metagRoot

F473856

General Info

Members	Datasets	Scaffolds	Average Seq Length
667	323	615	130

Family's Representative Sequence

Representative Sequence	3300041453\|Ga0451797_0665997\|Ga0451797_0665997_62_523
Length	153
Sequence	MRVDDVALLLVVGLGSLEPEDALEDADLDAGGRVVDAARLCAVGAGVDAGDGAGRRHDEVAFDAEPDALLPQASAAMRRVDGGDGVLVLTDLYGASPSNLAAQLSRLGTPSRRVSALSLPMLLRVMNYAELPLEELPAVAAAGARNGVVLDDA

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2571042365	Lysobacter oryzae DSM 21044	Isolate	Rhizosphere
3	2576861471	Stenotrophomonas rhizophila DSM 14405	Isolate	Rhizosphere
4	2643221559	Lysobacter sp. Root559	Isolate	Unclassified
5	2643221573	Lysobacter sp. Root604	Isolate	Unclassified
6	2643221579	Pseudoxanthomonas sp. Root630	Isolate	Unclassified
7	2643221581	Pseudoxanthomonas sp. Root65	Isolate	Unclassified
8	2643221586	Lysobacter sp. Root667	Isolate	Unclassified
9	2643221593	Lysobacter sp. Root690	Isolate	Unclassified
10	2643221612	Lysobacter sp. Root76	Isolate	Unclassified
11	2643221695	Lysobacter sp. Root494	Isolate	Unclassified
12	2643221720	Lysobacter sp. Root916	Isolate	Unclassified
13	2643221727	Lysobacter sp. Root96	Isolate	Unclassified
14	2643221728	Lysobacter sp. Root983	Isolate	Unclassified
15	2747842428	Stenotrophomonas sp. WCS2014-113	Isolate	Unclassified
16	2747842501	Xanthomonas sp. WCS2014-23	Isolate	Unclassified
17	2765235840	Stenotrophomonas maltophilia AA1	Isolate	Unclassified
18	2816332141	Stenotrophomonas muris 1190 (v2) (version 2)	Isolate	Unclassified
19	2818991457	Xanthomonas translucens 569	Isolate	Unclassified
20	2842757796	Stenotrophomonas sp. R-72406	Isolate	Unclassified
21	2842780639	Pseudoxanthomonas sp. R-71986	Isolate	Unclassified
22	2852649853	Stenotrophomonas sp. JAI102	Isolate	Rhizosphere
23	2852684882	Xanthomonas sp. JAI131	Isolate	Rhizosphere
24	2857442823	Stenotrophomonas sp. R-74235	Isolate	Unclassified
25	2874220319	Stenotrophomonas maltophilia PS5	Isolate	Unclassified
26	2894414249	Luteimonas sp. LNNU 24178	Isolate	Rhizosphere
27	2895498888	Pseudoxanthomonas sp. SGD-10	Isolate	Rhizosphere
28	2895511927	Pseudoxanthomonas sp. SGD-5-1	Isolate	Rhizosphere
29	2895522137	Pseudoxanthomonas sp. SGNA-20	Isolate	Rhizosphere
30	2895525241	Pseudoxanthomonas sp. SGT-18	Isolate	Rhizosphere
31	2919089067	Stenotrophomonas sp. 1337	Isolate	Rhizosphere
32	2919134579	Stenotrophomonas geniculata 1733	Isolate	Rhizosphere
33	2919513703	Luteimonas sp. 3794	Isolate	Unclassified
34	2928496128	Stenotrophomonas indicatrix 1163	Isolate	Unclassified
35	2931380184	Stenotrophomonas sp. DR822	Isolate	Rhizosphere
36	2937610967	Stenotrophomonas maltophilia EP20	Isolate	Unclassified
37	2939589442	Stenotrophomonas rhizophila 716	Isolate	Rhizosphere
38	2939622612	Stenotrophomonas sp. 2619	Isolate	Rhizosphere
39	2939626828	Stenotrophomonas sp. 2694	Isolate	Rhizosphere
40	2941475908	Stenotrophomonas rhizophila 2680	Isolate	Rhizosphere
41	2941489479	Lysobacter enzymogenes 2943	Isolate	Rhizosphere
42	2961047084	Stenotrophomonas maltophilia EP5	Isolate	Unclassified
43	2961064222	Stenotrophomonas maltophilia EP13	Isolate	Unclassified
44	2974307012	Stenotrophomonas sp. SORGH_AS_0282	Isolate	Unclassified
45	2977247770	Stenotrophomonas rhizophila SORGH_AS 457	Isolate	Unclassified
46	2984514374	Stenotrophomonas sp. SORGH_AS282	Isolate	Aerial Root
47	2987605356	Stenotrophomonas sp. ATCM1_4	Isolate	Unclassified
48	2995948881	Lysobacter enzymogenes B25	Isolate	Unclassified
49	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
50	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
51	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
52	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
53	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
54	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
55	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
56	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
57	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
58	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
59	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
60	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
61	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
62	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
63	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
64	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
65	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
66	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
67	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
68	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
69	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
70	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
71	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
72	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
73	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
74	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
75	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
76	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
77	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
78	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
79	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
80	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
81	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
82	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
83	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
84	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
85	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
86	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
87	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
88	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
89	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
90	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
91	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
92	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
93	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
94	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
95	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
96	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
97	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
98	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
99	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
100	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
101	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
102	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
103	3300012482	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510	Metagenome	Rhizosphere
104	3300012500	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610	Metagenome	Rhizosphere
105	3300012510	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610	Metagenome	Rhizosphere
106	3300012512	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510	Metagenome	Rhizosphere
107	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
108	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
109	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
110	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
111	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
112	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
113	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
114	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
115	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
116	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
117	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
118	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
119	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
120	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
121	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
122	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
123	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
124	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
125	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
126	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
127	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
128	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
129	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
130	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
131	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
132	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
133	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
134	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
135	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
136	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
169	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
173	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
174	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
175	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
176	3300030734	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5	Metagenome	Rhizosphere
177	3300030736	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6	Metagenome	Rhizosphere
178	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
179	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
180	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
181	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
182	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
183	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
184	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
185	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
186	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
187	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
188	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
189	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
190	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
191	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
192	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
193	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
194	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
195	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
196	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
197	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
198	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
199	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
200	3300039145	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1	Metagenome	Unclassified
201	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
202	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
203	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
204	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
205	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
206	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
207	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
208	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
209	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
210	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
211	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
212	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
213	3300041462	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG	Metagenome	Rhizoplane
214	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
215	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
216	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
217	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
218	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
219	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
220	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
221	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
222	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
223	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
224	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
225	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
226	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
227	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
228	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
229	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
230	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
231	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
232	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
233	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
234	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
235	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
236	3300042533	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472	Metagenome	Rhizosphere
237	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
238	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
239	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
240	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
241	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
242	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
243	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
244	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
245	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
246	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
247	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
248	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
249	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
250	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
251	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
252	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
253	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
254	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
255	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
256	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
257	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
258	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
259	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
260	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
261	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
262	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
263	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
264	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
265	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
266	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
267	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
268	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
269	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
270	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
271	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
272	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
273	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
274	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
275	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
276	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
277	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
278	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
279	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
280	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
281	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
282	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
283	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
284	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
285	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
286	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
287	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
288	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
289	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
290	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
291	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
292	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
293	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
294	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
295	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
296	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
297	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
298	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
299	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
300	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
301	3300049680	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought	Metagenome	Rhizosphere
302	3300049682	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought	Metagenome	Rhizosphere
303	3300049683	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control	Metagenome	Rhizosphere
304	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
305	3300049688	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought	Metagenome	Rhizosphere
306	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
307	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
308	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
309	3300049760	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control	Metagenome	Rhizosphere
310	3300049763	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control	Metagenome	Rhizosphere
311	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
312	3300049767	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought	Metagenome	Rhizosphere
313	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
314	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
315	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
316	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
317	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
318	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
319	8002869464	Pseudoxanthomonas helianthi 110414	Isolate	Unclassified
320	8003014200	Lysobacter changpingensis Cm-3-T8	Isolate	Rhizosphere
321	8021622325	Xanthomonas sp. LMG12462	Isolate	Rhizosphere
322	8021626552	Xanthomonas sp. LMG12460	Isolate	Rhizosphere
323	8021648035	Xanthomonas sp. LMG 12461	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	92.2
Metatranscriptomes	0
Isolates	7.8

Biome Distribution

Category	Percentage (%)
Aerial Root	0.15
Bulb	0
Endosphere	15.59
Nodule	0.15
Rhizoplane	7.8
Rhizosphere	62.67
Stem	0
Stem Tuber	0
Unclassified	13.64

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_145288	2162886007	Bacteria	5558
2	SwRhRL2b_contig_1607524	2162886007	Bacteria	2091
3	JGI25151J46595_10000351	3300003187	Bacteria	49103
4	JGI25151J46595_10070674	3300003187	Bacteria	1058
5	JGI25153J46596_10000219	3300003215	Bacteria	49103
6	rootH1_10228024	3300003323	Bacteria	1233
7	Ga0055537_1000017	3300003773	Bacteria	123856
8	Ga0055537_1001080	3300003773	Bacteria	11996
9	Ga0055524_1000280	3300003775	Bacteria	50037
10	Ga0055524_1031360	3300003775	Bacteria	1530
11	Ga0055524_1033724	3300003775	Bacteria	1428
12	Ga0055536_1004171	3300003781	Bacteria	7477
13	Ga0055536_1041947	3300003781	Bacteria	1075
14	Ga0055536_1044032	3300003781	Bacteria	1032
15	Ga0055534_1000163	3300003784	Bacteria	50001
16	Ga0055534_1000267	3300003784	Bacteria	36162
17	Ga0055528_1000182	3300003790	Bacteria	53454
18	Ga0055528_1000204	3300003790	Bacteria	50037
19	Ga0055528_1060258	3300003790	Bacteria	720
20	Ga0055530_10001486	3300003791	Bacteria	17027
21	Ga0055530_10003762	3300003791	Bacteria	8373
22	Ga0055530_10031900	3300003791	Bacteria	1377
23	Ga0055540_1074488	3300003792	Bacteria	658
24	Ga0055540_1078364	3300003792	Bacteria	636
25	Ga0055531_10019722	3300003794	Bacteria	2709
26	Ga0055531_10041423	3300003794	Bacteria	1334
27	Ga0055531_10047038	3300003794	Bacteria	1178
28	Ga0055531_10049929	3300003794	Bacteria	1113
29	Ga0055531_10051940	3300003794	Bacteria	1071
30	Ga0058692_1000022	3300003856	Bacteria	237321
31	Ga0065704_10070357	3300005289	Bacteria	30374
32	Ga0065704_10074981	3300005289	Bacteria	5868
33	Ga0065704_10221981	3300005289	Bacteria	1054
34	Ga0065704_10314415	3300005289	Bacteria	861
35	Ga0065715_10000130	3300005293	Bacteria	656
36	Ga0065715_10101892	3300005293	Bacteria	3161
37	Ga0065715_10221683	3300005293	Bacteria	1269
38	Ga0065715_10437975	3300005293	Bacteria	839
39	Ga0065715_10454641	3300005293	Bacteria	814
40	Ga0065715_10855805	3300005293	Bacteria	577
41	Ga0070683_100156980	3300005329	Bacteria	2158
42	Ga0070670_100007587	3300005331	Bacteria	9211
43	Ga0070670_100090613	3300005331	Bacteria	2628
44	Ga0070670_100739328	3300005331	Bacteria	886
45	Ga0070670_101030786	3300005331	Bacteria	749
46	Ga0070677_10166218	3300005333	Bacteria	1039
47	Ga0070660_100108406	3300005339	Bacteria	2207
48	Ga0070687_100096593	3300005343	Bacteria	1645
49	Ga0070661_100797280	3300005344	Bacteria	775
50	Ga0070661_101189195	3300005344	Bacteria	637
51	Ga0070692_10109580	3300005345	Bacteria	1525
52	Ga0070668_100099203	3300005347	Bacteria	2306
53	Ga0070668_100550066	3300005347	Bacteria	1004
54	Ga0070668_100851326	3300005347	Bacteria	812
55	Ga0070668_100905910	3300005347	Bacteria	788
56	Ga0070669_100426526	3300005353	Bacteria	1089
57	Ga0070669_100593822	3300005353	Bacteria	927
58	Ga0070669_101063888	3300005353	Bacteria	696
59	Ga0070669_101434063	3300005353	Bacteria	599
60	Ga0070675_100097656	3300005354	Bacteria	2470
61	Ga0070675_100533375	3300005354	Bacteria	1060
62	Ga0070675_102070403	3300005354	Bacteria	525
63	Ga0070671_100077750	3300005355	Bacteria	2773
64	Ga0070671_100083169	3300005355	Bacteria	2676
65	Ga0070671_100476787	3300005355	Bacteria	1072
66	Ga0070673_100131053	3300005364	Bacteria	2103
67	Ga0070673_100345828	3300005364	Bacteria	1319
68	Ga0070667_100133831	3300005367	Bacteria	2166
69	Ga0070714_100055744	3300005435	Bacteria	3379
70	Ga0070663_100260362	3300005455	Bacteria	1376
71	Ga0070678_100078660	3300005456	Bacteria	2492
72	Ga0070678_100429071	3300005456	Bacteria	1154
73	Ga0070679_100078856	3300005530	Bacteria	3282
74	Ga0070679_100219425	3300005530	Bacteria	1863
75	Ga0068853_100482226	3300005539	Bacteria	1169
76	Ga0070672_100008108	3300005543	Bacteria	7177
77	Ga0070672_101380071	3300005543	Bacteria	630
78	Ga0070693_100067849	3300005547	Bacteria	2092
79	Ga0070665_100016620	3300005548	Bacteria	7373
80	Ga0070665_101960092	3300005548	Bacteria	591
81	Ga0070665_102333866	3300005548	Bacteria	538
82	Ga0068855_101326559	3300005563	Bacteria	744
83	Ga0068855_101413332	3300005563	Bacteria	717
84	Ga0070664_100244715	3300005564	Bacteria	1611
85	Ga0070664_100516671	3300005564	Bacteria	1102
86	Ga0070664_101023070	3300005564	Bacteria	777
87	Ga0068864_100226667	3300005618	Bacteria	1727
88	Ga0068862_100207520	3300005844	Bacteria	1769
89	Ga0068862_100235456	3300005844	Bacteria	1663
90	Ga0081539_10052951	3300005985	Bacteria	2275
91	Ga0075365_10025358	3300006038	Bacteria	3752
92	Ga0075365_10633690	3300006038	Bacteria	756
93	Ga0075368_10263691	3300006042	Bacteria	738
94	Ga0075363_100110766	3300006048	Bacteria	1526
95	Ga0075363_100176930	3300006048	Bacteria	1213
96	Ga0075364_10000531	3300006051	Bacteria	19427
97	Ga0075364_10046386	3300006051	Bacteria	2829
98	Ga0075364_10065891	3300006051	Bacteria	2378
99	Ga0075364_10104237	3300006051	Bacteria	1889
100	Ga0075364_10116412	3300006051	Bacteria	1787
101	Ga0075364_10141940	3300006051	Bacteria	1616
102	Ga0075364_10624706	3300006051	Bacteria	736
103	Ga0075364_10957258	3300006051	Bacteria	582
104	Ga0075362_10094966	3300006177	Bacteria	1388
105	Ga0075367_10243581	3300006178	Bacteria	1127
106	Ga0075366_10326750	3300006195	Bacteria	940
107	Ga0099826_10359808	3300006948	Bacteria	721
108	Ga0105251_10000013	3300009011	Bacteria	163226
109	Ga0105251_10002785	3300009011	Bacteria	13292
110	Ga0105244_10069296	3300009036	Bacteria	1761
111	Ga0105244_10095776	3300009036	Bacteria	1456
112	Ga0105245_10586860	3300009098	Bacteria	1139
113	Ga0105243_10002714	3300009148	Bacteria	14720
114	Ga0105243_10009159	3300009148	Bacteria	7558
115	Ga0105243_10172641	3300009148	Bacteria	1874
116	Ga0105241_11457988	3300009174	Bacteria	657
117	Ga0105248_11929884	3300009177	Bacteria	670
118	Ga0157318_1001556	3300012482	Bacteria	1160
119	Ga0157314_1001472	3300012500	Bacteria	1691
120	Ga0157314_1004912	3300012500	Bacteria	999
121	Ga0157316_1009165	3300012510	Bacteria	882
122	Ga0157327_1000338	3300012512	Bacteria	2479
123	Ga0157327_1020048	3300012512	Bacteria	746
124	Ga0157373_10184015	3300013100	Bacteria	1471
125	Ga0157373_10605775	3300013100	Bacteria	798
126	Ga0157373_11419004	3300013100	Bacteria	528
127	Ga0157371_10002186	3300013102	Bacteria	18979
128	Ga0157371_10016935	3300013102	Bacteria	5428
129	Ga0157371_10020416	3300013102	Bacteria	4875
130	Ga0157371_10046400	3300013102	Bacteria	3090
131	Ga0157371_10133805	3300013102	Bacteria	1765
132	Ga0157370_10010646	3300013104	Bacteria	9681
133	Ga0157370_10112942	3300013104	Bacteria	2539
134	Ga0157369_10112963	3300013105	Bacteria	2886
135	Ga0163162_12193095	3300013306	Bacteria	634
136	Ga0163162_12714299	3300013306	Bacteria	570
137	Ga0157372_10138095	3300013307	Bacteria	2808
138	Ga0157372_10368776	3300013307	Bacteria	1673
139	Ga0157372_10909696	3300013307	Bacteria	1021
140	Ga0157372_12175401	3300013307	Bacteria	637
141	Ga0157375_10199755	3300013308	Bacteria	2155
142	Ga0157375_10941185	3300013308	Bacteria	1006
143	Ga0182008_10000096	3300014497	Bacteria	67450
144	Ga0182008_10001301	3300014497	Bacteria	17041
145	Ga0182008_10030840	3300014497	Bacteria	2700
146	Ga0157377_10319837	3300014745	Bacteria	1031
147	Ga0157376_10578350	3300014969	Bacteria	1115
148	Ga0182006_1008250	3300015261	Bacteria	4725
149	Ga0182006_1008605	3300015261	Bacteria	4624
150	Ga0182006_1063799	3300015261	Bacteria	1383
151	Ga0182007_10000048	3300015262	Bacteria	103024
152	Ga0182005_1011604	3300015265	Bacteria	2508
153	Ga0163161_10030249	3300017792	Bacteria	3852
154	Ga0163161_10449619	3300017792	Bacteria	1041
155	Ga0163161_10609356	3300017792	Bacteria	901
156	Ga0163161_10939047	3300017792	Bacteria	735
157	Ga0207425_1000111	3300025245	Bacteria	77375
158	Ga0207425_1003198	3300025245	Bacteria	5350
159	Ga0207425_1026892	3300025245	Bacteria	1177
160	Ga0209129_1000087	3300025258	Bacteria	179582
161	Ga0209565_1000005	3300025263	Bacteria	947317
162	Ga0209565_1000031	3300025263	Bacteria	320341
163	Ga0209673_1000011	3300025273	Bacteria	586604
164	Ga0209673_1000164	3300025273	Bacteria	138082
165	Ga0209673_1004282	3300025273	Bacteria	7731
166	Ga0209673_1064512	3300025273	Bacteria	898
167	Ga0209130_1002494	3300025284	Bacteria	9108
168	Ga0209130_1005265	3300025284	Bacteria	4553
169	Ga0209675_1000004	3300025291	Bacteria	947166
170	Ga0209675_1000015	3300025291	Bacteria	403517
171	Ga0209675_1015895	3300025291	Bacteria	2215
172	Ga0209676_1000027	3300025292	Bacteria	560222
173	Ga0209676_1000037	3300025292	Bacteria	457562
174	Ga0209676_1000110	3300025292	Bacteria	214083
175	Ga0209676_1001028	3300025292	Bacteria	32470
176	Ga0209676_1001231	3300025292	Bacteria	27052
177	Ga0209676_1005673	3300025292	Bacteria	6424
178	Ga0209676_1089497	3300025292	Bacteria	680
179	Ga0209025_1000013	3300025294	Bacteria	871757
180	Ga0209025_1000023	3300025294	Bacteria	541307
181	Ga0209025_1007002	3300025294	Bacteria	8559
182	Ga0209025_1042768	3300025294	Bacteria	1919
183	Ga0209025_1095496	3300025294	Bacteria	957
184	Ga0209564_1000018	3300025295	Bacteria	586913
185	Ga0209564_1000037	3300025295	Bacteria	414794
186	Ga0209564_1008868	3300025295	Bacteria	4891
187	Ga0209758_1000014	3300025297	Bacteria	871757
188	Ga0209758_1018562	3300025297	Bacteria	3400
189	Ga0209758_1037036	3300025297	Bacteria	1892
190	Ga0209050_1000417	3300025298	Bacteria	78631
191	Ga0209050_1001410	3300025298	Bacteria	26010
192	Ga0209050_1002473	3300025298	Bacteria	15717
193	Ga0209050_1015285	3300025298	Bacteria	3236
194	Ga0209050_1035653	3300025298	Bacteria	1468
195	Ga0209050_1046599	3300025298	Bacteria	1137
196	Ga0209256_1000021	3300025299	Bacteria	537097
197	Ga0209256_1002158	3300025299	Bacteria	16970
198	Ga0209256_1002613	3300025299	Bacteria	14247
199	Ga0209256_1008601	3300025299	Bacteria	4688
200	Ga0209256_1015165	3300025299	Bacteria	2715
201	Ga0207426_1054690	3300025302	Bacteria	1173
202	Ga0209051_1001882	3300025303	Bacteria	16414
203	Ga0209051_1039697	3300025303	Bacteria	1696
204	Ga0209257_1000129	3300025304	Bacteria	214155
205	Ga0209257_1000274	3300025304	Bacteria	117076
206	Ga0209257_1000476	3300025304	Bacteria	72955
207	Ga0209257_1000623	3300025304	Bacteria	57092
208	Ga0209257_1000670	3300025304	Bacteria	53641
209	Ga0209257_1001580	3300025304	Bacteria	26249
210	Ga0207655_1117845	3300025728	Bacteria	885
211	Ga0207713_1000262	3300025735	Bacteria	64928
212	Ga0207713_1037920	3300025735	Bacteria	2050
213	Ga0207705_10213150	3300025909	Bacteria	1465
214	Ga0207662_10262477	3300025918	Bacteria	1137
215	Ga0207662_10626290	3300025918	Bacteria	750
216	Ga0207657_10031869	3300025919	Bacteria	4768
217	Ga0207649_10425246	3300025920	Bacteria	998
218	Ga0207649_10796446	3300025920	Bacteria	737
219	Ga0207649_10858377	3300025920	Bacteria	710
220	Ga0207652_10505886	3300025921	Bacteria	1087
221	Ga0207681_10418352	3300025923	Bacteria	1085
222	Ga0207681_10500011	3300025923	Bacteria	995
223	Ga0207681_10587324	3300025923	Bacteria	919
224	Ga0207650_10025955	3300025925	Bacteria	4177
225	Ga0207650_10187016	3300025925	Bacteria	1653
226	Ga0207650_10474272	3300025925	Bacteria	1044
227	Ga0207659_10046804	3300025926	Bacteria	3057
228	Ga0207659_10554299	3300025926	Bacteria	977
229	Ga0207687_11465595	3300025927	Bacteria	586
230	Ga0207664_10345313	3300025929	Bacteria	1316
231	Ga0207644_10316163	3300025931	Bacteria	1262
232	Ga0207690_10395037	3300025932	Bacteria	1102
233	Ga0207709_10001341	3300025935	Bacteria	17363
234	Ga0207709_10005980	3300025935	Bacteria	6862
235	Ga0207709_10142292	3300025935	Bacteria	1650
236	Ga0207691_10033973	3300025940	Bacteria	4747
237	Ga0207691_10307624	3300025940	Bacteria	1361
238	Ga0207711_11125536	3300025941	Bacteria	726
239	Ga0207689_10859876	3300025942	Bacteria	765
240	Ga0207661_10380931	3300025944	Bacteria	1277
241	Ga0207679_10061845	3300025945	Bacteria	2788
242	Ga0207679_10923269	3300025945	Bacteria	799
243	Ga0207667_10743076	3300025949	Bacteria	981
244	Ga0207651_10406901	3300025960	Bacteria	1159
245	Ga0207668_10014131	3300025972	Bacteria	4938
246	Ga0207668_10225207	3300025972	Bacteria	1508
247	Ga0207668_10276307	3300025972	Bacteria	1375
248	Ga0207668_10481292	3300025972	Bacteria	1065
249	Ga0207678_10157423	3300026067	Bacteria	1940
250	Ga0207676_10408612	3300026095	Bacteria	1270
251	Ga0207683_10028247	3300026121	Bacteria	4850
252	Ga0207683_10787956	3300026121	Bacteria	882
253	Ga0209371_1000004	3300027312	Bacteria	1098197
254	Ga0209371_1000011	3300027312	Bacteria	848456
255	Ga0209982_1023758	3300027552	Bacteria	949
256	Ga0209970_1002871	3300027614	Bacteria	2907
257	Ga0210002_1006342	3300027617	Bacteria	1784
258	Ga0209983_1000436	3300027665	Bacteria	9043
259	Ga0209971_1008762	3300027682	Bacteria	2399
260	Ga0209813_10269388	3300027866	Bacteria	652
261	Ga0209974_10009471	3300027876	Bacteria	3306
262	Ga0209974_10017936	3300027876	Bacteria	2347
263	Ga0268266_10059786	3300028379	Bacteria	3283
264	Ga0268266_11690038	3300028379	Bacteria	608
265	Ga0268265_10096628	3300028380	Bacteria	2375
266	Ga0268265_11356389	3300028380	Bacteria	712
267	Ga0307515_10093168	3300028794	Bacteria	3739
268	Ga0268256_1000005	3300030500	Bacteria	1082342
269	Ga0268256_1000011	3300030500	Bacteria	848625
270	Ga0316176_1013813	3300030732	Bacteria	3135
271	Ga0316176_1040133	3300030732	Bacteria	1165
272	Ga0314311_1082679	3300030733	Bacteria	3774
273	Ga0314311_1099232	3300030733	Bacteria	3029
274	Ga0314311_1152756	3300030733	Bacteria	816
275	Ga0316179_1071168	3300030734	Bacteria	632
276	Ga0316180_1139485	3300030736	Bacteria	1368
277	Ga0316183_1083391	3300030742	Bacteria	12055
278	Ga0316181_1005833	3300030744	Bacteria	3389
279	Ga0316182_1061642	3300030745	Bacteria	870
280	Ga0316182_1118087	3300030745	Bacteria	2221
281	Ga0307513_10000456	3300031456	Bacteria	58897
282	Ga0307513_10151000	3300031456	Bacteria	2232
283	Ga0307408_100063608	3300031548	Bacteria	2700
284	Ga0307408_100115116	3300031548	Bacteria	2073
285	Ga0307408_100538974	3300031548	Bacteria	1028
286	Ga0307408_101024002	3300031548	Bacteria	762
287	Ga0307408_101813987	3300031548	Bacteria	583
288	Ga0307405_10109557	3300031731	Bacteria	1868
289	Ga0307405_10229291	3300031731	Bacteria	1368
290	Ga0307405_10338901	3300031731	Bacteria	1155
291	Ga0307405_10379378	3300031731	Bacteria	1100
292	Ga0307405_10603413	3300031731	Bacteria	896
293	Ga0307405_10619922	3300031731	Bacteria	885
294	Ga0307405_10620170	3300031731	Bacteria	885
295	Ga0307413_10040386	3300031824	Bacteria	2722
296	Ga0307413_10042618	3300031824	Bacteria	2669
297	Ga0307413_10108966	3300031824	Bacteria	1849
298	Ga0307413_10151902	3300031824	Bacteria	1615
299	Ga0307413_10201006	3300031824	Bacteria	1439
300	Ga0307413_10492005	3300031824	Bacteria	983
301	Ga0307413_10780594	3300031824	Bacteria	801
302	Ga0307413_11733344	3300031824	Bacteria	558
303	Ga0307410_10263814	3300031852	Bacteria	1344
304	Ga0307410_10329113	3300031852	Bacteria	1214
305	Ga0307410_10675313	3300031852	Bacteria	868
306	Ga0307406_10019842	3300031901	Bacteria	3950
307	Ga0307406_10089496	3300031901	Bacteria	2068
308	Ga0307406_10267793	3300031901	Bacteria	1296
309	Ga0307406_11770910	3300031901	Bacteria	549
310	Ga0307407_10327941	3300031903	Bacteria	1076
311	Ga0307412_10055820	3300031911	Bacteria	2629
312	Ga0307412_10070447	3300031911	Bacteria	2383
313	Ga0307412_10093932	3300031911	Bacteria	2105
314	Ga0307412_10411830	3300031911	Bacteria	1103
315	Ga0307412_10593402	3300031911	Bacteria	937
316	Ga0307412_11074673	3300031911	Bacteria	715
317	Ga0307409_100748946	3300031995	Bacteria	980
318	Ga0307409_100828353	3300031995	Bacteria	935
319	Ga0307416_100342918	3300032002	Bacteria	1508
320	Ga0307416_100421204	3300032002	Bacteria	1379
321	Ga0307416_100804449	3300032002	Bacteria	1036
322	Ga0307416_101614369	3300032002	Bacteria	754
323	Ga0307414_10000215	3300032004	Bacteria	38077
324	Ga0307414_10008172	3300032004	Bacteria	5917
325	Ga0307414_10010308	3300032004	Bacteria	5415
326	Ga0307414_10034606	3300032004	Bacteria	3352
327	Ga0307414_10057247	3300032004	Bacteria	2739
328	Ga0307414_10060466	3300032004	Bacteria	2679
329	Ga0307414_10087610	3300032004	Bacteria	2301
330	Ga0307414_10094649	3300032004	Bacteria	2230
331	Ga0307414_10097637	3300032004	Bacteria	2201
332	Ga0307414_10131946	3300032004	Bacteria	1941
333	Ga0307414_10236817	3300032004	Bacteria	1508
334	Ga0307414_10412772	3300032004	Bacteria	1175
335	Ga0307414_10431588	3300032004	Bacteria	1151
336	Ga0307414_10526910	3300032004	Bacteria	1049
337	Ga0307414_10536649	3300032004	Bacteria	1040
338	Ga0307414_10585435	3300032004	Bacteria	999
339	Ga0307414_10703540	3300032004	Bacteria	915
340	Ga0307414_10714026	3300032004	Bacteria	908
341	Ga0307414_10917469	3300032004	Bacteria	803
342	Ga0307414_11045030	3300032004	Bacteria	753
343	Ga0307414_11217374	3300032004	Bacteria	697
344	Ga0307414_11375990	3300032004	Bacteria	655
345	Ga0307414_11714309	3300032004	Bacteria	586
346	Ga0307411_10010665	3300032005	Bacteria	4912
347	Ga0307411_10012920	3300032005	Bacteria	4581
348	Ga0307411_10263994	3300032005	Bacteria	1361
349	Ga0307411_10315419	3300032005	Bacteria	1260
350	Ga0307411_10456120	3300032005	Bacteria	1070
351	Ga0307411_11196792	3300032005	Bacteria	689
352	Ga0307411_11344826	3300032005	Bacteria	652
353	Ga0373931_0397026	3300035691	Bacteria	872
354	Ga0395899_0031827	3300037312	Bacteria	3963
355	Ga0395899_0304250	3300037312	Bacteria	1078
356	Ga0395900_0190389	3300037418	Bacteria	2081
357	Ga0395900_0281014	3300037418	Bacteria	1656
358	Ga0395900_1208256	3300037418	Bacteria	671
359	Ga0395898_0044160	3300037466	Bacteria	4390
360	Ga0395898_0149069	3300037466	Bacteria	2239
361	Ga0395898_0153769	3300037466	Bacteria	2201
362	Ga0395905_0002340	3300037471	Bacteria	21136
363	Ga0395905_0084974	3300037471	Bacteria	2965
364	Ga0395905_0149371	3300037471	Bacteria	2198
365	Ga0395905_1694179	3300037471	Bacteria	537
366	Ga0395901_0002043	3300038443	Bacteria	20724
367	Ga0395901_0591938	3300038443	Bacteria	1119
368	Ga0237819_00040	3300038705	Bacteria	45528
369	Ga0237816_01328	3300039145	Bacteria	1999
370	Ga0439436_0006630	3300041404	Bacteria	3555
371	Ga0439436_0009624	3300041404	Bacteria	2963
372	Ga0439436_0027837	3300041404	Bacteria	1652
373	Ga0439436_0093051	3300041404	Bacteria	839
374	Ga0439436_0160152	3300041404	Bacteria	636
375	Ga0439436_0233420	3300041404	Bacteria	531
376	Ga0439439_0034156	3300041406	Bacteria	1304
377	Ga0439439_0067022	3300041406	Bacteria	958
378	Ga0439447_149128	3300041407	Bacteria	538
379	Ga0439465_0001052	3300041413	Bacteria	8793
380	Ga0439465_0005832	3300041413	Bacteria	3921
381	Ga0439465_0013607	3300041413	Bacteria	2534
382	Ga0439465_0170455	3300041413	Bacteria	784
383	Ga0439465_0287444	3300041413	Bacteria	613
384	Ga0451787_065104	3300041441	Bacteria	1318
385	Ga0451789_0119803	3300041443	Bacteria	676
386	Ga0451789_0940374	3300041443	Bacteria	986
387	Ga0451791_0078721	3300041451	Bacteria	1537
388	Ga0451791_1305826	3300041451	Bacteria	1082
389	Ga0451791_1500031	3300041451	Bacteria	606
390	Ga0451793_0670350	3300041452	Bacteria	1676
391	Ga0451793_1127667	3300041452	Bacteria	1045
392	Ga0451797_0164784	3300041453	Bacteria	1492
393	Ga0451797_0261558	3300041453	Bacteria	624
394	Ga0451797_0654529	3300041453	Bacteria	1622
395	Ga0451797_0665997	3300041453	Bacteria	580
396	Ga0451797_1546842	3300041453	Bacteria	895
397	Ga0451797_1589125	3300041453	Bacteria	2291
398	Ga0451798_0867166	3300041458	Bacteria	931
399	Ga0451800_0951563	3300041459	Bacteria	3570
400	Ga0451802_0280713	3300041460	Bacteria	1764
401	Ga0451802_1183978	3300041460	Bacteria	1825
402	Ga0451802_2076607	3300041460	Bacteria	892
403	Ga0451806_353517	3300041462	Bacteria	794
404	Ga0451804_0176025	3300041463	Bacteria	4713
405	Ga0451804_1029255	3300041463	Bacteria	1278
406	Ga0451807_0517368	3300041486	Bacteria	637
407	Ga0451807_0521648	3300041486	Bacteria	1686
408	Ga0451807_2077257	3300041486	Bacteria	514
409	Ga0451807_2709952	3300041486	Bacteria	3601
410	Ga0451833_1413313	3300041491	Bacteria	813
411	Ga0451837_0505909	3300041494	Bacteria	846
412	Ga0451837_0687947	3300041494	Bacteria	1668
413	Ga0451837_1112552	3300041494	Bacteria	648
414	Ga0451839_1230358	3300041496	Bacteria	817
415	Ga0451841_0105861	3300041498	Bacteria	660
416	Ga0451843_0119036	3300041509	Bacteria	631
417	Ga0451843_0525695	3300041509	Bacteria	701
418	Ga0451843_1288714	3300041509	Bacteria	1290
419	Ga0451843_1526773	3300041509	Bacteria	1201
420	Ga0451843_1657836	3300041509	Bacteria	1330
421	Ga0451853_0283292	3300041512	Bacteria	1020
422	Ga0451853_0552817	3300041512	Bacteria	754
423	Ga0451853_2504104	3300041512	Bacteria	659
424	Ga0451853_2758808	3300041512	Bacteria	574
425	Ga0451853_2953861	3300041512	Bacteria	582
426	Ga0439431_0120939	3300041997	Bacteria	730
427	Ga0439433_0015296	3300041999	Bacteria	1694
428	Ga0439433_0026976	3300041999	Bacteria	1301
429	Ga0439433_0038377	3300041999	Bacteria	1110
430	Ga0439433_0092066	3300041999	Bacteria	746
431	Ga0439433_0143177	3300041999	Bacteria	612
432	Ga0439445_0007424	3300042004	Bacteria	2542
433	Ga0439432_006888	3300042006	Bacteria	4047
434	Ga0439432_013892	3300042006	Bacteria	2730
435	Ga0439432_032834	3300042006	Bacteria	1672
436	Ga0439449_0000004	3300042007	Bacteria	82454
437	Ga0439449_0004225	3300042007	Bacteria	5551
438	Ga0439449_0011914	3300042007	Bacteria	3269
439	Ga0439449_0019204	3300042007	Bacteria	2562
440	Ga0439449_0023109	3300042007	Bacteria	2327
441	Ga0439449_0033764	3300042007	Bacteria	1905
442	Ga0439449_0042411	3300042007	Bacteria	1690
443	Ga0439449_0158662	3300042007	Bacteria	844
444	Ga0439449_0205433	3300042007	Bacteria	737
445	Ga0439452_006295	3300042010	Bacteria	3726
446	Ga0439452_070373	3300042010	Bacteria	772
447	Ga0439457_022016	3300042014	Bacteria	1412
448	Ga0439462_0053569	3300042015	Bacteria	1086
449	Ga0439462_0116874	3300042015	Bacteria	740
450	Ga0439462_0135732	3300042015	Bacteria	688
451	Ga0450923_056035	3300042125	Bacteria	854
452	Ga0450905_019173	3300042142	Bacteria	1000
453	Ga0450905_047418	3300042142	Bacteria	694
454	Ga0439446_0190118	3300042156	Bacteria	690
455	Ga0439434_0212220	3300042435	Bacteria	655
456	Ga0439434_0280158	3300042435	Bacteria	574
457	Ga0439444_0002879	3300042437	Bacteria	2391
458	Ga0450893_0032897	3300042532	Bacteria	929
459	Ga0450901_013957	3300042533	Bacteria	843
460	Ga0451577_0002652	3300042876	Bacteria	20952
461	Ga0453684_0193639	3300044712	Bacteria	2376
462	Ga0466967_0965632	3300045976	Bacteria	848
463	Ga0495627_008906	3300046453	Bacteria	3718
464	Ga0495591_023418	3300046458	Bacteria	1979
465	Ga0495638_0000881	3300046460	Bacteria	30946
466	Ga0495638_0032546	3300046460	Bacteria	3342
467	Ga0495638_0032950	3300046460	Bacteria	3316
468	Ga0495638_0134946	3300046460	Bacteria	1446
469	Ga0495605_0299116	3300046474	Bacteria	681
470	Ga0495607_0148583	3300046501	Bacteria	1201
471	Ga0495606_0024111	3300046507	Bacteria	4395
472	Ga0495610_0003046	3300046512	Bacteria	13417
473	Ga0495616_0037555	3300046513	Bacteria	2491
474	Ga0495616_0131998	3300046513	Bacteria	1144
475	Ga0495631_0001525	3300046518	Bacteria	13955
476	Ga0495643_0003922	3300046522	Bacteria	10656
477	Ga0495663_0003967	3300046525	Bacteria	4210
478	Ga0495663_0014322	3300046525	Bacteria	2222
479	Ga0495663_0023647	3300046525	Bacteria	1781
480	Ga0495663_0034967	3300046525	Bacteria	1507
481	Ga0495663_0211450	3300046525	Bacteria	679
482	Ga0495598_0002011	3300046537	Bacteria	4134
483	Ga0495621_0002263	3300046539	Bacteria	5150
484	Ga0495633_0026731	3300046558	Bacteria	2828
485	Ga0495633_0113725	3300046558	Bacteria	1255
486	Ga0495656_0001001	3300046615	Bacteria	9129
487	Ga0495656_0005612	3300046615	Bacteria	4341
488	Ga0495656_0042488	3300046615	Bacteria	1903
489	Ga0495656_0091210	3300046615	Bacteria	1393
490	Ga0495625_0058167	3300046660	Bacteria	2747
491	Ga0495659_0007586	3300046664	Bacteria	3440
492	Ga0495670_0022391	3300046691	Bacteria	3120
493	Ga0495670_0163502	3300046691	Bacteria	1170
494	Ga0495670_0708468	3300046691	Bacteria	549
495	Ga0495670_0747886	3300046691	Bacteria	533
496	Ga0495660_0026745	3300046810	Bacteria	3268
497	Ga0495636_0001111	3300047318	Bacteria	10119
498	Ga0495636_0013660	3300047318	Bacteria	3223
499	Ga0495636_0015636	3300047318	Bacteria	3025
500	Ga0495636_0037231	3300047318	Bacteria	2009
501	Ga0495672_0000090	3300047320	Bacteria	148367
502	Ga0495672_0068871	3300047320	Bacteria	2010
503	Ga0495685_053914	3300047447	Bacteria	1361
504	Ga0495686_0016694	3300047472	Bacteria	4970
505	Ga0496100_0144285	3300048903	Bacteria	1691
506	Ga0496101_0324855	3300048904	Bacteria	1207
507	Ga0496101_0423455	3300048904	Bacteria	1049
508	Ga0496102_0306391	3300048905	Bacteria	1497
509	Ga0496102_1145319	3300048905	Bacteria	697
510	Ga0496102_1414128	3300048905	Bacteria	615
511	Ga0496103_0256302	3300048906	Bacteria	1126
512	Ga0496105_0470242	3300048908	Bacteria	990
513	Ga0496105_0768291	3300048908	Bacteria	735
514	Ga0496107_0218038	3300048910	Bacteria	1419
515	Ga0496108_0035903	3300048911	Bacteria	4122
516	Ga0496108_0368749	3300048911	Bacteria	1253
517	Ga0496109_0043544	3300048912	Bacteria	4069
518	Ga0496109_0330037	3300048912	Bacteria	1440
519	Ga0496109_1203203	3300048912	Bacteria	694
520	Ga0496110_0071987	3300048913	Bacteria	3066
521	Ga0496110_0224170	3300048913	Bacteria	1710
522	Ga0496111_0211479	3300048914	Bacteria	1440
523	Ga0496111_0221718	3300048914	Bacteria	1405
524	Ga0496111_1048628	3300048914	Bacteria	583
525	Ga0496112_0021549	3300048915	Bacteria	6130
526	Ga0496112_0070274	3300048915	Bacteria	3460
527	Ga0496113_0122362	3300048916	Bacteria	2035
528	Ga0496113_0137369	3300048916	Bacteria	1921
529	Ga0496114_0004378	3300048917	Bacteria	10942
530	Ga0496114_0173279	3300048917	Bacteria	1881
531	Ga0496116_0021188	3300048919	Bacteria	4908
532	Ga0496117_0000617	3300048920	Bacteria	57555
533	Ga0496117_0001304	3300048920	Bacteria	36712
534	Ga0496117_0008591	3300048920	Bacteria	9679
535	Ga0496117_0057014	3300048920	Bacteria	2716
536	Ga0496118_0000404	3300048921	Bacteria	72202
537	Ga0496118_0000737	3300048921	Bacteria	52822
538	Ga0496118_0044462	3300048921	Bacteria	3477
539	Ga0496118_0049885	3300048921	Bacteria	3218
540	Ga0496118_0079564	3300048921	Bacteria	2312
541	Ga0496118_0123503	3300048921	Bacteria	1681
542	Ga0496119_0000329	3300048922	Bacteria	66425
543	Ga0496119_0006232	3300048922	Bacteria	11141
544	Ga0496120_0000147	3300048923	Bacteria	117881
545	Ga0496120_0000514	3300048923	Bacteria	60279
546	Ga0496121_0002594	3300048924	Bacteria	27284
547	Ga0496121_0135493	3300048924	Bacteria	1835
548	Ga0496122_0000566	3300048925	Bacteria	75845
549	Ga0496122_0001044	3300048925	Bacteria	48545
550	Ga0496122_0006535	3300048925	Bacteria	13341
551	Ga0496123_0000150	3300048926	Bacteria	142879
552	Ga0496123_0000324	3300048926	Bacteria	91012
553	Ga0496123_0005924	3300048926	Bacteria	12042
554	Ga0496123_0051615	3300048926	Bacteria	2737
555	Ga0496124_0000032	3300048927	Bacteria	332524
556	Ga0496124_0000680	3300048927	Bacteria	55821
557	Ga0496124_0001216	3300048927	Bacteria	39862
558	Ga0496124_0006616	3300048927	Bacteria	12584
559	Ga0496124_0042671	3300048927	Bacteria	3904
560	Ga0496124_0117367	3300048927	Bacteria	2131
561	Ga0496125_0018579	3300048928	Bacteria	6601
562	Ga0496125_0026103	3300048928	Bacteria	5334
563	Ga0496125_0064196	3300048928	Bacteria	2920
564	Ga0496125_0085664	3300048928	Bacteria	2386
565	Ga0496125_0120654	3300048928	Bacteria	1871
566	Ga0496126_0000967	3300048929	Bacteria	49289
567	Ga0496126_0011304	3300048929	Bacteria	9261
568	Ga0496126_0113282	3300048929	Bacteria	2361
569	Ga0496126_0391783	3300048929	Bacteria	1129
570	Ga0501292_029665	3300049515	Bacteria	915
571	Ga0501031_0016530	3300049568	Bacteria	4793
572	Ga0501033_0002084	3300049570	Bacteria	17322
573	Ga0501033_0024972	3300049570	Bacteria	4503
574	Ga0501034_0000834	3300049571	Bacteria	45735
575	Ga0501034_0001875	3300049571	Bacteria	26665
576	Ga0501034_0015913	3300049571	Bacteria	7720
577	Ga0501034_0193975	3300049571	Bacteria	1992
578	Ga0501034_0691155	3300049571	Bacteria	919
579	Ga0501036_0142199	3300049572	Bacteria	2024
580	Ga0501037_0046698	3300049573	Bacteria	3176
581	Ga0501038_0015316	3300049574	Bacteria	6971
582	Ga0501039_0027266	3300049575	Bacteria	4392
583	Ga0501043_0001713	3300049579	Bacteria	18952
584	Ga0501043_0120368	3300049579	Bacteria	2058
585	Ga0501046_0735439	3300049580	Bacteria	694
586	Ga0501047_0163739	3300049581	Bacteria	2095
587	Ga0501070_0037650	3300049586	Bacteria	4038
588	Ga0501202_069973	3300049652	Bacteria	807
589	Ga0501217_143909	3300049661	Bacteria	708
590	Ga0501250_097114	3300049680	Bacteria	520
591	Ga0501252_047908	3300049682	Bacteria	638
592	Ga0501253_088264	3300049683	Bacteria	710
593	Ga0501257_073267	3300049686	Bacteria	877
594	Ga0501259_157474	3300049688	Bacteria	566
595	Ga0501225_0002344	3300049705	Bacteria	5843
596	Ga0501225_0044022	3300049705	Bacteria	1234
597	Ga0501225_0072096	3300049705	Bacteria	983
598	Ga0501080_0417350	3300049742	Bacteria	1206
599	Ga0501241_097064	3300049758	Bacteria	631
600	Ga0501263_049582	3300049760	Bacteria	636
601	Ga0501266_102366	3300049763	Bacteria	509
602	Ga0501268_083792	3300049765	Bacteria	662
603	Ga0501270_128593	3300049767	Bacteria	558
604	Ga0501279_031641	3300049775	Bacteria	786
605	Ga0501035_0061152	3300049822	Bacteria	3352
606	Ga0501044_0147113	3300049823	Bacteria	2340
607	Ga0501044_0691739	3300049823	Bacteria	906
608	nmdc:mga03n38_267386_c1	3300050490	Bacteria	908
609	nmdc:mga03n38_927393_c1	3300050490	Bacteria	513
610	nmdc:mga00v17_107765_c1	3300050491	Bacteria	1765
611	nmdc:mga00v17_16162_c1	3300050491	Bacteria	4205
612	nmdc:mga00v17_20979_c1	3300050491	Bacteria	3751
613	nmdc:mga00v17_312760_c1	3300050491	Bacteria	1021
614	nmdc:mga00v17_694151_c1	3300050491	Bacteria	653
615	nmdc:mga0yw44_181472_c1	3300050492	Bacteria	1385

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005347	Ga0070668_100550066	Ga0070668_1005500661	123
2	3300025972	Ga0207668_10014131	Ga0207668_100141315	123
3	3300032004	Ga0307414_11045030	Ga0307414_110450301	123
4	iso_pu_bacteria	2571042365	2572254629	126
5	iso_pu_bacteria	2576861471	2578459340	126
6	iso_pu_bacteria	2643221559	2643816577	126
7	iso_pu_bacteria	2643221573	2643881972	126
8	iso_pu_bacteria	2643221579	2643905420	126
9	iso_pu_bacteria	2643221581	2643913437	126
10	iso_pu_bacteria	2643221586	2643938743	126
11	iso_pu_bacteria	2643221593	2643977986	126
12	iso_pu_bacteria	2643221612	2644077513	126
13	iso_pu_bacteria	2643221695	2644529710	126
14	iso_pu_bacteria	2643221720	2644661631	126
15	iso_pu_bacteria	2643221727	2644694172	126
16	iso_pu_bacteria	2643221728	2644701332	126
17	iso_pu_bacteria	2747842428	2747951375	126
18	iso_pu_bacteria	2747842501	2748018159	126
19	iso_pu_bacteria	2765235840	2765577977	126
20	iso_pu_bacteria	2816332141	2816516043	126
21	iso_pu_bacteria	2818991457	2819660692	126
22	iso_pu_bacteria	2842757796	2842759224	126
23	iso_pu_bacteria	2842780639	2842783405	126
24	iso_pu_bacteria	2852649853	2852653264	126
25	iso_pu_bacteria	2852684882	2852686560	126
26	iso_pu_bacteria	2857442823	2857442830	126
27	iso_pu_bacteria	2874220319	2874220627	126
28	iso_pu_bacteria	2894414249	2894417226	126
29	iso_pu_bacteria	2895498888	2895499092	126
30	iso_pu_bacteria	2895511927	2895512111	126
31	iso_pu_bacteria	2895522137	2895523234	126
32	iso_pu_bacteria	2895525241	2895528057	126
33	iso_pu_bacteria	2919089067	2919090642	126
34	iso_pu_bacteria	2919134579	2919134715	126
35	iso_pu_bacteria	2919513703	2919515257	126
36	iso_pu_bacteria	2928496128	2928496638	126
37	iso_pu_bacteria	2931380184	2931381740	126
38	iso_pu_bacteria	2937610967	2937611459	126
39	iso_pu_bacteria	2939589442	2939592051	126
40	iso_pu_bacteria	2939622612	2939626318	126
41	iso_pu_bacteria	2939626828	2939630437	126
42	iso_pu_bacteria	2941475908	2941477101	126
43	iso_pu_bacteria	2941489479	2941494293	126
44	iso_pu_bacteria	2961047084	2961047392	126
45	iso_pu_bacteria	2961064222	2961068182	126
46	iso_pu_bacteria	2974307012	2974309776	126
47	iso_pu_bacteria	2977247770	2977250523	126
48	iso_pu_bacteria	2984514374	2984515010	126
49	iso_pu_bacteria	2987605356	2987607816	126
50	iso_pu_bacteria	2995948881	2995952948	126
51	iso_pu_bacteria	8002869464	8002869700	126
52	iso_pu_bacteria	8003014200	8003016742	126
53	iso_pu_bacteria	8021622325	8021623829	126
54	iso_pu_bacteria	8021626552	8021628423	126
55	iso_pu_bacteria	8021648035	8021650343	126
56	3300005293	Ga0065715_10000130	Ga0065715_100001301	127
57	3300041453	Ga0451797_0665997	Ga0451797_0665997_62_523	128
58	2162886007	SwRhRL2b_contig_145288	SwRhRL2b_0907.00000380	130
59	2162886007	SwRhRL2b_contig_1607524	SwRhRL2b_0512.00000120	130
60	3300003187	JGI25151J46595_10000351	JGI25151J46595_1000035151	130
61	3300003187	JGI25151J46595_10070674	JGI25151J46595_100706742	130
62	3300003215	JGI25153J46596_10000219	JGI25153J46596_1000021951	130
63	3300003323	rootH1_10228024	rootH1_102280243	130
64	3300003773	Ga0055537_1000017	Ga0055537_100001784	130
65	3300003773	Ga0055537_1001080	Ga0055537_10010805	130
66	3300003775	Ga0055524_1000280	Ga0055524_100028011	130
67	3300003775	Ga0055524_1031360	Ga0055524_10313603	130
68	3300003775	Ga0055524_1033724	Ga0055524_10337243	130
69	3300003781	Ga0055536_1004171	Ga0055536_10041711	130
70	3300003781	Ga0055536_1041947	Ga0055536_10419471	130
71	3300003781	Ga0055536_1044032	Ga0055536_10440321	130
72	3300003784	Ga0055534_1000163	Ga0055534_100016312	130
73	3300003784	Ga0055534_1000267	Ga0055534_10002676	130
74	3300003790	Ga0055528_1000182	Ga0055528_100018240	130
75	3300003790	Ga0055528_1000204	Ga0055528_100020411	130
76	3300003790	Ga0055528_1060258	Ga0055528_10602581	130
77	3300003791	Ga0055530_10001486	Ga0055530_1000148620	130
78	3300003791	Ga0055530_10003762	Ga0055530_100037624	130
79	3300003791	Ga0055530_10031900	Ga0055530_100319003	130
80	3300003792	Ga0055540_1074488	Ga0055540_10744882	130
81	3300003792	Ga0055540_1078364	Ga0055540_10783641	130
82	3300003794	Ga0055531_10019722	Ga0055531_100197223	130
83	3300003794	Ga0055531_10041423	Ga0055531_100414232	130
84	3300003794	Ga0055531_10047038	Ga0055531_100470383	130
85	3300003794	Ga0055531_10049929	Ga0055531_100499292	130
86	3300003794	Ga0055531_10051940	Ga0055531_100519401	130
87	3300003856	Ga0058692_1000022	Ga0058692_100002272	130
88	3300005289	Ga0065704_10070357	Ga0065704_1007035728	130
89	3300005289	Ga0065704_10074981	Ga0065704_100749817	130
90	3300005289	Ga0065704_10221981	Ga0065704_102219812	130
91	3300005289	Ga0065704_10314415	Ga0065704_103144151	130
92	3300005293	Ga0065715_10101892	Ga0065715_101018924	130
93	3300005293	Ga0065715_10221683	Ga0065715_102216832	130
94	3300005293	Ga0065715_10437975	Ga0065715_104379752	130
95	3300005293	Ga0065715_10454641	Ga0065715_104546412	130
96	3300005293	Ga0065715_10855805	Ga0065715_108558052	130
97	3300005329	Ga0070683_100156980	Ga0070683_1001569801	130
98	3300005331	Ga0070670_100007587	Ga0070670_10000758710	130
99	3300005331	Ga0070670_100090613	Ga0070670_1000906133	130
100	3300005331	Ga0070670_100739328	Ga0070670_1007393282	130
101	3300005331	Ga0070670_101030786	Ga0070670_1010307862	130
102	3300005333	Ga0070677_10166218	Ga0070677_101662182	130
103	3300005339	Ga0070660_100108406	Ga0070660_1001084062	130
104	3300005343	Ga0070687_100096593	Ga0070687_1000965933	130
105	3300005344	Ga0070661_100797280	Ga0070661_1007972802	130
106	3300005344	Ga0070661_101189195	Ga0070661_1011891952	130
107	3300005345	Ga0070692_10109580	Ga0070692_101095802	130
108	3300005347	Ga0070668_100099203	Ga0070668_1000992033	130
109	3300005347	Ga0070668_100851326	Ga0070668_1008513262	130
110	3300005347	Ga0070668_100905910	Ga0070668_1009059102	130
111	3300005353	Ga0070669_100426526	Ga0070669_1004265263	130
112	3300005353	Ga0070669_100593822	Ga0070669_1005938221	130
113	3300005353	Ga0070669_101063888	Ga0070669_1010638882	130
114	3300005353	Ga0070669_101434063	Ga0070669_1014340632	130
115	3300005354	Ga0070675_100097656	Ga0070675_1000976563	130
116	3300005354	Ga0070675_100533375	Ga0070675_1005333752	130
117	3300005354	Ga0070675_102070403	Ga0070675_1020704031	130
118	3300005355	Ga0070671_100077750	Ga0070671_1000777503	130
119	3300005355	Ga0070671_100083169	Ga0070671_1000831691	130
120	3300005355	Ga0070671_100476787	Ga0070671_1004767872	130
121	3300005364	Ga0070673_100131053	Ga0070673_1001310533	130
122	3300005364	Ga0070673_100345828	Ga0070673_1003458282	130
123	3300005367	Ga0070667_100133831	Ga0070667_1001338313	130
124	3300005435	Ga0070714_100055744	Ga0070714_1000557442	130
125	3300005455	Ga0070663_100260362	Ga0070663_1002603623	130
126	3300005456	Ga0070678_100078660	Ga0070678_1000786603	130
127	3300005456	Ga0070678_100429071	Ga0070678_1004290712	130
128	3300005530	Ga0070679_100078856	Ga0070679_1000788563	130
129	3300005530	Ga0070679_100219425	Ga0070679_1002194252	130
130	3300005539	Ga0068853_100482226	Ga0068853_1004822262	130
131	3300005543	Ga0070672_100008108	Ga0070672_1000081085	130
132	3300005543	Ga0070672_101380071	Ga0070672_1013800712	130
133	3300005547	Ga0070693_100067849	Ga0070693_1000678493	130
134	3300005548	Ga0070665_100016620	Ga0070665_1000166209	130
135	3300005548	Ga0070665_101960092	Ga0070665_1019600921	130
136	3300005548	Ga0070665_102333866	Ga0070665_1023338662	130
137	3300005563	Ga0068855_101326559	Ga0068855_1013265591	130
138	3300005563	Ga0068855_101413332	Ga0068855_1014133322	130
139	3300005564	Ga0070664_100244715	Ga0070664_1002447152	130
140	3300005564	Ga0070664_100516671	Ga0070664_1005166712	130
141	3300005564	Ga0070664_101023070	Ga0070664_1010230702	130
142	3300005618	Ga0068864_100226667	Ga0068864_1002266672	130
143	3300005844	Ga0068862_100207520	Ga0068862_1002075203	130
144	3300005844	Ga0068862_100235456	Ga0068862_1002354562	130
145	3300005985	Ga0081539_10052951	Ga0081539_100529513	130
146	3300006038	Ga0075365_10025358	Ga0075365_100253582	130
147	3300006038	Ga0075365_10633690	Ga0075365_106336902	130
148	3300006042	Ga0075368_10263691	Ga0075368_102636912	130
149	3300006048	Ga0075363_100110766	Ga0075363_1001107661	130
150	3300006048	Ga0075363_100176930	Ga0075363_1001769303	130
151	3300006051	Ga0075364_10000531	Ga0075364_1000053124	130
152	3300006051	Ga0075364_10046386	Ga0075364_100463863	130
153	3300006051	Ga0075364_10065891	Ga0075364_100658913	130
154	3300006051	Ga0075364_10104237	Ga0075364_101042373	130
155	3300006051	Ga0075364_10116412	Ga0075364_101164121	130
156	3300006051	Ga0075364_10141940	Ga0075364_101419402	130
157	3300006051	Ga0075364_10624706	Ga0075364_106247061	130
158	3300006051	Ga0075364_10957258	Ga0075364_109572581	130
159	3300006177	Ga0075362_10094966	Ga0075362_100949663	130
160	3300006178	Ga0075367_10243581	Ga0075367_102435812	130
161	3300006195	Ga0075366_10326750	Ga0075366_103267503	130
162	3300006948	Ga0099826_10359808	Ga0099826_103598082	130
163	3300009011	Ga0105251_10000013	Ga0105251_10000013105	130
164	3300009011	Ga0105251_10002785	Ga0105251_1000278517	130
165	3300009036	Ga0105244_10069296	Ga0105244_100692961	130
166	3300009036	Ga0105244_10095776	Ga0105244_100957762	130
167	3300009098	Ga0105245_10586860	Ga0105245_105868602	130
168	3300009148	Ga0105243_10002714	Ga0105243_1000271416	130
169	3300009148	Ga0105243_10009159	Ga0105243_100091597	130
170	3300009148	Ga0105243_10172641	Ga0105243_101726413	130
171	3300009174	Ga0105241_11457988	Ga0105241_114579882	130
172	3300009177	Ga0105248_11929884	Ga0105248_119298842	130
173	3300012482	Ga0157318_1001556	Ga0157318_10015562	130
174	3300012500	Ga0157314_1001472	Ga0157314_10014723	130
175	3300012500	Ga0157314_1004912	Ga0157314_10049122	130
176	3300012510	Ga0157316_1009165	Ga0157316_10091652	130
177	3300012512	Ga0157327_1000338	Ga0157327_10003383	130
178	3300012512	Ga0157327_1020048	Ga0157327_10200482	130
179	3300013100	Ga0157373_10184015	Ga0157373_101840152	130
180	3300013100	Ga0157373_10605775	Ga0157373_106057752	130
181	3300013100	Ga0157373_11419004	Ga0157373_114190041	130
182	3300013102	Ga0157371_10002186	Ga0157371_100021867	130
183	3300013102	Ga0157371_10016935	Ga0157371_100169353	130
184	3300013102	Ga0157371_10020416	Ga0157371_100204163	130
185	3300013102	Ga0157371_10046400	Ga0157371_100464003	130
186	3300013102	Ga0157371_10133805	Ga0157371_101338051	130
187	3300013104	Ga0157370_10010646	Ga0157370_100106463	130
188	3300013104	Ga0157370_10112942	Ga0157370_101129423	130
189	3300013105	Ga0157369_10112963	Ga0157369_101129633	130
190	3300013306	Ga0163162_12193095	Ga0163162_121930952	130
191	3300013306	Ga0163162_12714299	Ga0163162_127142991	130
192	3300013307	Ga0157372_10138095	Ga0157372_101380952	130
193	3300013307	Ga0157372_10368776	Ga0157372_103687762	130
194	3300013307	Ga0157372_10909696	Ga0157372_109096962	130
195	3300013307	Ga0157372_12175401	Ga0157372_121754011	130
196	3300013308	Ga0157375_10199755	Ga0157375_101997552	130
197	3300013308	Ga0157375_10941185	Ga0157375_109411852	130
198	3300014497	Ga0182008_10000096	Ga0182008_1000009666	130
199	3300014497	Ga0182008_10001301	Ga0182008_1000130120	130
200	3300014497	Ga0182008_10030840	Ga0182008_100308401	130
201	3300014745	Ga0157377_10319837	Ga0157377_103198372	130
202	3300014969	Ga0157376_10578350	Ga0157376_105783502	130
203	3300015261	Ga0182006_1008250	Ga0182006_10082506	130
204	3300015261	Ga0182006_1008605	Ga0182006_10086053	130
205	3300015261	Ga0182006_1063799	Ga0182006_10637992	130
206	3300015262	Ga0182007_10000048	Ga0182007_1000004893	130
207	3300015265	Ga0182005_1011604	Ga0182005_10116042	130
208	3300017792	Ga0163161_10030249	Ga0163161_100302493	130
209	3300017792	Ga0163161_10449619	Ga0163161_104496192	130
210	3300017792	Ga0163161_10609356	Ga0163161_106093561	130
211	3300017792	Ga0163161_10939047	Ga0163161_109390472	130
212	3300025245	Ga0207425_1000111	Ga0207425_100011132	130
213	3300025245	Ga0207425_1003198	Ga0207425_10031982	130
214	3300025245	Ga0207425_1026892	Ga0207425_10268922	130
215	3300025258	Ga0209129_1000087	Ga0209129_1000087145	130
216	3300025263	Ga0209565_1000005	Ga0209565_1000005850	130
217	3300025263	Ga0209565_1000031	Ga0209565_1000031148	130
218	3300025273	Ga0209673_1000011	Ga0209673_1000011505	130
219	3300025273	Ga0209673_1000164	Ga0209673_100016471	130
220	3300025273	Ga0209673_1004282	Ga0209673_10042823	130
221	3300025273	Ga0209673_1064512	Ga0209673_10645123	130
222	3300025284	Ga0209130_1002494	Ga0209130_10024949	130
223	3300025284	Ga0209130_1005265	Ga0209130_10052654	130
224	3300025291	Ga0209675_1000004	Ga0209675_1000004850	130
225	3300025291	Ga0209675_1000015	Ga0209675_1000015247	130
226	3300025291	Ga0209675_1015895	Ga0209675_10158951	130
227	3300025292	Ga0209676_1000027	Ga0209676_1000027213	130
228	3300025292	Ga0209676_1000037	Ga0209676_1000037322	130
229	3300025292	Ga0209676_1000110	Ga0209676_1000110175	130
230	3300025292	Ga0209676_1001028	Ga0209676_100102825	130
231	3300025292	Ga0209676_1001231	Ga0209676_100123120	130
232	3300025292	Ga0209676_1005673	Ga0209676_10056734	130
233	3300025292	Ga0209676_1089497	Ga0209676_10894972	130
234	3300025294	Ga0209025_1000013	Ga0209025_1000013428	130
235	3300025294	Ga0209025_1000023	Ga0209025_1000023122	130
236	3300025294	Ga0209025_1007002	Ga0209025_10070028	130
237	3300025294	Ga0209025_1042768	Ga0209025_10427683	130
238	3300025294	Ga0209025_1095496	Ga0209025_10954962	130
239	3300025295	Ga0209564_1000018	Ga0209564_1000018505	130
240	3300025295	Ga0209564_1000037	Ga0209564_1000037122	130
241	3300025295	Ga0209564_1008868	Ga0209564_10088683	130
242	3300025297	Ga0209758_1000014	Ga0209758_1000014428	130
243	3300025297	Ga0209758_1018562	Ga0209758_10185622	130
244	3300025297	Ga0209758_1037036	Ga0209758_10370363	130
245	3300025298	Ga0209050_1000417	Ga0209050_100041769	130
246	3300025298	Ga0209050_1001410	Ga0209050_100141020	130
247	3300025298	Ga0209050_1002473	Ga0209050_10024732	130
248	3300025298	Ga0209050_1015285	Ga0209050_10152855	130
249	3300025298	Ga0209050_1035653	Ga0209050_10356532	130
250	3300025298	Ga0209050_1046599	Ga0209050_10465992	130
251	3300025299	Ga0209256_1000021	Ga0209256_1000021453	130
252	3300025299	Ga0209256_1002158	Ga0209256_10021587	130
253	3300025299	Ga0209256_1002613	Ga0209256_100261318	130
254	3300025299	Ga0209256_1008601	Ga0209256_10086016	130
255	3300025299	Ga0209256_1015165	Ga0209256_10151651	130
256	3300025302	Ga0207426_1054690	Ga0207426_10546901	130
257	3300025303	Ga0209051_1001882	Ga0209051_10018824	130
258	3300025303	Ga0209051_1039697	Ga0209051_10396972	130
259	3300025304	Ga0209257_1000129	Ga0209257_1000129175	130
260	3300025304	Ga0209257_1000274	Ga0209257_100027412	130
261	3300025304	Ga0209257_1000476	Ga0209257_100047620	130
262	3300025304	Ga0209257_1000623	Ga0209257_100062337	130
263	3300025304	Ga0209257_1000670	Ga0209257_100067046	130
264	3300025304	Ga0209257_1001580	Ga0209257_100158013	130
265	3300025728	Ga0207655_1117845	Ga0207655_11178452	130
266	3300025735	Ga0207713_1000262	Ga0207713_100026221	130
267	3300025735	Ga0207713_1037920	Ga0207713_10379202	130
268	3300025909	Ga0207705_10213150	Ga0207705_102131502	130
269	3300025918	Ga0207662_10262477	Ga0207662_102624772	130
270	3300025918	Ga0207662_10626290	Ga0207662_106262902	130
271	3300025919	Ga0207657_10031869	Ga0207657_100318693	130
272	3300025920	Ga0207649_10425246	Ga0207649_104252462	130
273	3300025920	Ga0207649_10796446	Ga0207649_107964461	130
274	3300025920	Ga0207649_10858377	Ga0207649_108583771	130
275	3300025921	Ga0207652_10505886	Ga0207652_105058862	130
276	3300025923	Ga0207681_10418352	Ga0207681_104183523	130
277	3300025923	Ga0207681_10500011	Ga0207681_105000113	130
278	3300025923	Ga0207681_10587324	Ga0207681_105873243	130
279	3300025925	Ga0207650_10025955	Ga0207650_100259553	130
280	3300025925	Ga0207650_10187016	Ga0207650_101870161	130
281	3300025925	Ga0207650_10474272	Ga0207650_104742722	130
282	3300025926	Ga0207659_10046804	Ga0207659_100468043	130
283	3300025926	Ga0207659_10554299	Ga0207659_105542992	130
284	3300025927	Ga0207687_11465595	Ga0207687_114655951	130
285	3300025929	Ga0207664_10345313	Ga0207664_103453133	130
286	3300025931	Ga0207644_10316163	Ga0207644_103161632	130
287	3300025932	Ga0207690_10395037	Ga0207690_103950373	130
288	3300025935	Ga0207709_10001341	Ga0207709_100013417	130
289	3300025935	Ga0207709_10005980	Ga0207709_100059806	130
290	3300025935	Ga0207709_10142292	Ga0207709_101422923	130
291	3300025940	Ga0207691_10033973	Ga0207691_100339732	130
292	3300025940	Ga0207691_10307624	Ga0207691_103076243	130
293	3300025941	Ga0207711_11125536	Ga0207711_111255362	130
294	3300025942	Ga0207689_10859876	Ga0207689_108598761	130
295	3300025944	Ga0207661_10380931	Ga0207661_103809313	130
296	3300025945	Ga0207679_10061845	Ga0207679_100618452	130
297	3300025945	Ga0207679_10923269	Ga0207679_109232692	130
298	3300025949	Ga0207667_10743076	Ga0207667_107430762	130
299	3300025960	Ga0207651_10406901	Ga0207651_104069011	130
300	3300025972	Ga0207668_10225207	Ga0207668_102252071	130
301	3300025972	Ga0207668_10276307	Ga0207668_102763071	130
302	3300025972	Ga0207668_10481292	Ga0207668_104812922	130
303	3300026067	Ga0207678_10157423	Ga0207678_101574232	130
304	3300026095	Ga0207676_10408612	Ga0207676_104086121	130
305	3300026121	Ga0207683_10028247	Ga0207683_100282474	130
306	3300026121	Ga0207683_10787956	Ga0207683_107879562	130
307	3300027312	Ga0209371_1000004	Ga0209371_1000004855	130
308	3300027312	Ga0209371_1000011	Ga0209371_1000011590	130
309	3300027552	Ga0209982_1023758	Ga0209982_10237582	130
310	3300027614	Ga0209970_1002871	Ga0209970_10028714	130
311	3300027617	Ga0210002_1006342	Ga0210002_10063422	130
312	3300027665	Ga0209983_1000436	Ga0209983_10004363	130
313	3300027682	Ga0209971_1008762	Ga0209971_10087622	130
314	3300027866	Ga0209813_10269388	Ga0209813_102693882	130
315	3300027876	Ga0209974_10009471	Ga0209974_100094712	130
316	3300027876	Ga0209974_10017936	Ga0209974_100179363	130
317	3300028379	Ga0268266_10059786	Ga0268266_100597863	130
318	3300028379	Ga0268266_11690038	Ga0268266_116900381	130
319	3300028380	Ga0268265_10096628	Ga0268265_100966283	130
320	3300028380	Ga0268265_11356389	Ga0268265_113563892	130
321	3300028794	Ga0307515_10093168	Ga0307515_100931685	130
322	3300030500	Ga0268256_1000005	Ga0268256_1000005192	130
323	3300030500	Ga0268256_1000011	Ga0268256_1000011590	130
324	3300030732	Ga0316176_1013813	Ga0316176_10138132	130
325	3300030732	Ga0316176_1040133	Ga0316176_10401332	130
326	3300030733	Ga0314311_1082679	Ga0314311_10826793	130
327	3300030733	Ga0314311_1099232	Ga0314311_10992323	130
328	3300030733	Ga0314311_1152756	Ga0314311_11527562	130
329	3300030734	Ga0316179_1071168	Ga0316179_10711682	130
330	3300030736	Ga0316180_1139485	Ga0316180_11394853	130
331	3300030742	Ga0316183_1083391	Ga0316183_10833919	130
332	3300030744	Ga0316181_1005833	Ga0316181_10058333	130
333	3300030745	Ga0316182_1061642	Ga0316182_10616422	130
334	3300030745	Ga0316182_1118087	Ga0316182_11180873	130
335	3300031456	Ga0307513_10000456	Ga0307513_1000045632	130
336	3300031456	Ga0307513_10151000	Ga0307513_101510002	130
337	3300031548	Ga0307408_100063608	Ga0307408_1000636084	130
338	3300031548	Ga0307408_100115116	Ga0307408_1001151163	130
339	3300031548	Ga0307408_100538974	Ga0307408_1005389741	130
340	3300031548	Ga0307408_101024002	Ga0307408_1010240021	130
341	3300031548	Ga0307408_101813987	Ga0307408_1018139871	130
342	3300031731	Ga0307405_10109557	Ga0307405_101095571	130
343	3300031731	Ga0307405_10229291	Ga0307405_102292912	130
344	3300031731	Ga0307405_10338901	Ga0307405_103389012	130
345	3300031731	Ga0307405_10379378	Ga0307405_103793782	130
346	3300031731	Ga0307405_10603413	Ga0307405_106034132	130
347	3300031731	Ga0307405_10619922	Ga0307405_106199221	130
348	3300031731	Ga0307405_10620170	Ga0307405_106201703	130
349	3300031824	Ga0307413_10040386	Ga0307413_100403864	130
350	3300031824	Ga0307413_10042618	Ga0307413_100426183	130
351	3300031824	Ga0307413_10108966	Ga0307413_101089662	130
352	3300031824	Ga0307413_10151902	Ga0307413_101519023	130
353	3300031824	Ga0307413_10201006	Ga0307413_102010063	130
354	3300031824	Ga0307413_10492005	Ga0307413_104920052	130
355	3300031824	Ga0307413_10780594	Ga0307413_107805942	130
356	3300031824	Ga0307413_11733344	Ga0307413_117333441	130
357	3300031852	Ga0307410_10263814	Ga0307410_102638142	130
358	3300031852	Ga0307410_10329113	Ga0307410_103291133	130
359	3300031852	Ga0307410_10675313	Ga0307410_106753132	130
360	3300031901	Ga0307406_10019842	Ga0307406_100198423	130
361	3300031901	Ga0307406_10089496	Ga0307406_100894961	130
362	3300031901	Ga0307406_10267793	Ga0307406_102677932	130
363	3300031901	Ga0307406_11770910	Ga0307406_117709101	130
364	3300031903	Ga0307407_10327941	Ga0307407_103279412	130
365	3300031911	Ga0307412_10055820	Ga0307412_100558203	130
366	3300031911	Ga0307412_10070447	Ga0307412_100704473	130
367	3300031911	Ga0307412_10093932	Ga0307412_100939323	130
368	3300031911	Ga0307412_10411830	Ga0307412_104118302	130
369	3300031911	Ga0307412_10593402	Ga0307412_105934022	130
370	3300031911	Ga0307412_11074673	Ga0307412_110746732	130
371	3300031995	Ga0307409_100748946	Ga0307409_1007489463	130
372	3300031995	Ga0307409_100828353	Ga0307409_1008283533	130
373	3300032002	Ga0307416_100342918	Ga0307416_1003429181	130
374	3300032002	Ga0307416_100421204	Ga0307416_1004212042	130
375	3300032002	Ga0307416_100804449	Ga0307416_1008044492	130
376	3300032002	Ga0307416_101614369	Ga0307416_1016143692	130
377	3300032004	Ga0307414_10000215	Ga0307414_100002155	130
378	3300032004	Ga0307414_10008172	Ga0307414_100081724	130
379	3300032004	Ga0307414_10010308	Ga0307414_100103082	130
380	3300032004	Ga0307414_10034606	Ga0307414_100346065	130
381	3300032004	Ga0307414_10057247	Ga0307414_100572472	130
382	3300032004	Ga0307414_10060466	Ga0307414_100604663	130
383	3300032004	Ga0307414_10087610	Ga0307414_100876103	130
384	3300032004	Ga0307414_10094649	Ga0307414_100946493	130
385	3300032004	Ga0307414_10097637	Ga0307414_100976373	130
386	3300032004	Ga0307414_10131946	Ga0307414_101319463	130
387	3300032004	Ga0307414_10236817	Ga0307414_102368173	130
388	3300032004	Ga0307414_10412772	Ga0307414_104127721	130
389	3300032004	Ga0307414_10431588	Ga0307414_104315882	130
390	3300032004	Ga0307414_10526910	Ga0307414_105269102	130
391	3300032004	Ga0307414_10536649	Ga0307414_105366492	130
392	3300032004	Ga0307414_10585435	Ga0307414_105854351	130
393	3300032004	Ga0307414_10703540	Ga0307414_107035402	130
394	3300032004	Ga0307414_10714026	Ga0307414_107140261	130
395	3300032004	Ga0307414_10917469	Ga0307414_109174692	130
396	3300032004	Ga0307414_11217374	Ga0307414_112173742	130
397	3300032004	Ga0307414_11375990	Ga0307414_113759901	130
398	3300032004	Ga0307414_11714309	Ga0307414_117143091	130
399	3300032005	Ga0307411_10010665	Ga0307411_100106653	130
400	3300032005	Ga0307411_10012920	Ga0307411_100129203	130
401	3300032005	Ga0307411_10263994	Ga0307411_102639942	130
402	3300032005	Ga0307411_10315419	Ga0307411_103154191	130
403	3300032005	Ga0307411_10456120	Ga0307411_104561203	130
404	3300032005	Ga0307411_11196792	Ga0307411_111967922	130
405	3300032005	Ga0307411_11344826	Ga0307411_113448261	130
406	3300035691	Ga0373931_0397026	Ga0373931_0397026_260_652	130
407	3300037312	Ga0395899_0031827	Ga0395899_0031827_2252_2644	130
408	3300037312	Ga0395899_0304250	Ga0395899_0304250_593_985	130
409	3300037418	Ga0395900_0190389	Ga0395900_0190389_425_817	130
410	3300037418	Ga0395900_0281014	Ga0395900_0281014_605_997	130
411	3300037418	Ga0395900_1208256	Ga0395900_1208256_97_489	130
412	3300037466	Ga0395898_0044160	Ga0395898_0044160_3022_3414	130
413	3300037466	Ga0395898_0149069	Ga0395898_0149069_1602_1994	130
414	3300037466	Ga0395898_0153769	Ga0395898_0153769_1156_1548	130
415	3300037471	Ga0395905_0002340	Ga0395905_0002340_19779_20171	130
416	3300037471	Ga0395905_0084974	Ga0395905_0084974_989_1381	130
417	3300037471	Ga0395905_0149371	Ga0395905_0149371_955_1347	130
418	3300037471	Ga0395905_1694179	Ga0395905_1694179_124_516	130
419	3300038443	Ga0395901_0002043	Ga0395901_0002043_19665_20057	130
420	3300038443	Ga0395901_0591938	Ga0395901_0591938_457_849	130
421	3300038705	Ga0237819_00040	Ga0237819_00040_44344_44736	130
422	3300039145	Ga0237816_01328	Ga0237816_01328_594_986	130
423	3300041404	Ga0439436_0006630	Ga0439436_0006630_1404_1796	130
424	3300041404	Ga0439436_0009624	Ga0439436_0009624_504_896	130
425	3300041404	Ga0439436_0027837	Ga0439436_0027837_59_451	130
426	3300041404	Ga0439436_0093051	Ga0439436_0093051_78_470	130
427	3300041404	Ga0439436_0160152	Ga0439436_0160152_44_436	130
428	3300041404	Ga0439436_0233420	Ga0439436_0233420_81_473	130
429	3300041406	Ga0439439_0034156	Ga0439439_0034156_39_431	130
430	3300041406	Ga0439439_0067022	Ga0439439_0067022_27_419	130
431	3300041407	Ga0439447_149128	Ga0439447_149128_79_471	130
432	3300041413	Ga0439465_0001052	Ga0439465_0001052_2515_2907	130
433	3300041413	Ga0439465_0005832	Ga0439465_0005832_1341_1733	130
434	3300041413	Ga0439465_0013607	Ga0439465_0013607_1968_2360	130
435	3300041413	Ga0439465_0170455	Ga0439465_0170455_107_499	130
436	3300041413	Ga0439465_0287444	Ga0439465_0287444_21_413	130
437	3300041441	Ga0451787_065104	Ga0451787_065104_589_981	130
438	3300041443	Ga0451789_0119803	Ga0451789_0119803_203_595	130
439	3300041443	Ga0451789_0940374	Ga0451789_0940374_356_748	130
440	3300041451	Ga0451791_0078721	Ga0451791_0078721_154_546	130
441	3300041451	Ga0451791_1305826	Ga0451791_1305826_391_783	130
442	3300041451	Ga0451791_1500031	Ga0451791_1500031_200_592	130
443	3300041452	Ga0451793_0670350	Ga0451793_0670350_585_977	130
444	3300041452	Ga0451793_1127667	Ga0451793_1127667_379_771	130
445	3300041453	Ga0451797_0164784	Ga0451797_0164784_1022_1414	130
446	3300041453	Ga0451797_0261558	Ga0451797_0261558_61_453	130
447	3300041453	Ga0451797_0654529	Ga0451797_0654529_381_773	130
448	3300041453	Ga0451797_1546842	Ga0451797_1546842_247_639	130
449	3300041453	Ga0451797_1589125	Ga0451797_1589125_1001_1393	130
450	3300041458	Ga0451798_0867166	Ga0451798_0867166_480_872	130
451	3300041459	Ga0451800_0951563	Ga0451800_0951563_73_465	130
452	3300041460	Ga0451802_0280713	Ga0451802_0280713_218_610	130
453	3300041460	Ga0451802_1183978	Ga0451802_1183978_1234_1626	130
454	3300041460	Ga0451802_2076607	Ga0451802_2076607_299_691	130
455	3300041462	Ga0451806_353517	Ga0451806_353517_314_706	130
456	3300041463	Ga0451804_0176025	Ga0451804_0176025_261_653	130
457	3300041463	Ga0451804_1029255	Ga0451804_1029255_352_744	130
458	3300041486	Ga0451807_0517368	Ga0451807_0517368_75_467	130
459	3300041486	Ga0451807_0521648	Ga0451807_0521648_1025_1417	130
460	3300041486	Ga0451807_2077257	Ga0451807_2077257_86_478	130
461	3300041486	Ga0451807_2709952	Ga0451807_2709952_1411_1803	130
462	3300041491	Ga0451833_1413313	Ga0451833_1413313_146_538	130
463	3300041494	Ga0451837_0505909	Ga0451837_0505909_402_794	130
464	3300041494	Ga0451837_0687947	Ga0451837_0687947_1165_1560	130
465	3300041494	Ga0451837_1112552	Ga0451837_1112552_52_444	130
466	3300041496	Ga0451839_1230358	Ga0451839_1230358_264_656	130
467	3300041498	Ga0451841_0105861	Ga0451841_0105861_90_482	130
468	3300041509	Ga0451843_0119036	Ga0451843_0119036_69_461	130
469	3300041509	Ga0451843_0525695	Ga0451843_0525695_231_623	130
470	3300041509	Ga0451843_1288714	Ga0451843_1288714_286_678	130
471	3300041509	Ga0451843_1526773	Ga0451843_1526773_784_1176	130
472	3300041509	Ga0451843_1657836	Ga0451843_1657836_895_1287	130
473	3300041512	Ga0451853_0283292	Ga0451853_0283292_145_537	130
474	3300041512	Ga0451853_0552817	Ga0451853_0552817_130_522	130
475	3300041512	Ga0451853_2504104	Ga0451853_2504104_45_437	130
476	3300041512	Ga0451853_2758808	Ga0451853_2758808_89_481	130
477	3300041512	Ga0451853_2953861	Ga0451853_2953861_30_422	130
478	3300041997	Ga0439431_0120939	Ga0439431_0120939_42_434	130
479	3300041999	Ga0439433_0015296	Ga0439433_0015296_590_982	130
480	3300041999	Ga0439433_0026976	Ga0439433_0026976_366_758	130
481	3300041999	Ga0439433_0038377	Ga0439433_0038377_523_915	130
482	3300041999	Ga0439433_0092066	Ga0439433_0092066_170_562	130
483	3300041999	Ga0439433_0143177	Ga0439433_0143177_152_544	130
484	3300042004	Ga0439445_0007424	Ga0439445_0007424_623_1015	130
485	3300042006	Ga0439432_006888	Ga0439432_006888_816_1208	130
486	3300042006	Ga0439432_013892	Ga0439432_013892_393_785	130
487	3300042006	Ga0439432_032834	Ga0439432_032834_531_923	130
488	3300042007	Ga0439449_0000004	Ga0439449_0000004_11045_11437	130
489	3300042007	Ga0439449_0004225	Ga0439449_0004225_3192_3584	130
490	3300042007	Ga0439449_0011914	Ga0439449_0011914_1490_1882	130
491	3300042007	Ga0439449_0019204	Ga0439449_0019204_2031_2423	130
492	3300042007	Ga0439449_0023109	Ga0439449_0023109_470_862	130
493	3300042007	Ga0439449_0033764	Ga0439449_0033764_237_629	130
494	3300042007	Ga0439449_0042411	Ga0439449_0042411_1240_1632	130
495	3300042007	Ga0439449_0158662	Ga0439449_0158662_394_786	130
496	3300042007	Ga0439449_0205433	Ga0439449_0205433_264_656	130
497	3300042010	Ga0439452_006295	Ga0439452_006295_442_834	130
498	3300042010	Ga0439452_070373	Ga0439452_070373_203_595	130
499	3300042014	Ga0439457_022016	Ga0439457_022016_424_816	130
500	3300042015	Ga0439462_0053569	Ga0439462_0053569_294_686	130
501	3300042015	Ga0439462_0116874	Ga0439462_0116874_291_683	130
502	3300042015	Ga0439462_0135732	Ga0439462_0135732_250_642	130
503	3300042125	Ga0450923_056035	Ga0450923_056035_234_626	130
504	3300042142	Ga0450905_019173	Ga0450905_019173_180_572	130
505	3300042142	Ga0450905_047418	Ga0450905_047418_69_461	130
506	3300042156	Ga0439446_0190118	Ga0439446_0190118_273_665	130
507	3300042435	Ga0439434_0212220	Ga0439434_0212220_202_594	130
508	3300042435	Ga0439434_0280158	Ga0439434_0280158_29_421	130
509	3300042437	Ga0439444_0002879	Ga0439444_0002879_1350_1742	130
510	3300042532	Ga0450893_0032897	Ga0450893_0032897_132_524	130
511	3300042533	Ga0450901_013957	Ga0450901_013957_320_712	130
512	3300042876	Ga0451577_0002652	Ga0451577_0002652_8103_8495	130
513	3300044712	Ga0453684_0193639	Ga0453684_0193639_1512_1904	130
514	3300045976	Ga0466967_0965632	Ga0466967_0965632_122_514	130
515	3300046453	Ga0495627_008906	Ga0495627_008906_2664_3056	130
516	3300046458	Ga0495591_023418	Ga0495591_023418_631_1023	130
517	3300046460	Ga0495638_0000881	Ga0495638_0000881_13813_14205	130
518	3300046460	Ga0495638_0032546	Ga0495638_0032546_1028_1420	130
519	3300046460	Ga0495638_0032950	Ga0495638_0032950_2151_2543	130
520	3300046460	Ga0495638_0134946	Ga0495638_0134946_854_1246	130
521	3300046474	Ga0495605_0299116	Ga0495605_0299116_248_640	130
522	3300046501	Ga0495607_0148583	Ga0495607_0148583_603_995	130
523	3300046507	Ga0495606_0024111	Ga0495606_0024111_3383_3775	130
524	3300046512	Ga0495610_0003046	Ga0495610_0003046_7204_7596	130
525	3300046513	Ga0495616_0037555	Ga0495616_0037555_1391_1783	130
526	3300046513	Ga0495616_0131998	Ga0495616_0131998_631_1023	130
527	3300046518	Ga0495631_0001525	Ga0495631_0001525_8172_8564	130
528	3300046522	Ga0495643_0003922	Ga0495643_0003922_8774_9166	130
529	3300046525	Ga0495663_0003967	Ga0495663_0003967_2717_3109	130
530	3300046525	Ga0495663_0014322	Ga0495663_0014322_1432_1824	130
531	3300046525	Ga0495663_0023647	Ga0495663_0023647_774_1166	130
532	3300046525	Ga0495663_0034967	Ga0495663_0034967_707_1099	130
533	3300046525	Ga0495663_0211450	Ga0495663_0211450_189_581	130
534	3300046537	Ga0495598_0002011	Ga0495598_0002011_3516_3908	130
535	3300046539	Ga0495621_0002263	Ga0495621_0002263_2185_2577	130
536	3300046558	Ga0495633_0026731	Ga0495633_0026731_1662_2054	130
537	3300046558	Ga0495633_0113725	Ga0495633_0113725_47_439	130
538	3300046615	Ga0495656_0001001	Ga0495656_0001001_1560_1952	130
539	3300046615	Ga0495656_0005612	Ga0495656_0005612_1033_1425	130
540	3300046615	Ga0495656_0042488	Ga0495656_0042488_655_1047	130
541	3300046615	Ga0495656_0091210	Ga0495656_0091210_155_547	130
542	3300046660	Ga0495625_0058167	Ga0495625_0058167_83_475	130
543	3300046664	Ga0495659_0007586	Ga0495659_0007586_2576_2968	130
544	3300046691	Ga0495670_0022391	Ga0495670_0022391_1002_1394	130
545	3300046691	Ga0495670_0163502	Ga0495670_0163502_355_747	130
546	3300046691	Ga0495670_0708468	Ga0495670_0708468_52_444	130
547	3300046691	Ga0495670_0747886	Ga0495670_0747886_37_429	130
548	3300046810	Ga0495660_0026745	Ga0495660_0026745_2438_2830	130
549	3300047318	Ga0495636_0001111	Ga0495636_0001111_1935_2327	130
550	3300047318	Ga0495636_0013660	Ga0495636_0013660_873_1265	130
551	3300047318	Ga0495636_0015636	Ga0495636_0015636_1272_1664	130
552	3300047318	Ga0495636_0037231	Ga0495636_0037231_404_796	130
553	3300047320	Ga0495672_0000090	Ga0495672_0000090_52148_52540	130
554	3300047320	Ga0495672_0068871	Ga0495672_0068871_477_869	130
555	3300047447	Ga0495685_053914	Ga0495685_053914_332_724	130
556	3300047472	Ga0495686_0016694	Ga0495686_0016694_4063_4455	130
557	3300048903	Ga0496100_0144285	Ga0496100_0144285_394_786	130
558	3300048904	Ga0496101_0324855	Ga0496101_0324855_570_962	130
559	3300048904	Ga0496101_0423455	Ga0496101_0423455_305_697	130
560	3300048905	Ga0496102_0306391	Ga0496102_0306391_48_440	130
561	3300048905	Ga0496102_1145319	Ga0496102_1145319_256_648	130
562	3300048905	Ga0496102_1414128	Ga0496102_1414128_123_515	130
563	3300048906	Ga0496103_0256302	Ga0496103_0256302_512_904	130
564	3300048908	Ga0496105_0470242	Ga0496105_0470242_154_546	130
565	3300048908	Ga0496105_0768291	Ga0496105_0768291_142_534	130
566	3300048910	Ga0496107_0218038	Ga0496107_0218038_401_793	130
567	3300048911	Ga0496108_0035903	Ga0496108_0035903_2422_2814	130
568	3300048911	Ga0496108_0368749	Ga0496108_0368749_203_595	130
569	3300048912	Ga0496109_0043544	Ga0496109_0043544_3493_3885	130
570	3300048912	Ga0496109_0330037	Ga0496109_0330037_93_485	130
571	3300048912	Ga0496109_1203203	Ga0496109_1203203_106_498	130
572	3300048913	Ga0496110_0071987	Ga0496110_0071987_667_1059	130
573	3300048913	Ga0496110_0224170	Ga0496110_0224170_1133_1525	130
574	3300048914	Ga0496111_0211479	Ga0496111_0211479_503_895	130
575	3300048914	Ga0496111_0221718	Ga0496111_0221718_158_550	130
576	3300048914	Ga0496111_1048628	Ga0496111_1048628_141_533	130
577	3300048915	Ga0496112_0021549	Ga0496112_0021549_2917_3309	130
578	3300048915	Ga0496112_0070274	Ga0496112_0070274_722_1114	130
579	3300048916	Ga0496113_0122362	Ga0496113_0122362_968_1360	130
580	3300048916	Ga0496113_0137369	Ga0496113_0137369_640_1032	130
581	3300048917	Ga0496114_0004378	Ga0496114_0004378_2222_2614	130
582	3300048917	Ga0496114_0173279	Ga0496114_0173279_535_927	130
583	3300048919	Ga0496116_0021188	Ga0496116_0021188_1363_1755	130
584	3300048920	Ga0496117_0000617	Ga0496117_0000617_43300_43692	130
585	3300048920	Ga0496117_0001304	Ga0496117_0001304_15202_15594	130
586	3300048920	Ga0496117_0008591	Ga0496117_0008591_2701_3093	130
587	3300048920	Ga0496117_0057014	Ga0496117_0057014_1259_1651	130
588	3300048921	Ga0496118_0000404	Ga0496118_0000404_67502_67894	130
589	3300048921	Ga0496118_0000737	Ga0496118_0000737_44021_44413	130
590	3300048921	Ga0496118_0044462	Ga0496118_0044462_718_1110	130
591	3300048921	Ga0496118_0049885	Ga0496118_0049885_1397_1789	130
592	3300048921	Ga0496118_0079564	Ga0496118_0079564_1047_1439	130
593	3300048921	Ga0496118_0123503	Ga0496118_0123503_273_665	130
594	3300048922	Ga0496119_0000329	Ga0496119_0000329_24436_24828	130
595	3300048922	Ga0496119_0006232	Ga0496119_0006232_2214_2606	130
596	3300048923	Ga0496120_0000147	Ga0496120_0000147_41454_41846	130
597	3300048923	Ga0496120_0000514	Ga0496120_0000514_19490_19882	130
598	3300048924	Ga0496121_0002594	Ga0496121_0002594_16609_17001	130
599	3300048924	Ga0496121_0135493	Ga0496121_0135493_879_1271	130
600	3300048925	Ga0496122_0000566	Ga0496122_0000566_66730_67122	130
601	3300048925	Ga0496122_0001044	Ga0496122_0001044_27832_28224	130
602	3300048925	Ga0496122_0006535	Ga0496122_0006535_11416_11808	130
603	3300048926	Ga0496123_0000150	Ga0496123_0000150_64025_64417	130
604	3300048926	Ga0496123_0000324	Ga0496123_0000324_38466_38858	130
605	3300048926	Ga0496123_0005924	Ga0496123_0005924_9333_9725	130
606	3300048926	Ga0496123_0051615	Ga0496123_0051615_1395_1787	130
607	3300048927	Ga0496124_0000032	Ga0496124_0000032_95038_95430	130
608	3300048927	Ga0496124_0000680	Ga0496124_0000680_8725_9117	130
609	3300048927	Ga0496124_0001216	Ga0496124_0001216_36109_36501	130
610	3300048927	Ga0496124_0006616	Ga0496124_0006616_5793_6185	130
611	3300048927	Ga0496124_0042671	Ga0496124_0042671_1172_1564	130
612	3300048927	Ga0496124_0117367	Ga0496124_0117367_1350_1742	130
613	3300048928	Ga0496125_0018579	Ga0496125_0018579_2174_2566	130
614	3300048928	Ga0496125_0026103	Ga0496125_0026103_2477_2869	130
615	3300048928	Ga0496125_0064196	Ga0496125_0064196_1256_1648	130
616	3300048928	Ga0496125_0085664	Ga0496125_0085664_467_859	130
617	3300048928	Ga0496125_0120654	Ga0496125_0120654_521_913	130
618	3300048929	Ga0496126_0000967	Ga0496126_0000967_40312_40704	130
619	3300048929	Ga0496126_0011304	Ga0496126_0011304_7688_8080	130
620	3300048929	Ga0496126_0113282	Ga0496126_0113282_1128_1520	130
621	3300048929	Ga0496126_0391783	Ga0496126_0391783_241_633	130
622	3300049515	Ga0501292_029665	Ga0501292_029665_380_772	130
623	3300049568	Ga0501031_0016530	Ga0501031_0016530_651_1043	130
624	3300049570	Ga0501033_0002084	Ga0501033_0002084_5636_6028	130
625	3300049570	Ga0501033_0024972	Ga0501033_0024972_2044_2436	130
626	3300049571	Ga0501034_0000834	Ga0501034_0000834_15849_16241	130
627	3300049571	Ga0501034_0001875	Ga0501034_0001875_4089_4481	130
628	3300049571	Ga0501034_0015913	Ga0501034_0015913_4202_4594	130
629	3300049571	Ga0501034_0193975	Ga0501034_0193975_921_1313	130
630	3300049571	Ga0501034_0691155	Ga0501034_0691155_38_430	130
631	3300049572	Ga0501036_0142199	Ga0501036_0142199_707_1099	130
632	3300049573	Ga0501037_0046698	Ga0501037_0046698_1248_1640	130
633	3300049574	Ga0501038_0015316	Ga0501038_0015316_3894_4286	130
634	3300049575	Ga0501039_0027266	Ga0501039_0027266_1349_1741	130
635	3300049579	Ga0501043_0001713	Ga0501043_0001713_3891_4283	130
636	3300049579	Ga0501043_0120368	Ga0501043_0120368_268_660	130
637	3300049580	Ga0501046_0735439	Ga0501046_0735439_123_515	130
638	3300049581	Ga0501047_0163739	Ga0501047_0163739_449_841	130
639	3300049586	Ga0501070_0037650	Ga0501070_0037650_2507_2899	130
640	3300049652	Ga0501202_069973	Ga0501202_069973_336_728	130
641	3300049661	Ga0501217_143909	Ga0501217_143909_38_430	130
642	3300049680	Ga0501250_097114	Ga0501250_097114_45_437	130
643	3300049682	Ga0501252_047908	Ga0501252_047908_115_507	130
644	3300049683	Ga0501253_088264	Ga0501253_088264_117_509	130
645	3300049686	Ga0501257_073267	Ga0501257_073267_199_591	130
646	3300049688	Ga0501259_157474	Ga0501259_157474_159_551	130
647	3300049705	Ga0501225_0002344	Ga0501225_0002344_1943_2335	130
648	3300049705	Ga0501225_0044022	Ga0501225_0044022_465_857	130
649	3300049705	Ga0501225_0072096	Ga0501225_0072096_516_908	130
650	3300049742	Ga0501080_0417350	Ga0501080_0417350_680_1072	130
651	3300049758	Ga0501241_097064	Ga0501241_097064_210_602	130
652	3300049760	Ga0501263_049582	Ga0501263_049582_188_580	130
653	3300049763	Ga0501266_102366	Ga0501266_102366_55_447	130
654	3300049765	Ga0501268_083792	Ga0501268_083792_41_433	130
655	3300049767	Ga0501270_128593	Ga0501270_128593_125_517	130
656	3300049775	Ga0501279_031641	Ga0501279_031641_345_737	130
657	3300049822	Ga0501035_0061152	Ga0501035_0061152_680_1072	130
658	3300049823	Ga0501044_0147113	Ga0501044_0147113_1421_1813	130
659	3300049823	Ga0501044_0691739	Ga0501044_0691739_452_844	130
660	3300050490	nmdc:mga03n38_267386_c1	nmdc:mga03n38_267386_c1_41_433	130
661	3300050490	nmdc:mga03n38_927393_c1	nmdc:mga03n38_927393_c1_51_443	130
662	3300050491	nmdc:mga00v17_107765_c1	nmdc:mga00v17_107765_c1_653_1045	130
663	3300050491	nmdc:mga00v17_16162_c1	nmdc:mga00v17_16162_c1_2586_2978	130
664	3300050491	nmdc:mga00v17_20979_c1	nmdc:mga00v17_20979_c1_3150_3542	130
665	3300050491	nmdc:mga00v17_312760_c1	nmdc:mga00v17_312760_c1_530_922	130
666	3300050491	nmdc:mga00v17_694151_c1	nmdc:mga00v17_694151_c1_44_436	130
667	3300050492	nmdc:mga0yw44_181472_c1	nmdc:mga0yw44_181472_c1_676_1068	130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03610

EIIA-man

PTS system fructose IIA component

59

141

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3ipr-assembly1.cif.gz_A	crystal structure of the enterococcus faecalis gluconate specific eiia phosphotransferase system component	0.907	3	119
2jzo-assembly1.cif.gz_A	solution nmr structure of the non-productive complex between iiamannose and iibmannose of the mannose transporter of the e. coli phosphotransferase system	0.8597	3	126
3lfh-assembly1.cif.gz_B	crystal structure of manxa from thermoanaerobacter tengcongensis	0.8596	3	119
3lfh-assembly2.cif.gz_D	crystal structure of manxa from thermoanaerobacter tengcongensis	0.8594	1	119
3bed-assembly1.cif.gz_A	mannose/sorbose specific iia subunit of phosphotransferase system from enterococcus faecalis	0.8573	1	119

ID	Description	Score	Start	End	Superfamily
af_P36881_1_135_3.40.50.510	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphotransferase system, mannose-type IIA component	0.9076	3	127	3.40.50.510
3iprA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphotransferase system, mannose-type IIA component	0.907	3	119	3.40.50.510
af_P36881_1_135_3.40.50.510	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphotransferase system, mannose-type IIA component	0.8687	3	127	3.40.50.510
3lfhE00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphotransferase system, mannose-type IIA component	0.8526	3	119	3.40.50.510
2jznA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphotransferase system, mannose-type IIA component	0.8348	3	130	3.40.50.510

ID	Description	Score	Start	End	GO Terms
AF-A0A4Q6C378-F1-model_v4	PTS fructose IIA subunit family protein	0.9935	1	115	GO:0009401 GO:0016020 GO:0016740
AF-A0A4Q6C378-F1-model_v4	PTS fructose IIA subunit family protein	0.9766	1	115	GO:0009401 GO:0016020 GO:0016740
AF-A0A836WSK4-F1-model_v4	deleted	0.9497	1	111
AF-A0A7C3HEU3-F1-model_v4	PTS mannose transporter subunit IIA	0.9463	1	113	GO:0009401 GO:0016020 GO:0016740
AF-A0A259P6L9-F1-model_v4	deleted	0.9451	3	120

Feature Viewer

pLDDT	pTM	Quality
91.22	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F473856

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03610

EIIA-man

PTS system fructose IIA component

59

141

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map