Ga0157380_10010044 3300014326 Bacteria 6794
193 Ga0157380_10149440 3300014326 Bacteria 2017
194 Ga0157377_10000048 3300014745 Bacteria 94061
195 Ga0157377_10001539 3300014745 Bacteria 10025
196 Ga0157376_10006686 3300014969 Bacteria 8161
197 Ga0163161_10014566 3300017792 Bacteria 5473
198 Ga0163161_10184612 3300017792 Bacteria 1601
199 Ga0213872_10000007 3300021361 Bacteria 228206
200 Ga0213872_10000313 3300021361 Bacteria 41306
201 Ga0213872_10002128 3300021361 Bacteria 11902
202 Ga0209435_100002 3300025206 Bacteria 794178
203 Ga0209784_100021 3300025224 Bacteria 408534
204 Ga0209566_100039 3300025225 Bacteria 303368
205 Ga0209674_100036 3300025226 Bacteria 408534
206 Ga0209563_100040 3300025230 Bacteria 408534
207 Ga0207425_1000691 3300025245 Bacteria 18293
208 Ga0207425_1003670 3300025245 Bacteria 4832
209 Ga0209646_1000001 3300025246 Bacteria 3092932
210 Ga0209026_1000001 3300025250 Bacteria 1228671
211 Ga0209677_100023 3300025253 Bacteria 408534
212 Ga0209759_1000001 3300025256 Bacteria 2799452
213 Ga0209129_1000027 3300025258 Bacteria 409587
214 Ga0209565_1000128 3300025263 Bacteria 108959
215 Ga0209565_1000574 3300025263 Bacteria 24961
216 Ga0209565_1004707 3300025263 Bacteria 4099
217 Ga0209673_1000008 3300025273 Bacteria 626013
218 Ga0209673_1005215 3300025273 Bacteria 6625
219 Ga0209673_1005777 3300025273 Bacteria 6155
220 Ga0209130_1000072 3300025284 Bacteria 175726
221 Ga0209130_1001611 3300025284 Bacteria 14009
222 Ga0209675_1000099 3300025291 Bacteria 128911
223 Ga0209675_1009287 3300025291 Bacteria 3489
224 Ga0209675_1009484 3300025291 Bacteria 3434
225 Ga0209676_1000023 3300025292 Bacteria 589732
226 Ga0209025_1014674 3300025294 Bacteria 4795
227 Ga0209564_1000139 3300025295 Bacteria 180328
228 Ga0209758_1000281 3300025297 Bacteria 100826
229 Ga0209758_1000310 3300025297 Bacteria 94307
230 Ga0209758_1033741 3300025297 Bacteria 2049
231 Ga0209050_1000022 3300025298 Bacteria 565239
232 Ga0209050_1000730 3300025298 Bacteria 47896
233 Ga0209256_1000001 3300025299 Bacteria 2166974
234 Ga0209256_1000061 3300025299 Bacteria 260890
235 Ga0207426_1000319 3300025302 Bacteria 92696
236 Ga0207426_1013921 3300025302 Bacteria 2965
237 Ga0209051_1000013 3300025303 Bacteria 565239
238 Ga0209051_1000018 3300025303 Bacteria 527061
239 Ga0209051_1000025 3300025303 Bacteria 415397
240 Ga0209257_1000039 3300025304 Bacteria 591694
241 Ga0209257_1000042 3300025304 Bacteria 537149
242 Ga0209257_1000047 3300025304 Bacteria 460507
243 Ga0209257_1000461 3300025304 Bacteria 75360
244 Ga0207682_10020532 3300025893 Bacteria 2593
245 Ga0207688_10009652 3300025901 Bacteria 5254
246 Ga0207680_10002711 3300025903 Bacteria 8272
247 Ga0207699_10012699 3300025906 Bacteria 4288
248 Ga0207645_10019522 3300025907 Bacteria 4443
249 Ga0207645_10097305 3300025907 Bacteria 1897
250 Ga0207643_10015716 3300025908 Bacteria 4123
251 Ga0207684_10003939 3300025910 Bacteria 14206
252 Ga0207684_10032412 3300025910 Bacteria 4443
253 Ga0207707_10002239 3300025912 Bacteria 17488
254 Ga0207695_10171046 3300025913 Bacteria 2098
255 Ga0207657_10022456 3300025919 Bacteria 5901
256 Ga0207649_10000774 3300025920 Bacteria 20745
257 Ga0207652_10016076 3300025921 Bacteria 6103
258 Ga0207652_10188737 3300025921 Bacteria 1853
259 Ga0207652_10266755 3300025921 Bacteria 1544
260 Ga0207646_10050732 3300025922 Bacteria 3713
261 Ga0207681_10005856 3300025923 Bacteria 7535
262 Ga0207681_10018545 3300025923 Bacteria 4385
263 Ga0207694_10047253 3300025924 Bacteria 3329
264 Ga0207650_10000149 3300025925 Bacteria 83837
265 Ga0207650_10009624 3300025925 Bacteria 6609
266 Ga0207650_10032150 3300025925 Bacteria 3795
267 Ga0207659_10000394 3300025926 Bacteria 26304
268 Ga0207659_10002170 3300025926 Bacteria 11657
269 Ga0207659_10003684 3300025926 Bacteria 9239
270 Ga0207659_10012392 3300025926 Bacteria 5423
271 Ga0207687_10034232 3300025927 Bacteria 3449
272 Ga0207644_10002319 3300025931 Bacteria 12312
273 Ga0207644_10125541 3300025931 Bacteria 1958
274 Ga0207690_10001407 3300025932 Bacteria 15134
275 Ga0207690_10059207 3300025932 Bacteria 2594
276 Ga0207706_10007947 3300025933 Bacteria 9793
277 Ga0207706_10084841 3300025933 Bacteria 2785
278 Ga0207686_10018138 3300025934 Bacteria 3979
279 Ga0207709_10000111 3300025935 Bacteria 127580
280 Ga0207709_10001074 3300025935 Bacteria 20124
281 Ga0207709_10029590 3300025935 Bacteria 3178
282 Ga0207670_10005748 3300025936 Bacteria 6843
283 Ga0207670_10033210 3300025936 Bacteria 3324
284 Ga0207669_10000874 3300025937 Bacteria 12794
285 Ga0207691_10001736 3300025940 Bacteria 21490
286 Ga0207691_10010760 3300025940 Bacteria 8782
287 Ga0207711_10011339 3300025941 Bacteria 7404
288 Ga0207711_10019236 3300025941 Bacteria 5686
289 Ga0207711_10032072 3300025941 Bacteria 4440
290 Ga0207689_10074760 3300025942 Bacteria 2784
291 Ga0207679_10000325 3300025945 Bacteria 35612
292 Ga0207679_10119382 3300025945 Bacteria 2096
293 Ga0207667_10087589 3300025949 Bacteria 3221
294 Ga0207712_10034996 3300025961 Bacteria 3407
295 Ga0207712_10340970 3300025961 Bacteria 1243
296 Ga0207640_10030610 3300025981 Bacteria 3317
297 Ga0207677_10016673 3300026023 Bacteria 4358
298 Ga0207703_10006064 3300026035 Bacteria 9665
299 Ga0207639_10009019 3300026041 Bacteria 6869
300 Ga0207639_10013695 3300026041 Bacteria 5685
301 Ga0207678_10002065 3300026067 Bacteria 18220
302 Ga0207678_10125670 3300026067 Bacteria 2188
303 Ga0207708_10030164 3300026075 Bacteria 4112
304 Ga0207708_10047600 3300026075 Bacteria 3264
305 Ga0207641_10019502 3300026088 Bacteria 5567
306 Ga0207641_10064069 3300026088 Bacteria 3141
307 Ga0207641_10111650 3300026088 Bacteria 2424
308 Ga0207648_10000179 3300026089 Bacteria 66602
309 Ga0207648_10018438 3300026089 Bacteria 6319
310 Ga0207648_10107784 3300026089 Bacteria 2445
311 Ga0207676_10008819 3300026095 Bacteria 7179
312 Ga0207676_10018678 3300026095 Bacteria 5045
313 Ga0207676_10102551 3300026095 Bacteria 2375
314 Ga0207674_10061556 3300026116 Bacteria 3793
315 Ga0207674_10084059 3300026116 Bacteria 3181
316 Ga0207675_100002243 3300026118 Bacteria 19223
317 Ga0207683_10031145 3300026121 Bacteria 4628
318 Ga0207683_10032225 3300026121 Bacteria 4553
319 Ga0207698_10004036 3300026142 Bacteria 8910
320 Ga0207698_10011836 3300026142 Bacteria 5679
321 Ga0209281_1000007 3300027111 Bacteria 938265
322 Ga0209281_1000103 3300027111 Bacteria 221425
323 Ga0209981_1002116 3300027378 Bacteria 2528
324 Ga0209981_1002328 3300027378 Bacteria 2414
325 Ga0210000_1007214 3300027462 Bacteria 1625
326 Ga0209970_1000036 3300027614 Bacteria 17242
327 Ga0209971_1001090 3300027682 Bacteria 6890
328 Ga0209813_10021589 3300027866 Bacteria 1812
329 Ga0209974_10007635 3300027876 Bacteria 3723
330 Ga0209974_10014336 3300027876 Bacteria 2639
331 Ga0207428_10010508 3300027907 Bacteria 8263
332 Ga0207428_10094791 3300027907 Bacteria 2313
333 Ga0268265_10089751 3300028380 Bacteria 2453
334 Ga0268264_10000613 3300028381 Bacteria 42687
335 Ga0265334_10000096 3300028573 Bacteria 62267
336 Ga0307515_10000011 3300028794 Bacteria 633903
337 Ga0307515_10000084 3300028794 Bacteria 221434
338 Ga0307515_10000609 3300028794 Bacteria 83557
339 Ga0307515_10000655 3300028794 Bacteria 79837
340 Ga0307515_10001484 3300028794 Bacteria 52674
341 Ga0307515_10003487 3300028794 Bacteria 33051
342 Ga0307515_10003934 3300028794 Bacteria 31018
343 Ga0265338_10000508 3300028800 Bacteria 68840
344 Ga0307512_10028186 3300030522 Bacteria 4928
345 Ga0265330_10000022 3300031235 Bacteria 154198
346 Ga0265332_10000001 3300031238 Bacteria 863783
347 Ga0265332_10000027 3300031238 Bacteria 190796
348 Ga0265325_10013308 3300031241 Bacteria 4686
349 Ga0265340_10070722 3300031247 Bacteria 1655
350 Ga0265327_10000320 3300031251 Bacteria 91776
351 Ga0265327_10038392 3300031251 Bacteria 2613
352 Ga0265316_10001401 3300031344 Bacteria 25937
353 Ga0307513_10000008 3300031456 Bacteria 442128
354 Ga0307513_10000038 3300031456 Bacteria 174780
355 Ga0307513_10001264 3300031456 Bacteria 36634
356 Ga0307513_10004316 3300031456 Bacteria 18998
357 Ga0307513_10019870 3300031456 Bacteria 7982
358 Ga0307513_10128755 3300031456 Bacteria 2481
359 Ga0307513_10148746 3300031456 Bacteria 2255
360 Ga0307509_10000991 3300031507 Bacteria 48763
361 Ga0307509_10211024 3300031507 Bacteria 1766
362 Ga0307408_100000109 3300031548 Bacteria 91284
363 Ga0307408_100000557 3300031548 Bacteria 32161
364 Ga0307408_100064350 3300031548 Bacteria 2686
365 Ga0307508_10000404 3300031616 Bacteria 51734
366 Ga0307514_10000319 3300031649 Bacteria 115327
367 Ga0307514_10005041 3300031649 Bacteria 11946
368 Ga0307514_10023099 3300031649 Bacteria 5049
369 Ga0265314_10000013 3300031711 Bacteria 403405
370 Ga0265314_10003012 3300031711 Bacteria 16658
371 Ga0265314_10108281 3300031711 Bacteria 1771
372 Ga0265342_10060092 3300031712 Bacteria 2243
373 Ga0307516_10000359 3300031730 Bacteria 59207
374 Ga0307516_10001752 3300031730 Bacteria 29850
375 Ga0307516_10002915 3300031730 Bacteria 22407
376 Ga0307516_10100905 3300031730 Bacteria 2702
377 Ga0307405_10006874 3300031731 Bacteria 5641
378 Ga0307413_10024068 3300031824 Bacteria 3312
379 Ga0307406_10001107 3300031901 Bacteria 15028
380 Ga0307406_10015826 3300031901 Bacteria 4372
381 Ga0307406_10073558 3300031901 Bacteria 2248
382 Ga0307412_10015454 3300031911 Bacteria 4528
383 Ga0307409_100046747 3300031995 Bacteria 3279
384 Ga0307416_100008243 3300032002 Bacteria 6702
385 Ga0307416_100024936 3300032002 Bacteria 4375
386 Ga0307416_100145284 3300032002 Bacteria 2164
387 Ga0307416_100364648 3300032002 Bacteria 1468
388 Ga0307414_10071274 3300032004 Bacteria 2506
389 Ga0307414_10075730 3300032004 Bacteria 2443
390 Ga0307411_10003755 3300032005 Bacteria 7123
391 Ga0307415_100057436 3300032126 Bacteria 2674
392 Ga0307507_10019265 3300033179 Bacteria 7693
393 Ga0307510_10027525 3300033180 Bacteria 6513
394 Ga0307510_10050339 3300033180 Bacteria 4421
395 Ga0373959_0005891 3300034820 Bacteria 2018
396 Ga0373936_0011796 3300035113 Bacteria 3315
397 Ga0373939_0000040 3300035114 Bacteria 45617
398 Ga0373955_0008168 3300035172 Bacteria 4846
399 Ga0373962_0018808 3300035242 Bacteria 1802
400 Ga0373924_0027059 3300035410 Bacteria 2279
401 Ga0373924_0045376 3300035410 Bacteria 1808
402 Ga0373931_0000637 3300035691 Bacteria 14552
403 Ga0373931_0003037 3300035691 Bacteria 7498
404 Ga0373927_0082941 3300035695 Bacteria 2078
405 Ga0373933_0119107 3300035724 Bacteria 1652
406 Ga0373937_0166663 3300036401 Bacteria 2066
407 Ga0395899_0000019 3300037312 Bacteria 411777
408 Ga0395899_0005445 3300037312 Bacteria 9875
409 Ga0395899_0008661 3300037312 Bacteria 7828
410 Ga0395899_0029333 3300037312 Bacteria 4138
411 Ga0395899_0044080 3300037312 Bacteria 3324
412 Ga0395900_0009652 3300037418 Bacteria 9898
413 Ga0395900_0011923 3300037418 Bacteria 8886
414 Ga0395900_0026531 3300037418 Bacteria 5931
415 Ga0395900_0030030 3300037418 Bacteria 5579
416 Ga0395900_0047478 3300037418 Bacteria 4421
417 Ga0395900_0163159 3300037418 Bacteria 2272
418 Ga0395898_0003251 3300037466 Bacteria 18262
419 Ga0395898_0004158 3300037466 Bacteria 15877
420 Ga0395898_0017821 3300037466 Bacteria 7245
421 Ga0395898_0018204 3300037466 Bacteria 7165
422 Ga0395898_0077854 3300037466 Bacteria 3200
423 Ga0395905_0000027 3300037471 Bacteria 297239
424 Ga0395905_0000544 3300037471 Bacteria 51411
425 Ga0395905_0000728 3300037471 Bacteria 43400
426 Ga0395905_0001260 3300037471 Bacteria 31303
427 Ga0395905_0002893 3300037471 Bacteria 18759
428 Ga0395905_0008745 3300037471 Bacteria 9960
429 Ga0395905_0009131 3300037471 Bacteria 9715
430 Ga0395905_0009245 3300037471 Bacteria 9647
431 Ga0395905_0011447 3300037471 Bacteria 8572
432 Ga0395905_0011947 3300037471 Bacteria 8372
433 Ga0395905_0014556 3300037471 Bacteria 7504
434 Ga0395905_0015718 3300037471 Bacteria 7190
435 Ga0395905_0016376 3300037471 Bacteria 7043
436 Ga0395905_0019544 3300037471 Bacteria 6420
437 Ga0395905_0029854 3300037471 Bacteria 5138
438 Ga0395905_0032757 3300037471 Bacteria 4885
439 Ga0395905_0037055 3300037471 Bacteria 4580
440 Ga0395905_0056222 3300037471 Bacteria 3681
441 Ga0395905_0100997 3300037471 Bacteria 2708
442 Ga0395901_0023253 3300038443 Bacteria 6353
443 Ga0395901_0112076 3300038443 Bacteria 2865
444 Ga0395901_0148480 3300038443 Bacteria 2463
445 Ga0395901_0257828 3300038443 Bacteria 1815
446 Ga0400483_261915 3300039062 Bacteria 8725
447 Ga0436361_0034025 3300039447 Bacteria 3332
448 Ga0436361_0094944 3300039447 Bacteria 20715
449 Ga0436361_0163583 3300039447 Bacteria 173204
450 Ga0436361_0260752 3300039447 Bacteria 7985
451 Ga0436361_0704696 3300039447 Bacteria 13555
452 Ga0439449_0001504 3300042007 Bacteria 9128
453 Ga0450888_000167 3300042126 Bacteria 5667
454 Ga0450890_001430 3300042127 Bacteria 3441
455 Ga0450889_000101 3300042144 Bacteria 8249
456 Ga0439446_0024221 3300042156 Bacteria 1731
457 Ga0439459_0000706 3300042438 Bacteria 4549
458 Ga0450918_000127 3300042531 Bacteria 16320
459 Ga0450893_0004553 3300042532 Bacteria 2208
460 Ga0451577_0000276 3300042876 Bacteria 99531
461 Ga0451577_0003533 3300042876 Bacteria 17291
462 Ga0466969_0002206 3300044656 Bacteria 10412
463 Ga0453683_0005431 3300044673 Bacteria 8894
464 Ga0466966_0015692 3300044684 Bacteria 5008
465 Ga0453684_0000891 3300044712 Bacteria 99637
466 Ga0453684_0005216 3300044712 Bacteria 26063
467 Ga0453684_0070122 3300044712 Bacteria 4440
468 Ga0453684_0287000 3300044712 Bacteria 1875
469 Ga0466959_0006104 3300045049 Bacteria 8320
470 Ga0451576_0000060 3300045051 Bacteria 290345
471 Ga0451576_0002533 3300045051 Bacteria 27062
472 Ga0451576_0010377 3300045051 Bacteria 10695
473 Ga0451576_0012835 3300045051 Bacteria 9398
474 Ga0451576_0039620 3300045051 Bacteria 4987
475 Ga0451576_0464535 3300045051 Bacteria 1329
476 Ga0466958_0021627 3300045836 Bacteria 3762
477 Ga0495592_0000083 3300046454 Bacteria 83092
478 Ga0495590_0010768 3300046457 Bacteria 3427
479 Ga0495653_0058295 3300046463 Bacteria 2936
480 Ga0495650_0000084 3300046471 Bacteria 235690
481 Ga0495580_0005567 3300046472 Bacteria 10387
482 Ga0495580_0073408 3300046472 Bacteria 2389
483 Ga0495639_0002158 3300046475 Bacteria 8677
484 Ga0495596_0000706 3300046500 Bacteria 20710
485 Ga0495607_0020881 3300046501 Bacteria 4129
486 Ga0495607_0025099 3300046501 Bacteria 3711
487 Ga0495606_0000400 3300046507 Bacteria 73341
488 Ga0495606_0000589 3300046507 Bacteria 57638
489 Ga0495606_0007197 3300046507 Bacteria 10037
490 Ga0495606_0009174 3300046507 Bacteria 8412
491 Ga0495608_0059363 3300046511 Bacteria 2520
492 Ga0495632_0002315 3300046519 Bacteria 14654
493 Ga0495648_0006247 3300046524 Bacteria 9747
494 Ga0495597_0000971 3300046542 Bacteria 22161
495 Ga0495645_0001792 3300046543 Bacteria 14572
496 Ga0495625_0003060 3300046660 Bacteria 17136
497 Ga0495588_0013692 3300046674 Bacteria 3867
498 Ga0495599_0059345 3300046678 Bacteria 2393
499 Ga0495658_0033748 3300046683 Bacteria 2805
500 Ga0495669_0012095 3300046684 Bacteria 3668
501 Ga0495649_0007696 3300046694 Bacteria 6543
502 Ga0495589_0002650 3300046794 Bacteria 9906
503 Ga0495672_0000088 3300047320 Bacteria 153860
504 Ga0495672_0000498 3300047320 Bacteria 45426
505 Ga0495687_000488 3300047443 Bacteria 47978
506 Ga0495673_0000008 3300047469 Bacteria 752462
507 Ga0495684_0052037 3300047471 Bacteria 3125
508 Ga0495686_0000212 3300047472 Bacteria 107418
509 Ga0495686_0025387 3300047472 Bacteria 3884
510 Ga0495602_0074167 3300048088 Bacteria 2893
511 Ga0496101_0134722 3300048904 Bacteria 1879
512 Ga0496104_0074314 3300048907 Bacteria 3236
513 Ga0496107_0035065 3300048910 Bacteria 3596
514 Ga0496108_0096965 3300048911 Bacteria 2512
515 Ga0496111_0039234 3300048914 Bacteria 3395
516 Ga0496125_0000713 3300048928 Bacteria 54953
517 Ga0496125_0010319 3300048928 Bacteria 9457
518 Ga0496125_0068323 3300048928 Bacteria 2796
519 Ga0501308_000594 3300049128 Bacteria 2454
520 Ga0495678_001079 3300049459 Bacteria 23033
521 Ga0501297_000470 3300049520 Bacteria 3671
522 Ga0501034_0068665 3300049571 Bacteria 3554
523 Ga0501037_0027545 3300049573 Bacteria 4199
524 Ga0501043_0000057 3300049579 Bacteria 103997
525 Ga0501046_0000075 3300049580 Bacteria 104000
526 Ga0501047_0000081 3300049581 Bacteria 122697
527 Ga0501047_0034488 3300049581 Bacteria 4886
528 Ga0501070_0097823 3300049586 Bacteria 2427
529 Ga0501074_0011169 3300049590 Bacteria 6523
530 Ga0501075_0014457 3300049591 Bacteria 5657
531 Ga0501198_000012 3300049649 Bacteria 113529
532 Ga0501211_000114 3300049658 Bacteria 6126
533 Ga0501222_000010 3300049662 Bacteria 113536
534 Ga0501223_008703 3300049663 Bacteria 2067
535 Ga0501235_001548 3300049669 Bacteria 4933
536 Ga0501080_0013210 3300049742 Bacteria 7586
537 Ga0501262_000894 3300049759 Bacteria 3383
538 Ga0501267_000410 3300049764 Bacteria 3285
539 Ga0501272_000099 3300049769 Bacteria 6631
540 Ga0501280_000536 3300049776 Bacteria 8902
541 Ga0501035_0044005 3300049822 Bacteria 4022
542 nmdc:mga0k408_10252_c1 3300050493 Bacteria 5066
543 nmdc:mga0k408_1156_c1 3300050493 Bacteria 14438
544 nmdc:mga0k408_12380_c1 3300050493 Bacteria 4664
545 nmdc:mga0k408_16379_c2 3300050493 Bacteria 3110
546 nmdc:mga0k408_18395_c1 3300050493 Bacteria 3901
547 nmdc:mga0k408_19625_c1 3300050493 Bacteria 3781
548 nmdc:mga0k408_2396_c2 3300050493 Bacteria 4946
549 nmdc:mga0k408_27194_c1 3300050493 Bacteria 3247
550 nmdc:mga0k408_287_c1 3300050493 Bacteria 27526
551 nmdc:mga0k408_50129_c1 3300050493 Bacteria 2417
552 nmdc:mga0k408_5557_c1 3300050493 Bacteria 6706
553 nmdc:mga0k408_738_c2 3300050493 Bacteria 8845
554 nmdc:mga06z11_32547_c1 3300050494 Bacteria 2544
555 nmdc:mga07m45_16271_c1 3300050496 Bacteria 3981
556 nmdc:mga07m45_30126_c3 3300050496 Bacteria 1611
557 nmdc:mga07m45_3016_c1 3300050496 Bacteria 8023
558 nmdc:mga07m45_57420_c1 3300050496 Bacteria 2201
559 nmdc:mga07m45_6146_c1 3300050496 Bacteria 6055
560 nmdc:mga07m45_77532_c1 3300050496 Bacteria 1896
561 nmdc:mga07m45_824_c1 3300050496 Bacteria 13393
562 nmdc:mga07m45_8869_c1 3300050496 Bacteria 5191
563 nmdc:mga0qj67_21804_c1 3300050509 Bacteria 4914
564 nmdc:mga08x19_10335_c1 3300050514 Bacteria 5603
565 nmdc:mga0sz30_7897_c1 3300050516 Bacteria 4004
566 Ga0495595_0016951 3300053084 Bacteria 3126
567 Ga0495619_0036868 3300053085 Bacteria 3185
568 Ga0500578_0000363 3300053086 Bacteria 55670
569 Ga0500641_0010453 3300053096 Bacteria 3355
570 Ga0500559_0000019 3300053136 Bacteria 134862
571 Ga0500622_0003007 3300053156 Bacteria 11654
572 Ga0500645_001028 3300053730 Bacteria 15622
573 Ga0590071_013562 3300059421 Bacteria 1908
574 Ga0590075_009875 3300059424 Bacteria 2292
575 Ga0587084_000637 3300059477 Bacteria 2906
576 Ga0587084_001346 3300059477 Bacteria 2310
577 Ga0587070_000971 3300059491 Bacteria 2742
578 Ga0587077_000607 3300059493 Bacteria 3233
579 Ga0587077_000886 3300059493 Bacteria 2941
580 Ga0587077_004261 3300059493 Bacteria 1867
581 Ga0587080_002604 3300059503 Bacteria 2145
582 Ga0587090_000538 3300059510 Bacteria 3238
583 Ga0587090_001371 3300059510 Bacteria 2455
584 Ga0587067_003517 3300059640 Bacteria 1966
585 Ga0587075_002533 3300059644 Bacteria 1942
586 Ga0587076_001426 3300059645 Bacteria 2428
587 Ga0587078_000411 3300059646 Bacteria 3153
588 Ga0587079_002927 3300059647 Bacteria 2169
589 Ga0587071_001011 3300060344 Bacteria 3294
590 Ga0587111_0001115 3300060346 Bacteria 3053
591 Ga0587111_0001149 3300060346 Bacteria 3031
592 Ga0587111_0001795 3300060346 Bacteria 2702

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0166663 Ga0373937_0166663_23_1072 310
2 3300053096 Ga0500641_0010453 Ga0500641_0010453_2093_3316 350
3 3300013307 Ga0157372_10004423 Ga0157372_1000442310 351
4 3300025961 Ga0207712_10340970 Ga0207712_103409701 362
5 3300009098 Ga0105245_10049512 Ga0105245_100495124 369
6 3300035724 Ga0373933_0119107 Ga0373933_0119107_27_1256 369
7 3300005328 Ga0070676_10029646 Ga0070676_100296462 370
8 3300005354 Ga0070675_100040468 Ga0070675_1000404682 370
9 3300005364 Ga0070673_100011026 Ga0070673_1000110263 370
10 3300005456 Ga0070678_100007358 Ga0070678_1000073584 370
11 3300005840 Ga0068870_10036066 Ga0068870_100360662 370
12 3300005841 Ga0068863_100022738 Ga0068863_1000227383 370
13 3300006237 Ga0097621_100001917 Ga0097621_1000019175 370
14 3300014326 Ga0157380_10149440 Ga0157380_101494402 370
15 3300032002 Ga0307416_100364648 Ga0307416_1003646481 373
16 3300006051 Ga0075364_10059950 Ga0075364_100599502 374
17 3300006186 Ga0075369_10021842 Ga0075369_100218423 374
18 3300006195 Ga0075366_10014023 Ga0075366_100140239 374
19 3300050493 nmdc:mga0k408_50129_c1 nmdc:mga0k408_50129_c1_318_1631 374
20 3300050516 nmdc:mga0sz30_7897_c1 nmdc:mga0sz30_7897_c1_2480_3793 374
21 3300046472 Ga0495580_0073408 Ga0495580_0073408_846_2111 375
22 3300039447 Ga0436361_0260752 Ga0436361_0260752_3625_4962 376
23 3300005354 Ga0070675_100035528 Ga0070675_1000355286 377
24 3300005441 Ga0070700_100043345 Ga0070700_1000433452 377
25 3300005459 Ga0068867_100011430 Ga0068867_1000114305 377
26 3300005466 Ga0070685_10053663 Ga0070685_100536632 377
27 3300005543 Ga0070672_100054812 Ga0070672_1000548124 377
28 3300005840 Ga0068870_10039650 Ga0068870_100396502 377
29 3300006195 Ga0075366_10020818 Ga0075366_100208182 377
30 3300006881 Ga0068865_100051619 Ga0068865_1000516192 377
31 3300025908 Ga0207643_10015716 Ga0207643_100157164 377
32 3300025926 Ga0207659_10003684 Ga0207659_1000368414 377
33 3300025940 Ga0207691_10010760 Ga0207691_100107602 377
34 3300026075 Ga0207708_10030164 Ga0207708_100301643 377
35 3300026075 Ga0207708_10047600 Ga0207708_100476002 377
36 3300026089 Ga0207648_10018438 Ga0207648_100184383 377
37 3300026121 Ga0207683_10032225 Ga0207683_100322255 377
38 3300039447 Ga0436361_0034025 Ga0436361_0034025_1903_3240 377
39 3300005366 Ga0070659_100051985 Ga0070659_1000519852 378
40 3300005547 Ga0070693_100003345 Ga0070693_1000033458 378
41 3300005548 Ga0070665_100032591 Ga0070665_1000325914 378
42 3300005563 Ga0068855_100042416 Ga0068855_10004241610 378
43 3300005616 Ga0068852_100003754 Ga0068852_10000375410 378
44 3300005616 Ga0068852_100024397 Ga0068852_1000243976 378
45 3300006844 Ga0075428_100030466 Ga0075428_1000304669 378
46 3300007076 Ga0075435_100061728 Ga0075435_1000617282 378
47 3300009094 Ga0111539_10001740 Ga0111539_100017409 378
48 3300009551 Ga0105238_10117685 Ga0105238_101176853 378
49 3300013105 Ga0157369_10029192 Ga0157369_1002919210 378
50 3300026142 Ga0207698_10011836 Ga0207698_100118367 378
51 3300027907 Ga0207428_10010508 Ga0207428_100105089 378
52 3300050514 nmdc:mga08x19_10335_c1 nmdc:mga08x19_10335_c1_1829_3145 378
53 3300025906 Ga0207699_10012699 Ga0207699_100126994 379
54 3300045051 Ga0451576_0000060 Ga0451576_0000060_165925_167163 382
55 3300046683 Ga0495658_0033748 Ga0495658_0033748_313_1581 382
56 3300027462 Ga0210000_1007214 Ga0210000_10072142 383
57 3300005331 Ga0070670_100030450 Ga0070670_1000304505 384
58 3300009093 Ga0105240_10049342 Ga0105240_100493423 384
59 3300009545 Ga0105237_10028275 Ga0105237_100282753 384
60 3300025925 Ga0207650_10009624 Ga0207650_100096245 384
61 3300026041 Ga0207639_10013695 Ga0207639_100136955 384
62 3300025912 Ga0207707_10002239 Ga0207707_100022392 385
63 3300005295 Ga0065707_10029034 Ga0065707_100290342 386
64 3300005547 Ga0070693_100142925 Ga0070693_1001429252 386
65 3300025934 Ga0207686_10018138 Ga0207686_100181381 386
66 3300027378 Ga0209981_1002328 Ga0209981_10023283 386
67 3300027907 Ga0207428_10094791 Ga0207428_100947912 386
68 3300032002 Ga0307416_100145284 Ga0307416_1001452842 386
69 3300035113 Ga0373936_0011796 Ga0373936_0011796_1710_2984 386
70 3300035410 Ga0373924_0027059 Ga0373924_0027059_820_2103 386
71 3300035695 Ga0373927_0082941 Ga0373927_0082941_274_1557 386
72 3300045051 Ga0451576_0039620 Ga0451576_0039620_2419_3702 386
73 3300046472 Ga0495580_0005567 Ga0495580_0005567_3905_5188 386
74 3300048910 Ga0496107_0035065 Ga0496107_0035065_28_1326 386
75 iso_pu_bacteria 2547132103 2547373349 386
76 iso_pu_bacteria 2843690924 2843694860 386
77 3300005458 Ga0070681_10035645 Ga0070681_100356455 388
78 3300005467 Ga0070706_100014985 Ga0070706_1000149859 388
79 3300005468 Ga0070707_100036188 Ga0070707_1000361884 388
80 3300005530 Ga0070679_100284990 Ga0070679_1002849902 388
81 3300005536 Ga0070697_100102024 Ga0070697_1001020243 388
82 3300025910 Ga0207684_10032412 Ga0207684_100324122 388
83 3300025921 Ga0207652_10266755 Ga0207652_102667551 388
84 3300025922 Ga0207646_10050732 Ga0207646_100507323 388
85 3300044712 Ga0453684_0287000 Ga0453684_0287000_316_1605 388
86 3300049573 Ga0501037_0027545 Ga0501037_0027545_1433_2659 389
87 3300049590 Ga0501074_0011169 Ga0501074_0011169_1347_2573 389
88 3300049742 Ga0501080_0013210 Ga0501080_0013210_1951_3177 389
89 3300028573 Ga0265334_10000096 Ga0265334_100000967 390
90 3300049586 Ga0501070_0097823 Ga0501070_0097823_1152_2393 391
91 3300005327 Ga0070658_10050285 Ga0070658_100502853 396
92 3300005563 Ga0068855_100169978 Ga0068855_1001699782 396
93 3300006195 Ga0075366_10065892 Ga0075366_100658922 396
94 3300006237 Ga0097621_100038182 Ga0097621_1000381822 396
95 3300006353 Ga0075370_10100824 Ga0075370_101008241 396
96 3300006358 Ga0068871_100044841 Ga0068871_1000448412 396
97 3300006881 Ga0068865_100018189 Ga0068865_1000181892 396
98 3300009098 Ga0105245_10033877 Ga0105245_100338777 396
99 3300009176 Ga0105242_10102667 Ga0105242_101026673 396
100 3300009176 Ga0105242_10231415 Ga0105242_102314152 396
101 3300009177 Ga0105248_10166687 Ga0105248_101666872 396
102 3300013297 Ga0157378_10063456 Ga0157378_100634563 396
103 3300013306 Ga0163162_10070976 Ga0163162_100709763 396
104 3300013308 Ga0157375_10024841 Ga0157375_100248418 396
105 3300025927 Ga0207687_10034232 Ga0207687_100342326 396
106 3300025936 Ga0207670_10005748 Ga0207670_1000574810 396
107 3300025941 Ga0207711_10011339 Ga0207711_100113396 396
108 3300025949 Ga0207667_10087589 Ga0207667_100875893 396
109 3300035172 Ga0373955_0008168 Ga0373955_0008168_2411_3727 396
110 3300035410 Ga0373924_0045376 Ga0373924_0045376_309_1625 396
111 3300037471 Ga0395905_0009131 Ga0395905_0009131_7276_8592 396
112 3300038443 Ga0395901_0112076 Ga0395901_0112076_699_2015 396
113 3300042156 Ga0439446_0024221 Ga0439446_0024221_59_1372 396
114 3300045836 Ga0466958_0021627 Ga0466958_0021627_40_1356 396
115 3300046463 Ga0495653_0058295 Ga0495653_0058295_1277_2593 396
116 3300046511 Ga0495608_0059363 Ga0495608_0059363_220_1536 396
117 3300046543 Ga0495645_0001792 Ga0495645_0001792_2486_3802 396
118 3300046678 Ga0495599_0059345 Ga0495599_0059345_550_1866 396
119 3300047471 Ga0495684_0052037 Ga0495684_0052037_894_2210 396
120 3300048088 Ga0495602_0074167 Ga0495602_0074167_921_2237 396
121 3300049776 Ga0501280_000536 Ga0501280_000536_6234_7517 396
122 3300050493 nmdc:mga0k408_27194_c1 nmdc:mga0k408_27194_c1_1094_2407 396
123 3300050496 nmdc:mga07m45_30126_c3 nmdc:mga07m45_30126_c3_74_1387 396
124 3300053084 Ga0495595_0016951 Ga0495595_0016951_592_1908 396
125 3300053085 Ga0495619_0036868 Ga0495619_0036868_1751_3067 396
126 3300006844 Ga0075428_100009793 Ga0075428_1000097936 400
127 3300026088 Ga0207641_10064069 Ga0207641_100640693 400
128 3300049591 Ga0501075_0014457 Ga0501075_0014457_2408_3670 400
129 3300027378 Ga0209981_1002116 Ga0209981_10021161 401
130 3300037418 Ga0395900_0163159 Ga0395900_0163159_935_2260 401
131 3300045051 Ga0451576_0464535 Ga0451576_0464535_14_1315 402
132 3300025921 Ga0207652_10016076 Ga0207652_100160762 403
133 3300025273 Ga0209673_1005777 Ga0209673_10057774 407
134 3300044656 Ga0466969_0002206 Ga0466969_0002206_5507_6946 410
135 3300045049 Ga0466959_0006104 Ga0466959_0006104_4785_6224 410
136 3300005544 Ga0070686_100075387 Ga0070686_1000753872 411
137 3300006195 Ga0075366_10078163 Ga0075366_100781632 411
138 3300032004 Ga0307414_10075730 Ga0307414_100757301 411
139 3300037471 Ga0395905_0011947 Ga0395905_0011947_2202_3641 411
140 3300044684 Ga0466966_0015692 Ga0466966_0015692_2451_3890 411
141 3300050493 nmdc:mga0k408_2396_c2 nmdc:mga0k408_2396_c2_3273_4661 411
142 3300005295 Ga0065707_10083392 Ga0065707_100833924 412
143 3300047472 Ga0495686_0000212 Ga0495686_0000212_81873_83276 413
144 3300037471 Ga0395905_0032757 Ga0395905_0032757_2736_4124 416
145 3300039062 Ga0400483_261915 Ga0400483_261915_3755_5149 416
146 3300044712 Ga0453684_0005216 Ga0453684_0005216_4872_6275 417
147 3300005262 Ga0065165_1000080 Ga0065165_100008061 418
148 3300031730 Ga0307516_10002915 Ga0307516_100029159 419
149 3300047320 Ga0495672_0000088 Ga0495672_0000088_45914_47323 419
150 3300047469 Ga0495673_0000008 Ga0495673_0000008_97984_99393 419
151 3300048904 Ga0496101_0134722 Ga0496101_0134722_215_1618 419
152 3300048928 Ga0496125_0000713 Ga0496125_0000713_26639_28042 419
153 3300005334 Ga0068869_100012628 Ga0068869_1000126284 420
154 3300005338 Ga0068868_100003181 Ga0068868_1000031816 420
155 3300005353 Ga0070669_100046001 Ga0070669_1000460012 420
156 3300005354 Ga0070675_100014444 Ga0070675_1000144445 420
157 3300005366 Ga0070659_100060202 Ga0070659_1000602022 420
158 3300005367 Ga0070667_100026749 Ga0070667_1000267494 420
159 3300005457 Ga0070662_100007162 Ga0070662_1000071624 420
160 3300005539 Ga0068853_100030634 Ga0068853_1000306343 420
161 3300005719 Ga0068861_100000694 Ga0068861_1000006945 420
162 3300006028 Ga0070717_10009296 Ga0070717_100092966 420
163 3300006358 Ga0068871_100004794 Ga0068871_1000047943 420
164 3300009551 Ga0105238_10111489 Ga0105238_101114892 420
165 3300013102 Ga0157371_10088006 Ga0157371_100880061 420
166 3300013306 Ga0163162_10012566 Ga0163162_100125666 420
167 3300013307 Ga0157372_10064423 Ga0157372_100644233 420
168 3300014745 Ga0157377_10001539 Ga0157377_100015393 420
169 3300014969 Ga0157376_10006686 Ga0157376_100066866 420
170 3300017792 Ga0163161_10014566 Ga0163161_100145664 420
171 3300025901 Ga0207688_10009652 Ga0207688_100096524 420
172 3300025907 Ga0207645_10019522 Ga0207645_100195223 420
173 3300025923 Ga0207681_10005856 Ga0207681_100058564 420
174 3300025924 Ga0207694_10047253 Ga0207694_100472533 420
175 3300025926 Ga0207659_10012392 Ga0207659_100123924 420
176 3300025932 Ga0207690_10059207 Ga0207690_100592073 420
177 3300025933 Ga0207706_10007947 Ga0207706_100079474 420
178 3300025945 Ga0207679_10119382 Ga0207679_101193822 420
179 3300025981 Ga0207640_10030610 Ga0207640_100306103 420
180 3300026023 Ga0207677_10016673 Ga0207677_100166732 420
181 3300026041 Ga0207639_10009019 Ga0207639_100090193 420
182 3300026088 Ga0207641_10111650 Ga0207641_101116502 420
183 3300026095 Ga0207676_10102551 Ga0207676_101025512 420
184 3300026116 Ga0207674_10061556 Ga0207674_100615562 420
185 3300026142 Ga0207698_10004036 Ga0207698_100040366 420
186 3300032002 Ga0307416_100008243 Ga0307416_1000082432 420
187 3300035242 Ga0373962_0018808 Ga0373962_0018808_130_1530 420
188 3300035691 Ga0373931_0003037 Ga0373931_0003037_5053_6453 420
189 3300037312 Ga0395899_0029333 Ga0395899_0029333_620_2023 420
190 3300046457 Ga0495590_0010768 Ga0495590_0010768_604_2013 420
191 3300046471 Ga0495650_0000084 Ga0495650_0000084_144055_145464 420
192 3300046500 Ga0495596_0000706 Ga0495596_0000706_3305_4714 420
193 3300046501 Ga0495607_0020881 Ga0495607_0020881_2485_3894 420
194 3300046507 Ga0495606_0000400 Ga0495606_0000400_67082_68491 420
195 3300046524 Ga0495648_0006247 Ga0495648_0006247_1151_2560 420
196 3300046542 Ga0495597_0000971 Ga0495597_0000971_772_2181 420
197 3300046794 Ga0495589_0002650 Ga0495589_0002650_1334_2743 420
198 3300047320 Ga0495672_0000498 Ga0495672_0000498_29049_30458 420
199 3300047443 Ga0495687_000488 Ga0495687_000488_26648_28057 420
200 3300047472 Ga0495686_0025387 Ga0495686_0025387_2060_3469 420
201 3300048911 Ga0496108_0096965 Ga0496108_0096965_1026_2426 420
202 3300048914 Ga0496111_0039234 Ga0496111_0039234_1035_2444 420
203 3300049459 Ga0495678_001079 Ga0495678_001079_20198_21607 420
204 3300005844 Ga0068862_100041306 Ga0068862_1000413062 421
205 3300017792 Ga0163161_10184612 Ga0163161_101846122 421
206 3300046694 Ga0495649_0007696 Ga0495649_0007696_1331_2731 421
207 3300037312 Ga0395899_0000019 Ga0395899_0000019_155921_157336 422
208 3300037466 Ga0395898_0077854 Ga0395898_0077854_1470_2885 422
209 3300037471 Ga0395905_0011447 Ga0395905_0011447_5779_7164 422
210 3300037471 Ga0395905_0056222 Ga0395905_0056222_72_1487 422
211 3300038443 Ga0395901_0257828 Ga0395901_0257828_12_1427 422
212 3300046501 Ga0495607_0025099 Ga0495607_0025099_1908_3317 422
213 3300046507 Ga0495606_0000589 Ga0495606_0000589_45619_47031 422
214 3300046674 Ga0495588_0013692 Ga0495588_0013692_1433_2848 422
215 3300046684 Ga0495669_0012095 Ga0495669_0012095_1330_2745 422
216 3300050493 nmdc:mga0k408_5557_c1 nmdc:mga0k408_5557_c1_1526_2926 423
217 3300059503 Ga0587080_002604 Ga0587080_002604_138_1541 423
218 3300059640 Ga0587067_003517 Ga0587067_003517_428_1831 423
219 3300059644 Ga0587075_002533 Ga0587075_002533_383_1786 423
220 3300003794 Ga0055531_10000261 Ga0055531_100002611 424
221 3300005339 Ga0070660_100001068 Ga0070660_10000106815 424
222 3300005344 Ga0070661_100005897 Ga0070661_1000058974 424
223 3300005366 Ga0070659_100005068 Ga0070659_1000050689 424
224 3300025919 Ga0207657_10022456 Ga0207657_100224564 424
225 3300025932 Ga0207690_10001407 Ga0207690_1000140716 424
226 3300025933 Ga0207706_10084841 Ga0207706_100848413 424
227 3300037312 Ga0395899_0044080 Ga0395899_0044080_710_2113 424
228 3300037418 Ga0395900_0009652 Ga0395900_0009652_8108_9511 424
229 3300037466 Ga0395898_0003251 Ga0395898_0003251_523_1926 424
230 3300046475 Ga0495639_0002158 Ga0495639_0002158_4999_6432 424
231 3300059647 Ga0587079_002927 Ga0587079_002927_138_1541 424
232 iso_pu_bacteria 2513237166 2514050823 424
233 iso_pu_bacteria 2818991450 2819624242 424
234 iso_pu_bacteria 2900634093 2900637151 424
235 iso_pu_bacteria 2904564687 2904569415 424
236 iso_pu_bacteria 2904571731 2904576748 424
237 iso_pu_bacteria 2928108538 2928114132 424
238 iso_pu_bacteria 2928135762 2928141120 424
239 iso_pu_bacteria 2928503688 2928509127 424
240 iso_pu_bacteria 2928536128 2928542092 424
241 iso_pu_bacteria 642555113 642623123 424
242 iso_pu_bacteria 8055225921 8055228439 424
243 iso_pu_bacteria 8055266321 8055269505 424
244 3300006195 Ga0075366_10009338 Ga0075366_100093383 425
245 3300050493 nmdc:mga0k408_19625_c1 nmdc:mga0k408_19625_c1_519_1922 425
246 iso_pu_bacteria 2515154189 2516023316 425
247 3300006038 Ga0075365_10004820 Ga0075365_100048206 426
248 3300031548 Ga0307408_100000109 Ga0307408_10000010939 426
249 3300037466 Ga0395898_0017821 Ga0395898_0017821_5453_6883 426
250 3300038443 Ga0395901_0023253 Ga0395901_0023253_1092_2522 426
251 3300042126 Ga0450888_000167 Ga0450888_000167_3930_5336 426
252 3300042127 Ga0450890_001430 Ga0450890_001430_1507_2913 426
253 3300042144 Ga0450889_000101 Ga0450889_000101_2011_3417 426
254 3300042532 Ga0450893_0004553 Ga0450893_0004553_471_1877 426
255 3300050493 nmdc:mga0k408_16379_c2 nmdc:mga0k408_16379_c2_25_1425 426
256 iso_pu_bacteria 2515154123 2515690866 426
257 iso_pu_bacteria 2515154189 2516022302 426
258 iso_pu_bacteria 2857542790 2857543380 426
259 iso_pu_bacteria 2883087390 2883091365 426
260 3300005367 Ga0070667_100008422 Ga0070667_1000084222 428
261 3300006195 Ga0075366_10089416 Ga0075366_100894161 428
262 3300028800 Ga0265338_10000508 Ga0265338_1000050813 428
263 3300031251 Ga0265327_10038392 Ga0265327_100383922 428
264 3300031456 Ga0307513_10001264 Ga0307513_1000126421 428
265 3300033180 Ga0307510_10050339 Ga0307510_100503392 428
266 3300046660 Ga0495625_0003060 Ga0495625_0003060_281_1660 428
267 3300005344 Ga0070661_100033267 Ga0070661_1000332672 429
268 3300027614 Ga0209970_1000036 Ga0209970_100003619 429
269 3300027876 Ga0209974_10014336 Ga0209974_100143362 429
270 3300031238 Ga0265332_10000027 Ga0265332_10000027168 429
271 3300031995 Ga0307409_100046747 Ga0307409_1000467472 429
272 3300042876 Ga0451577_0003533 Ga0451577_0003533_5770_7170 429
273 3300044673 Ga0453683_0005431 Ga0453683_0005431_1807_3207 429
274 3300044712 Ga0453684_0070122 Ga0453684_0070122_1677_3077 429
275 3300045051 Ga0451576_0010377 Ga0451576_0010377_312_1712 429
276 3300049520 Ga0501297_000470 Ga0501297_000470_1060_2466 429
277 3300049658 Ga0501211_000114 Ga0501211_000114_3776_5182 429
278 3300049663 Ga0501223_008703 Ga0501223_008703_219_1625 429
279 3300049669 Ga0501235_001548 Ga0501235_001548_2449_3855 429
280 3300049759 Ga0501262_000894 Ga0501262_000894_1471_2877 429
281 3300049764 Ga0501267_000410 Ga0501267_000410_1372_2778 429
282 3300049769 Ga0501272_000099 Ga0501272_000099_1156_2562 429
283 iso_pu_bacteria 2734482258 2735817906 429
284 3300003775 Ga0055524_1000013 Ga0055524_1000013250 430
285 3300003791 Ga0055530_10001804 Ga0055530_1000180413 430
286 3300003791 Ga0055530_10015037 Ga0055530_100150371 430
287 3300003792 Ga0055540_1000001 Ga0055540_100000111 430
288 3300003792 Ga0055540_1000037 Ga0055540_100003772 430
289 3300003794 Ga0055531_10023264 Ga0055531_100232641 430
290 3300005295 Ga0065707_10149697 Ga0065707_101496972 430
291 3300005445 Ga0070708_100114460 Ga0070708_1001144603 430
292 3300005467 Ga0070706_100000463 Ga0070706_10000046321 430
293 3300006178 Ga0075367_10023144 Ga0075367_100231444 430
294 3300006195 Ga0075366_10001536 Ga0075366_100015363 430
295 3300006353 Ga0075370_10022105 Ga0075370_100221053 430
296 3300025263 Ga0209565_1004707 Ga0209565_10047074 430
297 3300025284 Ga0209130_1001611 Ga0209130_100161114 430
298 3300025291 Ga0209675_1009287 Ga0209675_10092873 430
299 3300025292 Ga0209676_1000023 Ga0209676_1000023341 430
300 3300025298 Ga0209050_1000022 Ga0209050_1000022323 430
301 3300025298 Ga0209050_1000730 Ga0209050_100073054 430
302 3300025299 Ga0209256_1000061 Ga0209256_1000061252 430
303 3300025302 Ga0207426_1013921 Ga0207426_10139212 430
304 3300025303 Ga0209051_1000013 Ga0209051_1000013323 430
305 3300025303 Ga0209051_1000018 Ga0209051_1000018439 430
306 3300025304 Ga0209257_1000042 Ga0209257_1000042164 430
307 3300025304 Ga0209257_1000461 Ga0209257_100046112 430
308 3300025910 Ga0207684_10003939 Ga0207684_1000393911 430
309 3300031507 Ga0307509_10211024 Ga0307509_102110242 430
310 3300031901 Ga0307406_10015826 Ga0307406_100158264 430
311 3300031901 Ga0307406_10073558 Ga0307406_100735582 430
312 3300037418 Ga0395900_0011923 Ga0395900_0011923_2132_3562 430
313 3300037471 Ga0395905_0014556 Ga0395905_0014556_1283_2713 430
314 3300045051 Ga0451576_0012835 Ga0451576_0012835_2679_4085 430
315 3300046519 Ga0495632_0002315 Ga0495632_0002315_11804_13204 430
316 3300050493 nmdc:mga0k408_1156_c1 nmdc:mga0k408_1156_c1_11730_13133 430
317 iso_pu_bacteria 2501025502 2501084045 430
318 iso_pu_bacteria 2510917013 2511093400 430
319 iso_pu_bacteria 2513237082 2513556073 430
320 iso_pu_bacteria 2513237083 2513564259 430
321 iso_pu_bacteria 2643221603 2644027032 430
322 iso_pu_bacteria 8003955200 8003956751 430
323 3300002704 JGI25155J39150_1000022 JGI25155J39150_1000022110 431
324 3300002705 JGI25156J39149_1000005 JGI25156J39149_1000005102 431
325 3300002738 JGI25154J39366_1000017 JGI25154J39366_100001794 431
326 3300002741 JGI25157J39369_1000003 JGI25157J39369_1000003110 431
327 3300003354 JGI25160J50197_1000273 JGI25160J50197_100027339 431
328 3300003374 JGI25161J50226_1000095 JGI25161J50226_100009549 431
329 3300004625 Ga0055543_1000218 Ga0055543_100021847 431
330 3300006058 Ga0075432_10002101 Ga0075432_100021016 431
331 3300006195 Ga0075366_10005340 Ga0075366_100053405 431
332 3300006195 Ga0075366_10100929 Ga0075366_101009292 431
333 3300006880 Ga0075429_100126991 Ga0075429_1001269912 431
334 3300006946 Ga0079104_1000070 Ga0079104_100007046 431
335 3300009177 Ga0105248_10019961 Ga0105248_100199615 431
336 3300025206 Ga0209435_100002 Ga0209435_100002218 431
337 3300025245 Ga0207425_1003670 Ga0207425_10036701 431
338 3300025246 Ga0209646_1000001 Ga0209646_10000012361 431
339 3300025250 Ga0209026_1000001 Ga0209026_10000011018 431
340 3300025256 Ga0209759_1000001 Ga0209759_10000011992 431
341 3300025263 Ga0209565_1000574 Ga0209565_10005742 431
342 3300025284 Ga0209130_1000072 Ga0209130_100007253 431
343 3300025291 Ga0209675_1009484 Ga0209675_10094843 431
344 3300025294 Ga0209025_1014674 Ga0209025_10146742 431
345 3300025297 Ga0209758_1033741 Ga0209758_10337412 431
346 3300025302 Ga0207426_1000319 Ga0207426_100031947 431
347 3300025941 Ga0207711_10032072 Ga0207711_100320724 431
348 3300027111 Ga0209281_1000103 Ga0209281_100010346 431
349 3300028794 Ga0307515_10000084 Ga0307515_10000084154 431
350 3300030522 Ga0307512_10028186 Ga0307512_100281862 431
351 3300031456 Ga0307513_10148746 Ga0307513_101487462 431
352 3300031649 Ga0307514_10000319 Ga0307514_100003198 431
353 3300050493 nmdc:mga0k408_738_c2 nmdc:mga0k408_738_c2_3421_4830 431
354 3300053730 Ga0500645_001028 Ga0500645_001028_13404_14813 431
355 iso_pu_bacteria 2511231026 2511385596 431
356 iso_pu_bacteria 2521172590 2521560050 431
357 iso_pu_bacteria 2551306416 2553008080 431
358 iso_pu_bacteria 2818991449 2819616413 431
359 iso_pu_bacteria 2904439833 2904440916 431
360 iso_pu_bacteria 2904530477 2904535518 431
361 iso_pu_bacteria 2904584206 2904588341 431
362 iso_pu_bacteria 2904589729 2904594771 431
363 iso_pu_bacteria 2904601388 2904606034 431
364 iso_pu_bacteria 2919046199 2919049083 431
365 iso_pu_bacteria 2919079590 2919084692 431
366 iso_pu_bacteria 2919704043 2919707110 431
367 iso_pu_bacteria 2923510766 2923513781 431
368 iso_pu_bacteria 2939631187 2939635073 431
369 3300014326 Ga0157380_10010044 Ga0157380_100100445 432
370 3300031235 Ga0265330_10000022 Ga0265330_1000002233 432
371 3300031238 Ga0265332_10000001 Ga0265332_10000001542 432
372 3300031241 Ga0265325_10013308 Ga0265325_100133084 432
373 3300031247 Ga0265340_10070722 Ga0265340_100707222 432
374 3300031548 Ga0307408_100000557 Ga0307408_10000055721 432
375 3300031711 Ga0265314_10000013 Ga0265314_10000013275 432
376 3300031901 Ga0307406_10001107 Ga0307406_1000110717 432
377 3300037471 Ga0395905_0001260 Ga0395905_0001260_3292_4695 432
378 3300050493 nmdc:mga0k408_18395_c1 nmdc:mga0k408_18395_c1_1451_2854 432
379 iso_pu_bacteria 2511231002 2511244642 432
380 iso_pu_bacteria 2585428062 2587754201 432
381 iso_pu_bacteria 2643221544 2643743758 432
382 iso_pu_bacteria 2643221585 2643936490 432
383 iso_pu_bacteria 2643221639 2644222326 432
384 iso_pu_bacteria 2643221644 2644247030 432
385 iso_pu_bacteria 2643221646 2644256339 432
386 iso_pu_bacteria 2643221654 2644301379 432
387 iso_pu_bacteria 2643221656 2644317846 432
388 iso_pu_bacteria 2643221660 2644341092 432
389 iso_pu_bacteria 2738541337 2739058421 432
390 iso_pu_bacteria 2881101125 2881103422 432
391 3300002773 JGI25152J39213_1000900 JGI25152J39213_10009002 433
392 3300002774 JGI25150J39212_1003423 JGI25150J39212_10034234 433
393 3300003215 JGI25153J46596_10004541 JGI25153J46596_100045415 433
394 3300003751 Ga0055538_1000038 Ga0055538_1000038134 433
395 3300003752 Ga0055539_1000049 Ga0055539_1000049134 433
396 3300003756 Ga0055533_1000060 Ga0055533_1000060134 433
397 3300003759 Ga0055525_1000068 Ga0055525_100006861 433
398 3300003771 Ga0055526_1011045 Ga0055526_10110454 433
399 3300003773 Ga0055537_1000205 Ga0055537_100020514 433
400 3300003775 Ga0055524_1000073 Ga0055524_100007360 433
401 3300003784 Ga0055534_1000363 Ga0055534_10003637 433
402 3300003790 Ga0055528_1000289 Ga0055528_100028935 433
403 3300003841 Ga0055541_1000036 Ga0055541_100003661 433
404 3300010375 Ga0105239_10189383 Ga0105239_101893832 433
405 3300021361 Ga0213872_10002128 Ga0213872_100021286 433
406 3300025224 Ga0209784_100021 Ga0209784_100021234 433
407 3300025225 Ga0209566_100039 Ga0209566_100039235 433
408 3300025226 Ga0209674_100036 Ga0209674_100036234 433
409 3300025230 Ga0209563_100040 Ga0209563_100040234 433
410 3300025245 Ga0207425_1000691 Ga0207425_10006915 433
411 3300025253 Ga0209677_100023 Ga0209677_100023234 433
412 3300025258 Ga0209129_1000027 Ga0209129_1000027126 433
413 3300025263 Ga0209565_1000128 Ga0209565_100012870 433
414 3300025273 Ga0209673_1000008 Ga0209673_100000893 433
415 3300025291 Ga0209675_1000099 Ga0209675_10000993 433
416 3300025295 Ga0209564_1000139 Ga0209564_1000139117 433
417 3300025297 Ga0209758_1000310 Ga0209758_100031088 433
418 3300025299 Ga0209256_1000001 Ga0209256_10000011809 433
419 3300025942 Ga0207689_10074760 Ga0207689_100747603 433
420 3300031456 Ga0307513_10000008 Ga0307513_100000089 433
421 3300031711 Ga0265314_10003012 Ga0265314_100030122 433
422 3300037418 Ga0395900_0030030 Ga0395900_0030030_2387_3790 433
423 3300037471 Ga0395905_0002893 Ga0395905_0002893_263_1666 433
424 3300037471 Ga0395905_0008745 Ga0395905_0008745_6460_7863 433
425 3300039447 Ga0436361_0704696 Ga0436361_0704696_2011_3417 433
426 3300042531 Ga0450918_000127 Ga0450918_000127_7543_8943 433
427 3300046507 Ga0495606_0007197 Ga0495606_0007197_6674_8080 433
428 3300050496 nmdc:mga07m45_824_c1 nmdc:mga07m45_824_c1_766_2172 433
429 3300059477 Ga0587084_000637 Ga0587084_000637_717_2120 433
430 3300059477 Ga0587084_001346 Ga0587084_001346_646_2049 433
431 3300059491 Ga0587070_000971 Ga0587070_000971_700_2103 433
432 3300059493 Ga0587077_000607 Ga0587077_000607_620_2023 433
433 3300059493 Ga0587077_000886 Ga0587077_000886_1232_2635 433
434 3300059493 Ga0587077_004261 Ga0587077_004261_272_1675 433
435 3300059510 Ga0587090_000538 Ga0587090_000538_1133_2536 433
436 3300059510 Ga0587090_001371 Ga0587090_001371_646_2049 433
437 3300059645 Ga0587076_001426 Ga0587076_001426_679_2082 433
438 3300059646 Ga0587078_000411 Ga0587078_000411_556_1959 433
439 3300060344 Ga0587071_001011 Ga0587071_001011_646_2049 433
440 3300060346 Ga0587111_0001115 Ga0587111_0001115_1005_2408 433
441 3300060346 Ga0587111_0001149 Ga0587111_0001149_1273_2676 433
442 3300060346 Ga0587111_0001795 Ga0587111_0001795_639_2042 433
443 iso_pu_bacteria 2547132374 2548499054 433
444 iso_pu_bacteria 2643221570 2643867741 433
445 iso_pu_bacteria 2643221596 2643991604 433
446 iso_pu_bacteria 2643221609 2644062225 433
447 iso_pu_bacteria 2643221611 2644071413 433
448 iso_pu_bacteria 2643221652 2644293350 433
449 iso_pu_bacteria 2643221717 2644648511 433
450 iso_pu_bacteria 2721755523 2722881960 433
451 iso_pu_bacteria 2738541357 2739150397 433
452 iso_pu_bacteria 2738543003 2739192316 433
453 iso_pu_bacteria 2738543012 2739245836 433
454 iso_pu_bacteria 2738543026 2739318793 433
455 iso_pu_bacteria 2738543029 2739337034 433
456 iso_pu_bacteria 2816332133 2816470530 433
457 iso_pu_bacteria 2839138175 2839141853 433
458 iso_pu_bacteria 2919476304 2919476787 433
459 iso_pu_bacteria 2932422444 2932424016 433
460 iso_pu_bacteria 2990710928 2990713950 433
461 3300005844 Ga0068862_100111189 Ga0068862_1001111892 434
462 3300028380 Ga0268265_10089751 Ga0268265_100897512 434
463 3300031456 Ga0307513_10000038 Ga0307513_10000038147 434
464 3300031548 Ga0307408_100064350 Ga0307408_1000643503 434
465 3300037471 Ga0395905_0016376 Ga0395905_0016376_728_2134 434
466 3300048907 Ga0496104_0074314 Ga0496104_0074314_371_1774 434
467 iso_pu_bacteria 2643221684 2644474552 434
468 iso_pu_bacteria 2842718218 2842718694 434
469 iso_pu_bacteria 2857553236 2857556443 434
470 iso_pu_bacteria 2857564685 2857567829 434
471 iso_pu_bacteria 8047673197 8047676268 434
472 3300005328 Ga0070676_10107330 Ga0070676_101073302 435
473 3300005334 Ga0068869_100134325 Ga0068869_1001343252 435
474 3300005335 Ga0070666_10005194 Ga0070666_100051946 435
475 3300005347 Ga0070668_100026664 Ga0070668_1000266642 435
476 3300005354 Ga0070675_100007798 Ga0070675_1000077984 435
477 3300005355 Ga0070671_100003392 Ga0070671_1000033926 435
478 3300005367 Ga0070667_100064801 Ga0070667_1000648013 435
479 3300005456 Ga0070678_100012914 Ga0070678_1000129142 435
480 3300005459 Ga0068867_100065911 Ga0068867_1000659111 435
481 3300005617 Ga0068859_100023273 Ga0068859_1000232734 435
482 3300005617 Ga0068859_100061816 Ga0068859_1000618164 435
483 3300005618 Ga0068864_100002065 Ga0068864_1000020653 435
484 3300005719 Ga0068861_100002250 Ga0068861_1000022507 435
485 3300005841 Ga0068863_100019244 Ga0068863_1000192444 435
486 3300005842 Ga0068858_100008614 Ga0068858_1000086147 435
487 3300005843 Ga0068860_100000823 Ga0068860_10000082332 435
488 3300006051 Ga0075364_10001078 Ga0075364_1000107816 435
489 3300006195 Ga0075366_10002629 Ga0075366_100026293 435
490 3300006237 Ga0097621_100030577 Ga0097621_1000305773 435
491 3300006931 Ga0097620_100023272 Ga0097620_1000232724 435
492 3300006931 Ga0097620_100061816 Ga0097620_1000618164 435
493 3300009148 Ga0105243_10081100 Ga0105243_100811002 435
494 3300009553 Ga0105249_10054347 Ga0105249_100543472 435
495 3300013297 Ga0157378_10001703 Ga0157378_100017037 435
496 3300013306 Ga0163162_10066510 Ga0163162_100665104 435
497 3300013306 Ga0163162_10333169 Ga0163162_103331691 435
498 3300013308 Ga0157375_10134369 Ga0157375_101343692 435
499 3300014325 Ga0163163_10035273 Ga0163163_100352734 435
500 3300025903 Ga0207680_10002711 Ga0207680_100027114 435
501 3300025907 Ga0207645_10097305 Ga0207645_100973052 435
502 3300025923 Ga0207681_10018545 Ga0207681_100185454 435
503 3300025925 Ga0207650_10032150 Ga0207650_100321504 435
504 3300025926 Ga0207659_10002170 Ga0207659_100021707 435
505 3300025931 Ga0207644_10002319 Ga0207644_100023196 435
506 3300025935 Ga0207709_10029590 Ga0207709_100295903 435
507 3300025936 Ga0207670_10033210 Ga0207670_100332104 435
508 3300025941 Ga0207711_10019236 Ga0207711_100192364 435
509 3300025961 Ga0207712_10034996 Ga0207712_100349964 435
510 3300026035 Ga0207703_10006064 Ga0207703_100060645 435
511 3300026088 Ga0207641_10019502 Ga0207641_100195023 435
512 3300026089 Ga0207648_10000179 Ga0207648_1000017942 435
513 3300026095 Ga0207676_10018678 Ga0207676_100186783 435
514 3300026118 Ga0207675_100002243 Ga0207675_10000224314 435
515 3300026121 Ga0207683_10031145 Ga0207683_100311451 435
516 3300028381 Ga0268264_10000613 Ga0268264_1000061327 435
517 3300031456 Ga0307513_10128755 Ga0307513_101287552 435
518 3300037312 Ga0395899_0005445 Ga0395899_0005445_8242_9672 435
519 3300037312 Ga0395899_0008661 Ga0395899_0008661_1430_2839 435
520 3300037418 Ga0395900_0026531 Ga0395900_0026531_2046_3476 435
521 3300037418 Ga0395900_0047478 Ga0395900_0047478_636_2045 435
522 3300037466 Ga0395898_0004158 Ga0395898_0004158_12955_14385 435
523 3300037466 Ga0395898_0018204 Ga0395898_0018204_5526_6935 435
524 3300037471 Ga0395905_0000027 Ga0395905_0000027_138349_139779 435
525 3300037471 Ga0395905_0000544 Ga0395905_0000544_24984_26414 435
526 3300037471 Ga0395905_0019544 Ga0395905_0019544_2463_3875 435
527 3300037471 Ga0395905_0029854 Ga0395905_0029854_2861_4291 435
528 3300037471 Ga0395905_0037055 Ga0395905_0037055_2132_3562 435
529 3300037471 Ga0395905_0100997 Ga0395905_0100997_1138_2568 435
530 3300038443 Ga0395901_0148480 Ga0395901_0148480_320_1729 435
531 3300042007 Ga0439449_0001504 Ga0439449_0001504_2930_4336 435
532 3300042876 Ga0451577_0000276 Ga0451577_0000276_54621_56024 435
533 3300044712 Ga0453684_0000891 Ga0453684_0000891_43475_44878 435
534 3300045051 Ga0451576_0002533 Ga0451576_0002533_11432_12835 435
535 3300048928 Ga0496125_0068323 Ga0496125_0068323_649_2052 435
536 3300049128 Ga0501308_000594 Ga0501308_000594_897_2300 435
537 3300049571 Ga0501034_0068665 Ga0501034_0068665_180_1610 435
538 3300049579 Ga0501043_0000057 Ga0501043_0000057_71625_73025 435
539 3300049580 Ga0501046_0000075 Ga0501046_0000075_71625_73025 435
540 3300049581 Ga0501047_0000081 Ga0501047_0000081_71625_73025 435
541 3300049581 Ga0501047_0034488 Ga0501047_0034488_1479_2909 435
542 3300049822 Ga0501035_0044005 Ga0501035_0044005_1412_2842 435
543 3300050509 nmdc:mga0qj67_21804_c1 nmdc:mga0qj67_21804_c1_1660_3060 435
544 3300053086 Ga0500578_0000363 Ga0500578_0000363_5755_7155 435
545 iso_pu_bacteria 2894023352 2894024307 435
546 3300001979 JGI24740J21852_10002472 JGI24740J21852_100024728 436
547 3300003215 JGI25153J46596_10002128 JGI25153J46596_100021288 436
548 3300003775 Ga0055524_1002736 Ga0055524_10027367 436
549 3300003791 Ga0055530_10015857 Ga0055530_100158572 436
550 3300003794 Ga0055531_10000257 Ga0055531_1000025742 436
551 3300003794 Ga0055531_10015203 Ga0055531_100152033 436
552 3300005289 Ga0065704_10072859 Ga0065704_100728598 436
553 3300005290 Ga0065712_10094921 Ga0065712_100949212 436
554 3300005330 Ga0070690_100050185 Ga0070690_1000501853 436
555 3300005331 Ga0070670_100008472 Ga0070670_1000084724 436
556 3300005338 Ga0068868_100008545 Ga0068868_1000085456 436
557 3300005344 Ga0070661_100000809 Ga0070661_10000080917 436
558 3300005353 Ga0070669_100018739 Ga0070669_1000187393 436
559 3300005354 Ga0070675_100005641 Ga0070675_1000056415 436
560 3300005366 Ga0070659_100000649 Ga0070659_1000006498 436
561 3300005455 Ga0070663_100000477 Ga0070663_10000047710 436
562 3300005455 Ga0070663_100087827 Ga0070663_1000878272 436
563 3300005459 Ga0068867_100000081 Ga0068867_10000008120 436
564 3300005459 Ga0068867_100001379 Ga0068867_1000013796 436
565 3300005530 Ga0070679_100018152 Ga0070679_1000181524 436
566 3300005543 Ga0070672_100000327 Ga0070672_10000032720 436
567 3300005563 Ga0068855_100058788 Ga0068855_1000587884 436
568 3300005564 Ga0070664_100001243 Ga0070664_10000124317 436
569 3300005617 Ga0068859_100044728 Ga0068859_1000447284 436
570 3300005618 Ga0068864_100019420 Ga0068864_1000194204 436
571 3300006186 Ga0075369_10016987 Ga0075369_100169873 436
572 3300006195 Ga0075366_10015652 Ga0075366_100156522 436
573 3300006353 Ga0075370_10003930 Ga0075370_100039304 436
574 3300006353 Ga0075370_10034699 Ga0075370_100346991 436
575 3300006353 Ga0075370_10043922 Ga0075370_100439222 436
576 3300006358 Ga0068871_100009237 Ga0068871_1000092374 436
577 3300006931 Ga0097620_100044728 Ga0097620_1000447282 436
578 3300006946 Ga0079104_1000055 Ga0079104_100005516 436
579 3300009093 Ga0105240_10008945 Ga0105240_1000894518 436
580 3300009098 Ga0105245_10033383 Ga0105245_100333831 436
581 3300009148 Ga0105243_10007445 Ga0105243_100074456 436
582 3300009545 Ga0105237_10028578 Ga0105237_100285783 436
583 3300012497 Ga0157319_1000003 Ga0157319_1000003173 436
584 3300014745 Ga0157377_10000048 Ga0157377_1000004877 436
585 3300021361 Ga0213872_10000007 Ga0213872_10000007124 436
586 3300021361 Ga0213872_10000313 Ga0213872_1000031323 436
587 3300025273 Ga0209673_1005215 Ga0209673_10052156 436
588 3300025297 Ga0209758_1000281 Ga0209758_10002818 436
589 3300025303 Ga0209051_1000025 Ga0209051_100002516 436
590 3300025304 Ga0209257_1000039 Ga0209257_1000039592 436
591 3300025304 Ga0209257_1000047 Ga0209257_100004753 436
592 3300025893 Ga0207682_10020532 Ga0207682_100205323 436
593 3300025913 Ga0207695_10171046 Ga0207695_101710462 436
594 3300025920 Ga0207649_10000774 Ga0207649_1000077417 436
595 3300025921 Ga0207652_10188737 Ga0207652_101887372 436
596 3300025925 Ga0207650_10000149 Ga0207650_1000014973 436
597 3300025926 Ga0207659_10000394 Ga0207659_100003945 436
598 3300025931 Ga0207644_10125541 Ga0207644_101255412 436
599 3300025935 Ga0207709_10000111 Ga0207709_1000011165 436
600 3300025935 Ga0207709_10001074 Ga0207709_100010744 436
601 3300025937 Ga0207669_10000874 Ga0207669_1000087416 436
602 3300025940 Ga0207691_10001736 Ga0207691_1000173614 436
603 3300025945 Ga0207679_10000325 Ga0207679_1000032517 436
604 3300026067 Ga0207678_10002065 Ga0207678_100020657 436
605 3300026067 Ga0207678_10125670 Ga0207678_101256702 436
606 3300026089 Ga0207648_10107784 Ga0207648_101077841 436
607 3300026095 Ga0207676_10008819 Ga0207676_100088194 436
608 3300026116 Ga0207674_10084059 Ga0207674_100840592 436
609 3300027111 Ga0209281_1000007 Ga0209281_1000007813 436
610 3300027682 Ga0209971_1001090 Ga0209971_10010908 436
611 3300027866 Ga0209813_10021589 Ga0209813_100215892 436
612 3300027876 Ga0209974_10007635 Ga0209974_100076352 436
613 3300028794 Ga0307515_10000011 Ga0307515_10000011379 436
614 3300028794 Ga0307515_10000609 Ga0307515_1000060916 436
615 3300028794 Ga0307515_10000655 Ga0307515_1000065574 436
616 3300028794 Ga0307515_10001484 Ga0307515_1000148428 436
617 3300028794 Ga0307515_10003487 Ga0307515_1000348717 436
618 3300028794 Ga0307515_10003934 Ga0307515_1000393422 436
619 3300031251 Ga0265327_10000320 Ga0265327_1000032085 436
620 3300031344 Ga0265316_10001401 Ga0265316_1000140111 436
621 3300031456 Ga0307513_10004316 Ga0307513_100043162 436
622 3300031456 Ga0307513_10019870 Ga0307513_100198704 436
623 3300031507 Ga0307509_10000991 Ga0307509_1000099110 436
624 3300031616 Ga0307508_10000404 Ga0307508_1000040429 436
625 3300031649 Ga0307514_10005041 Ga0307514_100050416 436
626 3300031649 Ga0307514_10023099 Ga0307514_100230997 436
627 3300031711 Ga0265314_10108281 Ga0265314_101082811 436
628 3300031712 Ga0265342_10060092 Ga0265342_100600922 436
629 3300031730 Ga0307516_10000359 Ga0307516_1000035953 436
630 3300031730 Ga0307516_10001752 Ga0307516_100017528 436
631 3300031730 Ga0307516_10100905 Ga0307516_101009052 436
632 3300031731 Ga0307405_10006874 Ga0307405_100068744 436
633 3300031824 Ga0307413_10024068 Ga0307413_100240682 436
634 3300031911 Ga0307412_10015454 Ga0307412_100154546 436
635 3300032002 Ga0307416_100024936 Ga0307416_1000249366 436
636 3300032004 Ga0307414_10071274 Ga0307414_100712742 436
637 3300032005 Ga0307411_10003755 Ga0307411_100037557 436
638 3300032126 Ga0307415_100057436 Ga0307415_1000574362 436
639 3300033179 Ga0307507_10019265 Ga0307507_100192654 436
640 3300033180 Ga0307510_10027525 Ga0307510_100275253 436
641 3300034820 Ga0373959_0005891 Ga0373959_0005891_93_1535 436
642 3300035114 Ga0373939_0000040 Ga0373939_0000040_36263_37729 436
643 3300035691 Ga0373931_0000637 Ga0373931_0000637_9665_11131 436
644 3300037471 Ga0395905_0000728 Ga0395905_0000728_6421_7824 436
645 3300037471 Ga0395905_0009245 Ga0395905_0009245_2219_3619 436
646 3300037471 Ga0395905_0015718 Ga0395905_0015718_2984_4384 436
647 3300039447 Ga0436361_0094944 Ga0436361_0094944_3291_4754 436
648 3300039447 Ga0436361_0163583 Ga0436361_0163583_101508_102917 436
649 3300042438 Ga0439459_0000706 Ga0439459_0000706_1028_2428 436
650 3300046454 Ga0495592_0000083 Ga0495592_0000083_55161_56561 436
651 3300046507 Ga0495606_0009174 Ga0495606_0009174_563_1996 436
652 3300048928 Ga0496125_0010319 Ga0496125_0010319_7012_8427 436
653 3300049649 Ga0501198_000012 Ga0501198_000012_94171_95571 436
654 3300049662 Ga0501222_000010 Ga0501222_000010_94177_95577 436
655 3300050493 nmdc:mga0k408_10252_c1 nmdc:mga0k408_10252_c1_744_2144 436
656 3300050493 nmdc:mga0k408_12380_c1 nmdc:mga0k408_12380_c1_2211_3611 436
657 3300050493 nmdc:mga0k408_287_c1 nmdc:mga0k408_287_c1_16374_17774 436
658 3300050494 nmdc:mga06z11_32547_c1 nmdc:mga06z11_32547_c1_880_2280 436
659 3300050496 nmdc:mga07m45_16271_c1 nmdc:mga07m45_16271_c1_1708_3108 436
660 3300050496 nmdc:mga07m45_3016_c1 nmdc:mga07m45_3016_c1_2260_3660 436
661 3300050496 nmdc:mga07m45_57420_c1 nmdc:mga07m45_57420_c1_636_2063 436
662 3300050496 nmdc:mga07m45_6146_c1 nmdc:mga07m45_6146_c1_4045_5445 436
663 3300050496 nmdc:mga07m45_77532_c1 nmdc:mga07m45_77532_c1_233_1633 436
664 3300050496 nmdc:mga07m45_8869_c1 nmdc:mga07m45_8869_c1_833_2233 436
665 3300053136 Ga0500559_0000019 Ga0500559_0000019_107524_108924 436
666 3300053156 Ga0500622_0003007 Ga0500622_0003007_5897_7297 436
667 3300059421 Ga0590071_013562 Ga0590071_013562_324_1790 436
668 3300059424 Ga0590075_009875 Ga0590075_009875_182_1582 436

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00032

Cytochrom_B_C

Cytochrome b(C-terminal)/b6/petD

402

486

0.98

PF00033

Cytochrome_B

Cytochrome b/b6/petB

35

224

0.98

PF13631

Cytochrom_B_N_2

Cytochrome b(N-terminal)/b6/petB

105

311

0.89

PF00032

Cytochrom_B_C

Cytochrome b(C-terminal)/b6/petD

293

347

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8snh-assembly1.cif.gz_D cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.8824 15 432
8snh-assembly1.cif.gz_D cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.8763 15 432
8ab6-assembly1.cif.gz_N complex iii2 from yarrowia lipolytica, combined datasets, consensus refinement 0.8711 21 419
6hu9-assembly1.cif.gz_N iii2-iv2 mitochondrial respiratory supercomplex from s. cerevisiae 0.8686 20 416
7o3c-assembly1.cif.gz_C murine supercomplex ciii2civ in the mature unlocked conformation 0.8672 21 416
ID Description Score Start End Superfamily
af_P03879_1_263_1.20.810.10 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8818 22 277 1.20.810.10
af_Q37311_1_385_1.20.810.10 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8671 21 416 1.20.810.10
3cwbC00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8606 21 416 1.20.810.10
1kyoC00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8584 20 419 1.20.810.10
af_P05642_1_215_1.20.810.10 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8524 16 222 1.20.810.10
ID Description Score Start End GO Terms
AF-A0A0N9XSA1-F1-model_v4 Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) 0.9429 26 150 GO:0005743
GO:0006122
GO:0008121
GO:0046872
AF-Q85SS8-F1-model_v4 Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) 0.9417 26 148 GO:0005743
GO:0006122
GO:0008121
GO:0046872
AF-G3LSP3-F1-model_v4 Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) 0.9387 26 144 GO:0005743
GO:0006122
GO:0008121
GO:0046872
AF-B9VAV3-F1-model_v4 Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) 0.9382 26 144 GO:0005743
GO:0006122
GO:0008121
GO:0046872
AF-Q7GI26-F1-model_v4 Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) 0.9378 26 142 GO:0005743
GO:0006122
GO:0008121
GO:0046872

Feature Viewer

pLDDT pTM Quality
83.57 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map