F473847

General Info

Members Datasets Scaffolds Average Seq Length
667 519 1334 103

Family's Representative Sequence

Representative Sequence 3300027471|Ga0209995_1089533|Ga0209995_10895331
Length 122
Sequence MSDHPGTAPALPFPMEVSVSWFILFFAGLFEVGWAVGLKYTDGFTRPLPTLLTIAAMLVSLALLGLAMKELPLGTAYAIWTGVGAIGTVIAGILLFGESMALLRLASVALIVCGLLGLKLSH

Samples

Sample ID Description Type Environment
1 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
126 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
127 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
128 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
129 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
130 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
133 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
134 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
138 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
139 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
143 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
192 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
193 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
223 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
226 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
227 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
228 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
229 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
230 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
231 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
232 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
233 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
234 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
239 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
240 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
241 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
242 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
243 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
244 2512875024
245 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
246 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
247 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
248 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
249 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
250 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
251 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
252 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
253 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
254 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
255 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
256 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
257 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
258 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
259 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
260 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
261 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
262 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
263 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
264 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
265 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
266 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
267 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
268 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
269 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
270 2738543024 Aminobacter sp. AP02 Isolate Unclassified
271 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
272 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
273 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
274 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
275 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
276 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
277 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
278 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
279 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
280 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
281 2841760612 Bosea sp. Tri-49 Isolate Nodule
282 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
283 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
284 2844104063 Bosea sp. Tri-39 Isolate Nodule
285 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
286 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
287 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
288 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
289 2851246043 Bosea sp. Tri-54 Isolate Nodule
290 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
291 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
292 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
293 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
294 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
295 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
296 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
297 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
298 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
299 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
300 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
301 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
302 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
303 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
304 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
305 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
306 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
307 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
308 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
309 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
310 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
311 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
312 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
313 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
314 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
315 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
316 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
317 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
318 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
319 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
320 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
321 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
322 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
323 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
324 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
325 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
326 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
327 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
328 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
329 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
330 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
331 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
332 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
333 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
334 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
335 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
336 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
337 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
338 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
339 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
340 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
341 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
342 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
343 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
344 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
345 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
346 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
347 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
348 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
349 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
350 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
351 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
352 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
353 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
354 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
355 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
356 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
357 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
358 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
359 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
360 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
361 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
362 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
363 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
364 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
365 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
366 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
367 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
368 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
369 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
370 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
371 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
372 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
373 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
374 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
375 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
376 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
377 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
378 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
379 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
380 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
381 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
382 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
383 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
384 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
385 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
386 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
387 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
388 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
389 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
390 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
391 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
392 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
393 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
394 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
395 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
396 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
397 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
398 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
399 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
400 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
401 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
402 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
403 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
404 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
405 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
406 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
407 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
408 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
409 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
410 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
411 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
412 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
413 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
414 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
415 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
416 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
417 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
418 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
419 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
420 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
421 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
422 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
423 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
424 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
425 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
426 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
427 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
428 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
429 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
430 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
431 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
432 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
433 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
434 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
435 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
436 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
437 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
438 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
439 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
440 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
441 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
442 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
443 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
444 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
445 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
446 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
447 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
448 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
449 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
450 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
451 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
452 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
453 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
454 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
455 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
456 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
457 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
458 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
459 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
460 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
461 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
462 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
463 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
464 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
465 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
466 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
467 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
468 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
469 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
470 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
471 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
472 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
473 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
474 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
475 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
476 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
477 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
478 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
479 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
480 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
481 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
482 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
483 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
484 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
485 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
486 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
487 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
488 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
489 3004167301 Mesorhizobium loti 582 Isolate Unclassified
490 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
491 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
492 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
493 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
494 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
495 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
496 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
497 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
498 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
499 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
500 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
501 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
502 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
503 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
504 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
505 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
506 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
507 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
508 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
509 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
510 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
511 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
512 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
513 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
514 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
515 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
516 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
517 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
518 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
519 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 56.52
Metatranscriptomes 0.75
Isolates 42.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.1
Nodule 34.63
Rhizoplane 2.55
Rhizosphere 45.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209995_1089533 3300027471 Bacteria 529
2 JGI24740J21852_10015592 3300001979 Bacteria 2769
3 JGI24739J22299_10050392 3300001989 Bacteria 1347
4 JGI24739J22299_10128842 3300001989 Bacteria 753
5 JGI24738J21930_10108690 3300002075 Bacteria 596
6 JGI25157J39369_1001679 3300002741 Bacteria 7515
7 JGI25165J46597_1000079 3300003214 Bacteria 179163
8 Ga0058692_1019929 3300003856 Bacteria 1419
9 Ga0070658_10172227 3300005327 Bacteria 1819
10 Ga0068869_101080949 3300005334 Bacteria 701
11 Ga0070666_10014775 3300005335 Bacteria 4975
12 Ga0068868_102151905 3300005338 Bacteria 531
13 Ga0070660_100334390 3300005339 Bacteria 1246
14 Ga0070661_101253861 3300005344 Bacteria 621
15 Ga0070668_100654199 3300005347 Bacteria 924
16 Ga0070675_100597076 3300005354 Bacteria 1001
17 Ga0070673_102066913 3300005364 Bacteria 541
18 Ga0070659_101089226 3300005366 Bacteria 704
19 Ga0070659_101224581 3300005366 Bacteria 664
20 Ga0070667_100060777 3300005367 Bacteria 3198
21 Ga0070667_100134318 3300005367 Bacteria 2162
22 Ga0070663_100022086 3300005455 Bacteria 4247
23 Ga0070663_100191600 3300005455 Bacteria 1591
24 Ga0070678_100545061 3300005456 Bacteria 1029
25 Ga0068867_102295304 3300005459 Bacteria 513
26 Ga0068853_100035109 3300005539 Bacteria 4258
27 Ga0068853_100471347 3300005539 Bacteria 1183
28 Ga0068853_102001983 3300005539 Bacteria 562
29 Ga0068853_102212895 3300005539 Bacteria 533
30 Ga0070672_100347444 3300005543 Bacteria 1264
31 Ga0070672_101671711 3300005543 Bacteria 572
32 Ga0070665_100835039 3300005548 Bacteria 934
33 Ga0070665_100951035 3300005548 Bacteria 872
34 Ga0068855_100328873 3300005563 Bacteria 1687
35 Ga0068855_100546845 3300005563 Bacteria 1254
36 Ga0068857_100385209 3300005577 Bacteria 1303
37 Ga0068854_100258712 3300005578 Bacteria 1393
38 Ga0068854_100973294 3300005578 Bacteria 750
39 Ga0068856_100111924 3300005614 Bacteria 2727
40 Ga0070702_100414021 3300005615 Bacteria 968
41 Ga0068852_100005379 3300005616 Bacteria 9154
42 Ga0068852_100036885 3300005616 Bacteria 4095
43 Ga0068852_102229852 3300005616 Bacteria 569
44 Ga0068858_101253399 3300005842 Bacteria 729
45 Ga0081455_10291149 3300005937 Bacteria 1175
46 Ga0081539_10178967 3300005985 Bacteria 996
47 Ga0075365_10039080 3300006038 Bacteria 3088
48 Ga0075365_10084187 3300006038 Bacteria 2158
49 Ga0075365_10280608 3300006038 Bacteria 1172
50 Ga0075365_10323859 3300006038 Bacteria 1085
51 Ga0075368_10093396 3300006042 Bacteria 1231
52 Ga0075368_10497880 3300006042 Bacteria 544
53 Ga0075363_100077544 3300006048 Bacteria 1813
54 Ga0075363_100255150 3300006048 Bacteria 1010
55 Ga0075363_100281673 3300006048 Bacteria 962
56 Ga0075364_10279588 3300006051 Bacteria 1135
57 Ga0075367_10028282 3300006178 Bacteria 3197
58 Ga0075367_10767464 3300006178 Bacteria 614
59 Ga0075369_10033833 3300006186 Bacteria 2167
60 Ga0075369_10113279 3300006186 Bacteria 1223
61 Ga0075366_10339930 3300006195 Bacteria 920
62 Ga0075370_10106365 3300006353 Bacteria 1627
63 Ga0075370_10136630 3300006353 Bacteria 1432
64 Ga0075370_10730161 3300006353 Bacteria 602
65 Ga0075429_100707899 3300006880 Bacteria 882
66 Ga0068865_100448118 3300006881 Bacteria 1067
67 Ga0105251_10000123 3300009011 Bacteria 77428
68 Ga0105244_10035745 3300009036 Bacteria 2608
69 Ga0105250_10000166 3300009092 Bacteria 56999
70 Ga0105250_10042936 3300009092 Bacteria 1812
71 Ga0105250_10049177 3300009092 Bacteria 1691
72 Ga0105250_10050160 3300009092 Bacteria 1674
73 Ga0105240_10313292 3300009093 Bacteria 1791
74 Ga0105240_11678837 3300009093 Bacteria 663
75 Ga0105245_11507324 3300009098 Bacteria 723
76 Ga0105243_10017730 3300009148 Bacteria 5385
77 Ga0105237_10031947 3300009545 Bacteria 5331
78 Ga0105237_10089473 3300009545 Bacteria 3068
79 Ga0105238_10337661 3300009551 Bacteria 1494
80 Ga0105238_10898699 3300009551 Bacteria 904
81 Ga0105239_10054482 3300010375 Bacteria 4387
82 Ga0105239_10170436 3300010375 Bacteria 2434
83 Ga0105239_10247035 3300010375 Bacteria 2004
84 Ga0105239_10624974 3300010375 Bacteria 1229
85 Ga0157373_10003566 3300013100 Bacteria 11757
86 Ga0157373_10034114 3300013100 Bacteria 3656
87 Ga0157373_10843234 3300013100 Bacteria 678
88 Ga0157371_10861217 3300013102 Bacteria 685
89 Ga0157371_11205507 3300013102 Bacteria 583
90 Ga0157369_10007408 3300013105 Bacteria 12635
91 Ga0157369_10105438 3300013105 Bacteria 3001
92 Ga0157369_10351780 3300013105 Bacteria 1530
93 Ga0157374_10146089 3300013296 Bacteria 2297
94 Ga0157374_10776125 3300013296 Bacteria 974
95 Ga0163162_10003705 3300013306 Bacteria 14643
96 Ga0163162_11272020 3300013306 Bacteria 836
97 Ga0157372_10603649 3300013307 Bacteria 1279
98 Ga0157375_10294723 3300013308 Bacteria 1785
99 Ga0163163_11895574 3300014325 Bacteria 656
100 Ga0182008_10137468 3300014497 Bacteria 1221
101 Ga0182008_10394533 3300014497 Bacteria 742
102 Ga0182005_1048512 3300015265 Bacteria 1153
103 Ga0213872_10003798 3300021361 Bacteria 8235
104 Ga0213872_10005831 3300021361 Bacteria 6253
105 Ga0213872_10017689 3300021361 Bacteria 3291
106 Ga0209026_1000118 3300025250 Bacteria 130611
107 Ga0209026_1041722 3300025250 Bacteria 664
108 Ga0209148_1000136 3300025254 Bacteria 169088
109 Ga0209759_1000076 3300025256 Bacteria 175911
110 Ga0209233_1000247 3300025261 Bacteria 87890
111 Ga0209233_1049753 3300025261 Bacteria 859
112 Ga0209455_1000085 3300025272 Bacteria 247601
113 Ga0207696_1000141 3300025711 Bacteria 127091
114 Ga0207696_1003011 3300025711 Bacteria 7870
115 Ga0207696_1029207 3300025711 Bacteria 1685
116 Ga0207696_1054349 3300025711 Bacteria 1138
117 Ga0207655_1028637 3300025728 Bacteria 2624
118 Ga0207713_1000085 3300025735 Bacteria 160800
119 Ga0207688_10545273 3300025901 Bacteria 728
120 Ga0207680_10012117 3300025903 Bacteria 4383
121 Ga0207647_10507754 3300025904 Bacteria 672
122 Ga0207685_10845200 3300025905 Bacteria 506
123 Ga0207645_10037798 3300025907 Bacteria 3098
124 Ga0207645_10457564 3300025907 Bacteria 862
125 Ga0207705_10222747 3300025909 Bacteria 1433
126 Ga0207654_10905083 3300025911 Bacteria 640
127 Ga0207695_10838907 3300025913 Bacteria 799
128 Ga0207671_10034394 3300025914 Bacteria 3765
129 Ga0207671_10207965 3300025914 Bacteria 1530
130 Ga0207657_10202931 3300025919 Bacteria 1594
131 Ga0207657_10621851 3300025919 Bacteria 842
132 Ga0207649_11673321 3300025920 Bacteria 504
133 Ga0207694_10029933 3300025924 Bacteria 4157
134 Ga0207694_10286246 3300025924 Bacteria 1355
135 Ga0207694_10427290 3300025924 Bacteria 1104
136 Ga0207690_10033773 3300025932 Bacteria 3292
137 Ga0207690_10756073 3300025932 Bacteria 801
138 Ga0207706_10052845 3300025933 Bacteria 3587
139 Ga0207706_10086919 3300025933 Bacteria 2749
140 Ga0207709_10127057 3300025935 Bacteria 1731
141 Ga0207709_11423657 3300025935 Bacteria 574
142 Ga0207669_10124442 3300025937 Bacteria 1758
143 Ga0207704_10095724 3300025938 Bacteria 1964
144 Ga0207704_10108773 3300025938 Bacteria 1868
145 Ga0207711_10232259 3300025941 Bacteria 1690
146 Ga0207689_10974809 3300025942 Bacteria 715
147 Ga0207667_10379937 3300025949 Bacteria 1439
148 Ga0207651_10918969 3300025960 Bacteria 780
149 Ga0207640_11092716 3300025981 Bacteria 705
150 Ga0207658_10044646 3300025986 Bacteria 3227
151 Ga0207703_10551444 3300026035 Bacteria 1087
152 Ga0207639_10216523 3300026041 Bacteria 1651
153 Ga0207639_10284794 3300026041 Bacteria 1455
154 Ga0207678_10214330 3300026067 Bacteria 1648
155 Ga0207678_10253924 3300026067 Bacteria 1506
156 Ga0207702_10273831 3300026078 Bacteria 1593
157 Ga0207702_10434833 3300026078 Bacteria 1271
158 Ga0207648_10156901 3300026089 Bacteria 2009
159 Ga0207674_10041174 3300026116 Bacteria 4779
160 Ga0207683_10135368 3300026121 Bacteria 2218
161 Ga0207683_10156433 3300026121 Bacteria 2059
162 Ga0207698_10000395 3300026142 Bacteria 25170
163 Ga0207698_10289924 3300026142 Bacteria 1518
164 Ga0207698_11691788 3300026142 Bacteria 648
165 Ga0207698_12012458 3300026142 Bacteria 592
166 Ga0209371_1000433 3300027312 Bacteria 42607
167 Ga0209813_10124787 3300027866 Bacteria 900
168 Ga0268266_10252673 3300028379 Bacteria 1631
169 Ga0268266_10938062 3300028379 Bacteria 837
170 Ga0268256_1000372 3300030500 Bacteria 42556
171 Ga0307513_10157139 3300031456 Bacteria 2172
172 Ga0307408_100000969 3300031548 Bacteria 22245
173 Ga0307408_100062227 3300031548 Bacteria 2727
174 Ga0307405_10952235 3300031731 Bacteria 729
175 Ga0307413_10005276 3300031824 Bacteria 5746
176 Ga0307410_10200253 3300031852 Bacteria 1524
177 Ga0307412_11403618 3300031911 Bacteria 632
178 Ga0307409_100640702 3300031995 Bacteria 1055
179 Ga0307409_100837069 3300031995 Bacteria 930
180 Ga0307416_101465858 3300032002 Bacteria 788
181 Ga0307416_101755050 3300032002 Bacteria 725
182 Ga0307414_10039048 3300032004 Bacteria 3194
183 Ga0307510_10412547 3300033180 Bacteria 793
184 Ga0373931_0014237 3300035691 Bacteria 3885
185 Ga0373925_0679595 3300037068 Bacteria 849
186 Ga0373925_1727340 3300037068 Bacteria 511
187 Ga0395900_0032783 3300037418 Bacteria 5344
188 Ga0395900_0731362 3300037418 Bacteria 921
189 Ga0395900_1496467 3300037418 Bacteria 587
190 Ga0395900_1846884 3300037418 Bacteria 515
191 Ga0395898_0184119 3300037466 Bacteria 1996
192 Ga0395898_0700873 3300037466 Bacteria 954
193 Ga0395905_0001236 3300037471 Bacteria 31740
194 Ga0395905_0024508 3300037471 Bacteria 5694
195 Ga0395905_0477864 3300037471 Bacteria 1145
196 Ga0395905_0582691 3300037471 Bacteria 1020
197 Ga0395901_0177705 3300038443 Bacteria 2232
198 Ga0395901_0246718 3300038443 Bacteria 1861
199 Ga0395901_0401736 3300038443 Bacteria 1408
200 Ga0237819_10912 3300038705 Bacteria 1170
201 Ga0436361_0036409 3300039447 Bacteria 23805
202 Ga0436361_0139111 3300039447 Bacteria 16913
203 Ga0436361_0710706 3300039447 Bacteria 6343
204 Ga0436361_0993359 3300039447 Bacteria 43823
205 Ga0451793_1889980 3300041452 Bacteria 1237
206 Ga0451797_1583900 3300041453 Bacteria 933
207 Ga0451798_0936562 3300041458 Bacteria 539
208 Ga0451839_0620483 3300041496 Bacteria 577
209 Ga0451847_0566809 3300041503 Bacteria 751
210 Ga0451843_1141026 3300041509 Bacteria 646
211 Ga0451843_1435666 3300041509 Bacteria 1090
212 Ga0451853_1774114 3300041512 Bacteria 934
213 Ga0439458_0031137 3300042157 Bacteria 1271
214 Ga0439464_0002100 3300042439 Bacteria 4853
215 Ga0439464_0008165 3300042439 Bacteria 2744
216 Ga0450916_007945 3300042530 Bacteria 1282
217 Ga0466972_0088457 3300044658 Bacteria 1470
218 Ga0453684_0192594 3300044712 Bacteria 2384
219 Ga0495617_136904 3300046452 Bacteria 783
220 Ga0495590_0019036 3300046457 Bacteria 2450
221 Ga0495591_006224 3300046458 Bacteria 5322
222 Ga0495638_0011748 3300046460 Bacteria 6028
223 Ga0495638_0241396 3300046460 Bacteria 1000
224 Ga0495638_0404777 3300046460 Bacteria 707
225 Ga0495650_0010724 3300046471 Bacteria 5091
226 Ga0495650_0080295 3300046471 Bacteria 1259
227 Ga0495605_0485583 3300046474 Bacteria 506
228 Ga0495584_0002333 3300046491 Bacteria 10818
229 Ga0495585_0054386 3300046492 Bacteria 2213
230 Ga0495607_0002582 3300046501 Bacteria 14603
231 Ga0495607_0050256 3300046501 Bacteria 2428
232 Ga0495583_0290032 3300046506 Bacteria 651
233 Ga0495606_0004359 3300046507 Bacteria 14192
234 Ga0495616_0001890 3300046513 Bacteria 14150
235 Ga0495616_0303618 3300046513 Bacteria 673
236 Ga0495620_0017018 3300046515 Bacteria 3633
237 Ga0495620_0083501 3300046515 Bacteria 1289
238 Ga0495631_0001477 3300046518 Bacteria 14267
239 Ga0495632_0000608 3300046519 Bacteria 33143
240 Ga0495632_0027646 3300046519 Bacteria 2968
241 Ga0495632_0037453 3300046519 Bacteria 2461
242 Ga0495632_0320821 3300046519 Bacteria 684
243 Ga0495637_0038054 3300046520 Bacteria 2084
244 Ga0495637_0132365 3300046520 Bacteria 952
245 Ga0495637_0137398 3300046520 Bacteria 929
246 Ga0495643_0125709 3300046522 Bacteria 1291
247 Ga0495648_0157903 3300046524 Bacteria 1175
248 Ga0495642_0001419 3300046528 Bacteria 10740
249 Ga0495654_0145710 3300046530 Bacteria 1051
250 Ga0495609_0007536 3300046538 Bacteria 5418
251 Ga0495609_0082878 3300046538 Bacteria 1400
252 Ga0495597_0001891 3300046542 Bacteria 14256
253 Ga0495597_0017438 3300046542 Bacteria 3381
254 Ga0495622_0000424 3300046557 Bacteria 27860
255 Ga0495668_0043237 3300046616 Bacteria 2507
256 Ga0495611_0101327 3300046648 Bacteria 1337
257 Ga0495611_0123256 3300046648 Bacteria 1208
258 Ga0495625_0022013 3300046660 Bacteria 4894
259 Ga0495625_0064808 3300046660 Bacteria 2577
260 Ga0495661_0077948 3300046665 Bacteria 1918
261 Ga0495670_0458787 3300046691 Bacteria 691
262 Ga0495649_0002668 3300046694 Bacteria 12433
263 Ga0495649_0023969 3300046694 Bacteria 3406
264 Ga0495649_0313690 3300046694 Bacteria 797
265 Ga0495589_0084044 3300046794 Bacteria 1547
266 Ga0495660_0044594 3300046810 Bacteria 2438
267 Ga0495604_0245728 3300047317 Bacteria 1222
268 Ga0495679_066745 3300047446 Bacteria 1043
269 Ga0495673_0006236 3300047469 Bacteria 7051
270 Ga0495673_0112557 3300047469 Bacteria 1086
271 Ga0495681_0002069 3300047470 Bacteria 14574
272 Ga0495681_0067953 3300047470 Bacteria 1622
273 Ga0495626_0006456 3300048091 Bacteria 6679
274 Ga0496100_0814815 3300048903 Bacteria 732
275 Ga0496101_0405386 3300048904 Bacteria 1074
276 Ga0496102_0338995 3300048905 Bacteria 1416
277 Ga0496103_0146483 3300048906 Bacteria 1512
278 Ga0496105_1079597 3300048908 Bacteria 597
279 Ga0496106_0876437 3300048909 Bacteria 710
280 Ga0496111_1345763 3300048914 Bacteria 502
281 Ga0496112_0003368 3300048915 Bacteria 13198
282 Ga0496115_0750862 3300048918 Bacteria 763
283 Ga0496117_0155207 3300048920 Bacteria 1349
284 Ga0496118_0378395 3300048921 Bacteria 744
285 Ga0496118_0580957 3300048921 Bacteria 540
286 Ga0496119_0025752 3300048922 Bacteria 4100
287 Ga0496119_0038241 3300048922 Bacteria 3104
288 Ga0496119_0228170 3300048922 Bacteria 949
289 Ga0496120_0002673 3300048923 Bacteria 17544
290 Ga0496121_0454388 3300048924 Bacteria 825
291 Ga0496122_0000861 3300048925 Bacteria 57060
292 Ga0496122_0384940 3300048925 Bacteria 718
293 Ga0496124_0264747 3300048927 Bacteria 1263
294 Ga0496125_0067600 3300048928 Bacteria 2815
295 Ga0496125_0319527 3300048928 Bacteria 942
296 Ga0496126_0490499 3300048929 Bacteria 983
297 Ga0495678_002077 3300049459 Bacteria 14269
298 Ga0495678_056267 3300049459 Bacteria 1496
299 Ga0495682_0003376 3300049460 Bacteria 7113
300 Ga0495682_0023090 3300049460 Bacteria 2324
301 Ga0495682_0246748 3300049460 Bacteria 631
302 Ga0501314_004935 3300049530 Bacteria 1122
303 Ga0501031_0000076 3300049568 Bacteria 51870
304 Ga0501031_0001643 3300049568 Bacteria 14030
305 Ga0501032_0000004 3300049569 Bacteria 310855
306 Ga0501032_0000025 3300049569 Bacteria 138521
307 Ga0501033_0000156 3300049570 Bacteria 65847
308 Ga0501033_0000229 3300049570 Bacteria 54036
309 Ga0501033_0205382 3300049570 Bacteria 1406
310 Ga0501034_0000011 3300049571 Bacteria 310855
311 Ga0501034_0000733 3300049571 Bacteria 49673
312 Ga0501034_0861199 3300049571 Bacteria 796
313 Ga0501034_0935859 3300049571 Bacteria 753
314 Ga0501036_0000001 3300049572 Bacteria 310855
315 Ga0501036_0000151 3300049572 Bacteria 45499
316 Ga0501037_0000064 3300049573 Bacteria 97087
317 Ga0501037_0000176 3300049573 Bacteria 60011
318 Ga0501038_0000003 3300049574 Bacteria 310855
319 Ga0501038_0000046 3300049574 Bacteria 106465
320 Ga0501038_1137755 3300049574 Bacteria 569
321 Ga0501039_0000003 3300049575 Bacteria 357424
322 Ga0501039_0000004 3300049575 Bacteria 310855
323 Ga0501040_0012342 3300049576 Bacteria 5597
324 Ga0501041_0188346 3300049577 Bacteria 1292
325 Ga0501042_0103153 3300049578 Bacteria 2052
326 Ga0501043_0000051 3300049579 Bacteria 106957
327 Ga0501043_0000417 3300049579 Bacteria 38233
328 Ga0501047_0004675 3300049581 Bacteria 12881
329 Ga0501047_0059340 3300049581 Bacteria 3694
330 Ga0501070_0027043 3300049586 Bacteria 4812
331 Ga0501070_0109855 3300049586 Bacteria 2279
332 Ga0501070_0908007 3300049586 Bacteria 687
333 Ga0501070_1329299 3300049586 Bacteria 548
334 Ga0501072_1417640 3300049588 Bacteria 537
335 Ga0501075_0767763 3300049591 Bacteria 734
336 Ga0501202_210495 3300049652 Bacteria 535
337 Ga0501035_0000009 3300049822 Bacteria 310827
338 Ga0501035_0000102 3300049822 Bacteria 106915
339 Ga0501035_0111526 3300049822 Bacteria 2397
340 Ga0501035_1212737 3300049822 Bacteria 585
341 Ga0501044_0000005 3300049823 Bacteria 310855
342 Ga0501044_0014990 3300049823 Bacteria 8356
343 Ga0501044_0197510 3300049823 Bacteria 1971
344 Ga0501044_1415302 3300049823 Bacteria 561
345 Ga0501045_0200984 3300049824 Bacteria 1485
346 Ga0501226_000017 3300049853 Bacteria 150879
347 nmdc:mga03n38_106637_c1 3300050490 Bacteria 1359
348 nmdc:mga03n38_266742_c1 3300050490 Bacteria 909
349 nmdc:mga03n38_451231_c1 3300050490 Bacteria 715
350 nmdc:mga00v17_59989_c1 3300050491 Bacteria 2335
351 nmdc:mga00v17_75991_c1 3300050491 Bacteria 2089
352 nmdc:mga0yw44_203958_c1 3300050492 Bacteria 1307
353 nmdc:mga0yw44_220537_c1 3300050492 Bacteria 1257
354 nmdc:mga0yw44_31168_c1 3300050492 Bacteria 3098
355 nmdc:mga0yw44_69226_c1 3300050492 Bacteria 2185
356 nmdc:mga0yw44_72487_c1 3300050492 Bacteria 2141
357 nmdc:mga0k408_244750_c1 3300050493 Bacteria 1071
358 nmdc:mga06z11_202843_c1 3300050494 Bacteria 1153
359 nmdc:mga06z11_303597_c1 3300050494 Bacteria 949
360 nmdc:mga06z11_60286_c1 3300050494 Bacteria 1975
361 nmdc:mga06z11_60952_c1 3300050494 Bacteria 1966
362 nmdc:mga07m45_656999_c1 3300050496 Bacteria 604
363 nmdc:mga07m45_72749_c1 3300050496 Bacteria 1957
364 nmdc:mga0sz30_35437_c1 3300050516 Bacteria 2082
365 Ga0500610_0295585 3300053079 Bacteria 717
366 Ga0495655_0032430 3300053083 Bacteria 1278
367 Ga0495619_1144494 3300053085 Bacteria 517
368 Ga0500643_008695 3300053087 Bacteria 3964
369 Ga0500595_125772 3300053119 Bacteria 723
370 Ga0500621_201685 3300053126 Bacteria 704
371 Ga0500658_0031291 3300053134 Bacteria 2081
372 Ga0500604_0043548 3300053151 Bacteria 1364
373 Ga0500604_0325592 3300053151 Bacteria 533
374 Ga0500620_003740 3300053155 Bacteria 3294
375 Ga0500627_0032326 3300053158 Bacteria 2204
376 Ga0500627_0484753 3300053158 Bacteria 516
377 Ga0500638_334244 3300053162 Bacteria 569
378 Ga0500611_110792 3300053727 Bacteria 721
379 Ga0587084_109084 3300059477 Bacteria 570
380 Ga0587088_078065 3300059508 Bacteria 703
381 Ga0587106_134352 3300059605 Bacteria 537
382 Ga0587128_031846 3300059630 Bacteria 878
383 2503198605 2503198000 Bacteria 6884444
384 2509115713 2508501123 Bacteria 6283661
385 2509140850 2508501127 Bacteria 7037543
386 2509368646 2509276018 Bacteria 6910194
387 2509393404 2509276022 Bacteria 6200534
388 2512933957 2512875016 Bacteria 6529530
389 2512962212 2512875024 Bacteria 7195110
390 2513610517 2513237090 Bacteria 7096802
391 2513963201 2513237151 Bacteria 6309801
392 2514037123 2513237164 Bacteria 7563725
393 2514417584 2513237305 Bacteria 7293571
394 2527077123 2526164713 Bacteria 6780608
395 2554814057 2554235132 Bacteria 6772433
396 2555249204 2554235231 Bacteria 5215788
397 2563062506 2562617112 Bacteria 10918404
398 2588520067 2588253730 Bacteria 6881675
399 2597810301 2597489875 Bacteria 7010078
400 2599102381 2597490356 Bacteria 7030811
401 2599940141 2599185301 Bacteria 6161860
402 2600442758 2600254954 Bacteria 5100516
403 2602010325 2600255389 Bacteria 5275336
404 2608384647 2606217733 Bacteria 6360972
405 2643777745 2643221551 Bacteria 3750538
406 2643796193 2643221555 Bacteria 3749717
407 2643983588 2643221595 Bacteria 6565519
408 2644133588 2643221623 Bacteria 5239945
409 2644157229 2643221627 Bacteria 6761570
410 2688595902 2687453392 Bacteria 6880454
411 2694627759 2693429783 Bacteria 7019804
412 2694636873 2693429784 Bacteria 7241525
413 2713477636 2711768613 Bacteria 11048459
414 2723573175 2721755686 Bacteria 7343952
415 2739308453 2738543024 Bacteria 5603683
416 2756674990 2756170246 Bacteria 7451806
417 2792747093 2791355123 Bacteria 8049106
418 2808907243 2808606373 Bacteria 4423627
419 2808940658 2808606379 Bacteria 5022697
420 2808971939 2808606384 Bacteria 8474373
421 2809006768 2808606390 Bacteria 8476311
422 2809013906 2808606391 Bacteria 8308166
423 2812368091 2811994881 Bacteria 6298475
424 2823422874 2823421272 Bacteria 5372474
425 2841736304 2841734538 Bacteria 6784580
426 2841762687 2841760612 Bacteria 6454112
427 2844003526 2844002411 Bacteria 7168230
428 2844010714 2844009547 Bacteria 6728125
429 2844110305 2844104063 Bacteria 6440972
430 2846954459 2846952575 Bacteria 6587527
431 2847673477 2847670302 Bacteria 6165597
432 2847689985 2847686936 Bacteria 6278406
433 2848859279 2848858292 Bacteria 7391279
434 2851251967 2851246043 Bacteria 6439203
435 2856319054 2856314179 Bacteria 6477897
436 2856321060 2856320880 Bacteria 7263508
437 2856332613 2856328259 Bacteria 6528202
438 2856340600 2856334872 Bacteria 7037011
439 2856345146 2856342000 Bacteria 7176905
440 2856350718 2856349417 Bacteria 6230045
441 2856359604 2856356410 Bacteria 6297484
442 2856369828 2856364286 Bacteria 6939991
443 2857375380 2857367948 Bacteria 6965560
444 2869163398 2869162929 Bacteria 6399702
445 2869171503 2869169390 Bacteria 6659796
446 2869238097 2869234852 Bacteria 6654993
447 2869249298 2869242130 Bacteria 6609239
448 2869250489 2869249662 Bacteria 6868783
449 2869262808 2869256925 Bacteria 6981691
450 2869270425 2869264136 Bacteria 6880765
451 2869273328 2869271264 Bacteria 6908218
452 2869280707 2869278585 Bacteria 7077053
453 2869290635 2869285874 Bacteria 6901219
454 2871432917 2871429161 Bacteria 6547891
455 2871437852 2871435913 Bacteria 6880295
456 2871449532 2871444079 Bacteria 6423508
457 2871454421 2871451962 Bacteria 7336357
458 2871460826 2871459585 Bacteria 6866887
459 2871471585 2871466892 Bacteria 6923287
460 2871473218 2871466892 Bacteria 6923287
461 2871476941 2871474448 Bacteria 6806570
462 2871488073 2871481445 Bacteria 6700002
463 2871489781 2871488783 Bacteria 6929816
464 2871499848 2871495908 Bacteria 6935695
465 2874107219 2874102143 Bacteria 6342645
466 2874112593 2874109183 Bacteria 6517025
467 2874116759 2874116593 Bacteria 6674494
468 2874138786 2874131515 Bacteria 6820270
469 2874143143 2874139085 Bacteria 7021506
470 2874153922 2874146452 Bacteria 7533118
471 2874158610 2874155637 Bacteria 6724144
472 2874167491 2874162495 Bacteria 6174670
473 2874172356 2874168670 Bacteria 8062617
474 2876363788 2876363079 Bacteria 6544991
475 2876385481 2876377896 Bacteria 6565995
476 2876391889 2876386047 Bacteria 6698674
477 2876396994 2876392853 Bacteria 6660880
478 2876403208 2876399893 Bacteria 6927900
479 2876413132 2876406927 Bacteria 6191900
480 2876419227 2876413966 Bacteria 6831344
481 2876425896 2876420981 Bacteria 6687741
482 2878039443 2878035449 Bacteria 6555736
483 2878731222 2878730984 Bacteria 6380721
484 2878740792 2878738818 Bacteria 7136951
485 2878750530 2878745973 Bacteria 6867388
486 2878754183 2878753008 Bacteria 6922523
487 2878764012 2878760144 Bacteria 6823465
488 2878771042 2878767105 Bacteria 6898628
489 2878780521 2878774303 Bacteria 6108671
490 2878785568 2878781027 Bacteria 6834456
491 2881159328 2881155292 Bacteria 6461656
492 2881165027 2881161766 Bacteria 7127907
493 2881847890 2881845957 Bacteria 6611900
494 2881855919 2881853255 Bacteria 6698367
495 2882636777 2882632389 Bacteria 8154593
496 2885306895 2885305155 Bacteria 7348390
497 2885314216 2885312484 Bacteria 6415165
498 2885335452 2885334103 Bacteria 7216818
499 2885349301 2885342637 Bacteria 7011821
500 2885352070 2885350715 Bacteria 6787678
501 2888343163 2888337043 Bacteria 6629336
502 2888344299 2888343758 Bacteria 6611049
503 2889014959 2889010040 Bacteria 6749192
504 2889019970 2889016732 Bacteria 6700763
505 2903454129 2903448605 Bacteria 7357801
506 2903497502 2903492973 Bacteria 13473544
507 2903499624 2903492973 Bacteria 13473544
508 2903517456 2903513507 Bacteria 6344008
509 2903526053 2903521522 Bacteria 6525694
510 2903532401 2903528002 Bacteria 6586099
511 2903544659 2903540706 Bacteria 7062119
512 2904663748 2904659560 Bacteria 6685615
513 2906313455 2906308376 Bacteria 6841989
514 2906326164 2906321335 Bacteria 6579571
515 2906334152 2906328253 Bacteria 6585166
516 2906363617 2906363423 Bacteria 6856682
517 2906377899 2906370794 Bacteria 6881062
518 2906385586 2906378014 Bacteria 6911440
519 2906389375 2906386501 Bacteria 5977019
520 2906400111 2906393657 Bacteria 6790866
521 2906408160 2906401398 Bacteria 6693206
522 2906409155 2906408224 Bacteria 6162342
523 2906419125 2906414383 Bacteria 6580790
524 2906431730 2906427513 Bacteria 6375796
525 2919504743 2919501602 Bacteria 5286340
526 2922153624 2922151315 Bacteria 6902399
527 2922162006 2922158528 Bacteria 6573167
528 2922174293 2922172374 Bacteria 6167644
529 2922185255 2922178524 Bacteria 6025201
530 2923522144 2923519811 Bacteria 6298479
531 2924711008 2924710171 Bacteria 6752351
532 2924731429 2924726620 Bacteria 6271473
533 2924737486 2924733363 Bacteria 7574837
534 2924741567 2924741084 Bacteria 6661321
535 2924753201 2924748358 Bacteria 6154725
536 2924761067 2924754689 Bacteria 6774424
537 2924766134 2924762789 Bacteria 6561353
538 2924778393 2924776078 Bacteria 7492003
539 2926066420 2926063275 Bacteria 5285848
540 2937820241 2937813078 Bacteria 7783518
541 2937822680 2937822353 Bacteria 7290551
542 2937843230 2937836603 Bacteria 6811263
543 2937848931 2937848649 Bacteria 6983481
544 2937863141 2937861824 Bacteria 6660327
545 2937873084 2937868953 Bacteria 6639878
546 2937880058 2937877337 Bacteria 7246526
547 2937981298 2937980651 Bacteria 6517427
548 2937998507 2937994558 Bacteria 7036190
549 2938022032 2938014810 Bacteria 6700592
550 2958036580 2958034702 Bacteria 6989922
551 2958046531 2958041894 Bacteria 13082850
552 2958066882 2958064165 Bacteria 7158582
553 2958077262 2958071322 Bacteria 6815895
554 2958086122 2958084443 Bacteria 7312792
555 2958094941 2958092219 Bacteria 6861151
556 2958106561 2958100919 Bacteria 6800575
557 2958113503 2958108152 Bacteria 6681128
558 2958119134 2958115193 Bacteria 6923548
559 2958125510 2958122699 Bacteria 7280457
560 2958135035 2958130278 Bacteria 6897202
561 2958140850 2958137437 Bacteria 6050276
562 2958145642 2958144490 Bacteria 6677056
563 2958158526 2958158011 Bacteria 6058449
564 2958168983 2958165035 Bacteria 6906348
565 2958172874 2958172287 Bacteria 6716688
566 2958184064 2958179912 Bacteria 6874908
567 2961082119 2961077736 Bacteria 7079850
568 2961119112 2961114664 Bacteria 6680456
569 2961127764 2961127735 Bacteria 7196641
570 2961143959 2961136820 Bacteria 6775228
571 2961167445 2961163497 Bacteria 6901077
572 2961176242 2961170736 Bacteria 7072258
573 2961190326 2961183825 Bacteria 6688536
574 2963645247 2963644680 Bacteria 6530403
575 2965022267 2965018300 Bacteria 6883036
576 2965030061 2965025482 Bacteria 6532201
577 2965035424 2965032056 Bacteria 6887443
578 2965044305 2965040258 Bacteria 6855979
579 2965049078 2965047637 Bacteria 6623551
580 2965068527 2965062239 Bacteria 7412989
581 2965096074 2965089291 Bacteria 6866420
582 2965107775 2965102966 Bacteria 6800987
583 2965112058 2965110997 Bacteria 6693150
584 2965120940 2965119406 Bacteria 6956431
585 2965120991 2965119406 Bacteria 6956431
586 2967996844 2967996073 Bacteria 6787468
587 2968004907 2968003550 Bacteria 6929263
588 2968023127 2968016561 Bacteria 7022047
589 2968089855 2968083720 Bacteria 7351627
590 2968093563 2968091066 Bacteria 6052692
591 2968101392 2968097103 Bacteria 6107094
592 2968114887 2968110612 Bacteria 6814636
593 2968122618 2968117919 Bacteria 6536078
594 2968134008 2968128360 Bacteria 6270294
595 2968141800 2968138860 Bacteria 6605449
596 2968175852 2968171901 Bacteria 6894245
597 2970475711 2970469710 Bacteria 6969209
598 2970494397 2970489779 Bacteria 6517260
599 2970508913 2970503327 Bacteria 7099517
600 2970510742 2970510686 Bacteria 7006402
601 2970525978 2970524798 Bacteria 6840927
602 2970532634 2970532167 Bacteria 6553173
603 2970544557 2970540015 Bacteria 6977556
604 2970553502 2970547951 Bacteria 6931819
605 2970558856 2970554993 Bacteria 6814252
606 2970595425 2970593180 Bacteria 7073582
607 2970626097 2970619444 Bacteria 6986144
608 2970630769 2970627176 Bacteria 6680862
609 2977823398 2977821940 Bacteria 6906439
610 2977830534 2977828996 Bacteria 7007971
611 2977847066 2977843712 Bacteria 6753583
612 2977853351 2977851361 Bacteria 6694324
613 2977868134 2977864932 Bacteria 7534097
614 2977876548 2977872689 Bacteria 7270173
615 2977912754 2977907340 Bacteria 6577984
616 2977921201 2977915119 Bacteria 6829656
617 2977925575 2977922695 Bacteria 6956781
618 2977941016 2977935797 Bacteria 6252826
619 2977943306 2977942078 Bacteria 7570577
620 2977955998 2977950692 Bacteria 6893264
621 2977958884 2977957713 Bacteria 6877875
622 2977993013 2977986579 Bacteria 6581278
623 2979713789 2979710463 Bacteria 6785254
624 2979767578 2979764755 Bacteria 6610066
625 2979772868 2979772303 Bacteria 6618277
626 2979786408 2979779861 Bacteria 6219781
627 2979798000 2979793036 Bacteria 6808957
628 2979813592 2979808191 Bacteria 7179355
629 2987650030 2987645492 Bacteria 6117018
630 2987654444 2987652177 Bacteria 6969023
631 2987663451 2987659509 Bacteria 6966464
632 2987666988 2987666974 Bacteria 6509233
633 2987674916 2987673487 Bacteria 6884027
634 2996341931 2996341866 Bacteria 6643098
635 2996355661 2996348954 Bacteria 7239054
636 2996387147 2996386984 Bacteria 6978667
637 3004173178 3004167301 Bacteria 8330599
638 3004192510 3004188549 Bacteria 6952365
639 3004203799 3004195979 Bacteria 6776956
640 3004209617 3004203850 Bacteria 7307914
641 3004217107 3004211236 Bacteria 7417683
642 3004225300 3004218560 Bacteria 7421728
643 3004233728 3004232784 Bacteria 6662140
644 3004246952 3004239961 Bacteria 6892290
645 3004252104 3004248173 Bacteria 6563236
646 3004269274 3004268573 Bacteria 7043476
647 3004282087 3004275668 Bacteria 7114440
648 3004293522 3004289098 Bacteria 6135450
649 3004337429 3004334049 Bacteria 8449246
650 3006979743 3006978542 Bacteria 5328100
651 3007253610 3007252601 Bacteria 4559114
652 637077108 637000159 Bacteria 7596297
653 642593845 642555112 Bacteria 8676562
654 649870469 649633066 Bacteria 6690028
655 8004301197 8004300914 Bacteria 6132239
656 8004314900 8004312739 Bacteria 7444653
657 8004367164 8004361976 Bacteria 6858373
658 8004375760 8004374579 Bacteria 6898112
659 8004392924 8004387939 Bacteria 7049250
660 8004403564 8004395343 Bacteria 6620908
661 8004636125 8004633249 Bacteria 6723080
662 8004643871 8004640170 Bacteria 6723001
663 8004700937 8004695233 Bacteria 6731676
664 8004706717 8004703790 Bacteria 8006957
665 8004719711 8004714634 Bacteria 6776161
666 8004733679 8004727605 Bacteria 6643904
667 8034966000 8034962539 Bacteria 4884839
668 Ga0209995_1089533
669 JGI24740J21852_10015592
670 JGI24739J22299_10050392
671 JGI24739J22299_10128842
672 JGI24738J21930_10108690
673 JGI25157J39369_1001679
674 JGI25165J46597_1000079
675 Ga0058692_1019929
676 Ga0070658_10172227
677 Ga0068869_101080949
678 Ga0070666_10014775
679 Ga0068868_102151905
680 Ga0070660_100334390
681 Ga0070661_101253861
682 Ga0070668_100654199
683 Ga0070675_100597076
684 Ga0070673_102066913
685 Ga0070659_101089226
686 Ga0070659_101224581
687 Ga0070667_100060777
688 Ga0070667_100134318
689 Ga0070663_100022086
690 Ga0070663_100191600
691 Ga0070678_100545061
692 Ga0068867_102295304
693 Ga0068853_100035109
694 Ga0068853_100471347
695 Ga0068853_102001983
696 Ga0068853_102212895
697 Ga0070672_100347444
698 Ga0070672_101671711
699 Ga0070665_100835039
700 Ga0070665_100951035
701 Ga0068855_100328873
702 Ga0068855_100546845
703 Ga0068857_100385209
704 Ga0068854_100258712
705 Ga0068854_100973294
706 Ga0068856_100111924
707 Ga0070702_100414021
708 Ga0068852_100005379
709 Ga0068852_100036885
710 Ga0068852_102229852
711 Ga0068858_101253399
712 Ga0081455_10291149
713 Ga0081539_10178967
714 Ga0075365_10039080
715 Ga0075365_10084187
716 Ga0075365_10280608
717 Ga0075365_10323859
718 Ga0075368_10093396
719 Ga0075368_10497880
720 Ga0075363_100077544
721 Ga0075363_100255150
722 Ga0075363_100281673
723 Ga0075364_10279588
724 Ga0075367_10028282
725 Ga0075367_10767464
726 Ga0075369_10033833
727 Ga0075369_10113279
728 Ga0075366_10339930
729 Ga0075370_10106365
730 Ga0075370_10136630
731 Ga0075370_10730161
732 Ga0075429_100707899
733 Ga0068865_100448118
734 Ga0105251_10000123
735 Ga0105244_10035745
736 Ga0105250_10000166
737 Ga0105250_10042936
738 Ga0105250_10049177
739 Ga0105250_10050160
740 Ga0105240_10313292
741 Ga0105240_11678837
742 Ga0105245_11507324
743 Ga0105243_10017730
744 Ga0105237_10031947
745 Ga0105237_10089473
746 Ga0105238_10337661
747 Ga0105238_10898699
748 Ga0105239_10054482
749 Ga0105239_10170436
750 Ga0105239_10247035
751 Ga0105239_10624974
752 Ga0157373_10003566
753 Ga0157373_10034114
754 Ga0157373_10843234
755 Ga0157371_10861217
756 Ga0157371_11205507
757 Ga0157369_10007408
758 Ga0157369_10105438
759 Ga0157369_10351780
760 Ga0157374_10146089
761 Ga0157374_10776125
762 Ga0163162_10003705
763 Ga0163162_11272020
764 Ga0157372_10603649
765 Ga0157375_10294723
766 Ga0163163_11895574
767 Ga0182008_10137468
768 Ga0182008_10394533
769 Ga0182005_1048512
770 Ga0213872_10003798
771 Ga0213872_10005831
772 Ga0213872_10017689
773 Ga0209026_1000118
774 Ga0209026_1041722
775 Ga0209148_1000136
776 Ga0209759_1000076
777 Ga0209233_1000247
778 Ga0209233_1049753
779 Ga0209455_1000085
780 Ga0207696_1000141
781 Ga0207696_1003011
782 Ga0207696_1029207
783 Ga0207696_1054349
784 Ga0207655_1028637
785 Ga0207713_1000085
786 Ga0207688_10545273
787 Ga0207680_10012117
788 Ga0207647_10507754
789 Ga0207685_10845200
790 Ga0207645_10037798
791 Ga0207645_10457564
792 Ga0207705_10222747
793 Ga0207654_10905083
794 Ga0207695_10838907
795 Ga0207671_10034394
796 Ga0207671_10207965
797 Ga0207657_10202931
798 Ga0207657_10621851
799 Ga0207649_11673321
800 Ga0207694_10029933
801 Ga0207694_10286246
802 Ga0207694_10427290
803 Ga0207690_10033773
804 Ga0207690_10756073
805 Ga0207706_10052845
806 Ga0207706_10086919
807 Ga0207709_10127057
808 Ga0207709_11423657
809 Ga0207669_10124442
810 Ga0207704_10095724
811 Ga0207704_10108773
812 Ga0207711_10232259
813 Ga0207689_10974809
814 Ga0207667_10379937
815 Ga0207651_10918969
816 Ga0207640_11092716
817 Ga0207658_10044646
818 Ga0207703_10551444
819 Ga0207639_10216523
820 Ga0207639_10284794
821 Ga0207678_10214330
822 Ga0207678_10253924
823 Ga0207702_10273831
824 Ga0207702_10434833
825 Ga0207648_10156901
826 Ga0207674_10041174
827 Ga0207683_10135368
828 Ga0207683_10156433
829 Ga0207698_10000395
830 Ga0207698_10289924
831 Ga0207698_11691788
832 Ga0207698_12012458
833 Ga0209371_1000433
834 Ga0209813_10124787
835 Ga0268266_10252673
836 Ga0268266_10938062
837 Ga0268256_1000372
838 Ga0307513_10157139
839 Ga0307408_100000969
840 Ga0307408_100062227
841 Ga0307405_10952235
842 Ga0307413_10005276
843 Ga0307410_10200253
844 Ga0307412_11403618
845 Ga0307409_100640702
846 Ga0307409_100837069
847 Ga0307416_101465858
848 Ga0307416_101755050
849 Ga0307414_10039048
850 Ga0307510_10412547
851 Ga0373931_0014237
852 Ga0373925_0679595
853 Ga0373925_1727340
854 Ga0395900_0032783
855 Ga0395900_0731362
856 Ga0395900_1496467
857 Ga0395900_1846884
858 Ga0395898_0184119
859 Ga0395898_0700873
860 Ga0395905_0001236
861 Ga0395905_0024508
862 Ga0395905_0477864
863 Ga0395905_0582691
864 Ga0395901_0177705
865 Ga0395901_0246718
866 Ga0395901_0401736
867 Ga0237819_10912
868 Ga0436361_0036409
869 Ga0436361_0139111
870 Ga0436361_0710706
871 Ga0436361_0993359
872 Ga0451793_1889980
873 Ga0451797_1583900
874 Ga0451798_0936562
875 Ga0451839_0620483
876 Ga0451847_0566809
877 Ga0451843_1141026
878 Ga0451843_1435666
879 Ga0451853_1774114
880 Ga0439458_0031137
881 Ga0439464_0002100
882 Ga0439464_0008165
883 Ga0450916_007945
884 Ga0466972_0088457
885 Ga0453684_0192594
886 Ga0495617_136904
887 Ga0495590_0019036
888 Ga0495591_006224
889 Ga0495638_0011748
890 Ga0495638_0241396
891 Ga0495638_0404777
892 Ga0495650_0010724
893 Ga0495650_0080295
894 Ga0495605_0485583
895 Ga0495584_0002333
896 Ga0495585_0054386
897 Ga0495607_0002582
898 Ga0495607_0050256
899 Ga0495583_0290032
900 Ga0495606_0004359
901 Ga0495616_0001890
902 Ga0495616_0303618
903 Ga0495620_0017018
904 Ga0495620_0083501
905 Ga0495631_0001477
906 Ga0495632_0000608
907 Ga0495632_0027646
908 Ga0495632_0037453
909 Ga0495632_0320821
910 Ga0495637_0038054
911 Ga0495637_0132365
912 Ga0495637_0137398
913 Ga0495643_0125709
914 Ga0495648_0157903
915 Ga0495642_0001419
916 Ga0495654_0145710
917 Ga0495609_0007536
918 Ga0495609_0082878
919 Ga0495597_0001891
920 Ga0495597_0017438
921 Ga0495622_0000424
922 Ga0495668_0043237
923 Ga0495611_0101327
924 Ga0495611_0123256
925 Ga0495625_0022013
926 Ga0495625_0064808
927 Ga0495661_0077948
928 Ga0495670_0458787
929 Ga0495649_0002668
930 Ga0495649_0023969
931 Ga0495649_0313690
932 Ga0495589_0084044
933 Ga0495660_0044594
934 Ga0495604_0245728
935 Ga0495679_066745
936 Ga0495673_0006236
937 Ga0495673_0112557
938 Ga0495681_0002069
939 Ga0495681_0067953
940 Ga0495626_0006456
941 Ga0496100_0814815
942 Ga0496101_0405386
943 Ga0496102_0338995
944 Ga0496103_0146483
945 Ga0496105_1079597
946 Ga0496106_0876437
947 Ga0496111_1345763
948 Ga0496112_0003368
949 Ga0496115_0750862
950 Ga0496117_0155207
951 Ga0496118_0378395
952 Ga0496118_0580957
953 Ga0496119_0025752
954 Ga0496119_0038241
955 Ga0496119_0228170
956 Ga0496120_0002673
957 Ga0496121_0454388
958 Ga0496122_0000861
959 Ga0496122_0384940
960 Ga0496124_0264747
961 Ga0496125_0067600
962 Ga0496125_0319527
963 Ga0496126_0490499
964 Ga0495678_002077
965 Ga0495678_056267
966 Ga0495682_0003376
967 Ga0495682_0023090
968 Ga0495682_0246748
969 Ga0501314_004935
970 Ga0501031_0000076
971 Ga0501031_0001643
972 Ga0501032_0000004
973 Ga0501032_0000025
974 Ga0501033_0000156
975 Ga0501033_0000229
976 Ga0501033_0205382
977 Ga0501034_0000011
978 Ga0501034_0000733
979 Ga0501034_0861199
980 Ga0501034_0935859
981 Ga0501036_0000001
982 Ga0501036_0000151
983 Ga0501037_0000064
984 Ga0501037_0000176
985 Ga0501038_0000003
986 Ga0501038_0000046
987 Ga0501038_1137755
988 Ga0501039_0000003
989 Ga0501039_0000004
990 Ga0501040_0012342
991 Ga0501041_0188346
992 Ga0501042_0103153
993 Ga0501043_0000051
994 Ga0501043_0000417
995 Ga0501047_0004675
996 Ga0501047_0059340
997 Ga0501070_0027043
998 Ga0501070_0109855
999 Ga0501070_0908007
1000 Ga0501070_1329299
1001 Ga0501072_1417640
1002 Ga0501075_0767763
1003 Ga0501202_210495
1004 Ga0501035_0000009
1005 Ga0501035_0000102
1006 Ga0501035_0111526
1007 Ga0501035_1212737
1008 Ga0501044_0000005
1009 Ga0501044_0014990
1010 Ga0501044_0197510
1011 Ga0501044_1415302
1012 Ga0501045_0200984
1013 Ga0501226_000017
1014 nmdc:mga03n38_106637_c1
1015 nmdc:mga03n38_266742_c1
1016 nmdc:mga03n38_451231_c1
1017 nmdc:mga00v17_59989_c1
1018 nmdc:mga00v17_75991_c1
1019 nmdc:mga0yw44_203958_c1
1020 nmdc:mga0yw44_220537_c1
1021 nmdc:mga0yw44_31168_c1
1022 nmdc:mga0yw44_69226_c1
1023 nmdc:mga0yw44_72487_c1
1024 nmdc:mga0k408_244750_c1
1025 nmdc:mga06z11_202843_c1
1026 nmdc:mga06z11_303597_c1
1027 nmdc:mga06z11_60286_c1
1028 nmdc:mga06z11_60952_c1
1029 nmdc:mga07m45_656999_c1
1030 nmdc:mga07m45_72749_c1
1031 nmdc:mga0sz30_35437_c1
1032 Ga0500610_0295585
1033 Ga0495655_0032430
1034 Ga0495619_1144494
1035 Ga0500643_008695
1036 Ga0500595_125772
1037 Ga0500621_201685
1038 Ga0500658_0031291
1039 Ga0500604_0043548
1040 Ga0500604_0325592
1041 Ga0500620_003740
1042 Ga0500627_0032326
1043 Ga0500627_0484753
1044 Ga0500638_334244
1045 Ga0500611_110792
1046 Ga0587084_109084
1047 Ga0587088_078065
1048 Ga0587106_134352
1049 Ga0587128_031846
1050 2503198605
1051 2509115713
1052 2509140850
1053 2509368646
1054 2509393404
1055 2512933957
1056 2512962212
1057 2513610517
1058 2513963201
1059 2514037123
1060 2514417584
1061 2527077123
1062 2554814057
1063 2555249204
1064 2563062506
1065 2588520067
1066 2597810301
1067 2599102381
1068 2599940141
1069 2600442758
1070 2602010325
1071 2608384647
1072 2643777745
1073 2643796193
1074 2643983588
1075 2644133588
1076 2644157229
1077 2688595902
1078 2694627759
1079 2694636873
1080 2713477636
1081 2723573175
1082 2739308453
1083 2756674990
1084 2792747093
1085 2808907243
1086 2808940658
1087 2808971939
1088 2809006768
1089 2809013906
1090 2812368091
1091 2823422874
1092 2841736304
1093 2841762687
1094 2844003526
1095 2844010714
1096 2844110305
1097 2846954459
1098 2847673477
1099 2847689985
1100 2848859279
1101 2851251967
1102 2856319054
1103 2856321060
1104 2856332613
1105 2856340600
1106 2856345146
1107 2856350718
1108 2856359604
1109 2856369828
1110 2857375380
1111 2869163398
1112 2869171503
1113 2869238097
1114 2869249298
1115 2869250489
1116 2869262808
1117 2869270425
1118 2869273328
1119 2869280707
1120 2869290635
1121 2871432917
1122 2871437852
1123 2871449532
1124 2871454421
1125 2871460826
1126 2871471585
1127 2871473218
1128 2871476941
1129 2871488073
1130 2871489781
1131 2871499848
1132 2874107219
1133 2874112593
1134 2874116759
1135 2874138786
1136 2874143143
1137 2874153922
1138 2874158610
1139 2874167491
1140 2874172356
1141 2876363788
1142 2876385481
1143 2876391889
1144 2876396994
1145 2876403208
1146 2876413132
1147 2876419227
1148 2876425896
1149 2878039443
1150 2878731222
1151 2878740792
1152 2878750530
1153 2878754183
1154 2878764012
1155 2878771042
1156 2878780521
1157 2878785568
1158 2881159328
1159 2881165027
1160 2881847890
1161 2881855919
1162 2882636777
1163 2885306895
1164 2885314216
1165 2885335452
1166 2885349301
1167 2885352070
1168 2888343163
1169 2888344299
1170 2889014959
1171 2889019970
1172 2903454129
1173 2903497502
1174 2903499624
1175 2903517456
1176 2903526053
1177 2903532401
1178 2903544659
1179 2904663748
1180 2906313455
1181 2906326164
1182 2906334152
1183 2906363617
1184 2906377899
1185 2906385586
1186 2906389375
1187 2906400111
1188 2906408160
1189 2906409155
1190 2906419125
1191 2906431730
1192 2919504743
1193 2922153624
1194 2922162006
1195 2922174293
1196 2922185255
1197 2923522144
1198 2924711008
1199 2924731429
1200 2924737486
1201 2924741567
1202 2924753201
1203 2924761067
1204 2924766134
1205 2924778393
1206 2926066420
1207 2937820241
1208 2937822680
1209 2937843230
1210 2937848931
1211 2937863141
1212 2937873084
1213 2937880058
1214 2937981298
1215 2937998507
1216 2938022032
1217 2958036580
1218 2958046531
1219 2958066882
1220 2958077262
1221 2958086122
1222 2958094941
1223 2958106561
1224 2958113503
1225 2958119134
1226 2958125510
1227 2958135035
1228 2958140850
1229 2958145642
1230 2958158526
1231 2958168983
1232 2958172874
1233 2958184064
1234 2961082119
1235 2961119112
1236 2961127764
1237 2961143959
1238 2961167445
1239 2961176242
1240 2961190326
1241 2963645247
1242 2965022267
1243 2965030061
1244 2965035424
1245 2965044305
1246 2965049078
1247 2965068527
1248 2965096074
1249 2965107775
1250 2965112058
1251 2965120940
1252 2965120991
1253 2967996844
1254 2968004907
1255 2968023127
1256 2968089855
1257 2968093563
1258 2968101392
1259 2968114887
1260 2968122618
1261 2968134008
1262 2968141800
1263 2968175852
1264 2970475711
1265 2970494397
1266 2970508913
1267 2970510742
1268 2970525978
1269 2970532634
1270 2970544557
1271 2970553502
1272 2970558856
1273 2970595425
1274 2970626097
1275 2970630769
1276 2977823398
1277 2977830534
1278 2977847066
1279 2977853351
1280 2977868134
1281 2977876548
1282 2977912754
1283 2977921201
1284 2977925575
1285 2977941016
1286 2977943306
1287 2977955998
1288 2977958884
1289 2977993013
1290 2979713789
1291 2979767578
1292 2979772868
1293 2979786408
1294 2979798000
1295 2979813592
1296 2987650030
1297 2987654444
1298 2987663451
1299 2987666988
1300 2987674916
1301 2996341931
1302 2996355661
1303 2996387147
1304 3004173178
1305 3004192510
1306 3004203799
1307 3004209617
1308 3004217107
1309 3004225300
1310 3004233728
1311 3004246952
1312 3004252104
1313 3004269274
1314 3004282087
1315 3004293522
1316 3004337429
1317 3006979743
1318 3007253610
1319 637077108
1320 642593845
1321 649870469
1322 8004301197
1323 8004314900
1324 8004367164
1325 8004375760
1326 8004392924
1327 8004403564
1328 8004636125
1329 8004643871
1330 8004700937
1331 8004706717
1332 8004719711
1333 8004733679
1334 8034966000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00893

Multi_Drug_Res

Small Multidrug Resistance protein

19

111

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.9629 1 104
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.9019 1 98
7b0k-assembly1.cif.gz_A membrane protein structure 0.8986 31 101
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.8972 31 100
7svx-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and harmane 0.8901 1 98
ID Description Score Start End Superfamily
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 1 1 104 1.10.3730.20
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9906 1 104 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8971 3 103 1.10.3730.20
af_I1KSB6_13_116_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8882 1 103 1.10.3730.20
af_C6S3G0_14_136_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8753 4 103 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A4R7PG08-F1-model_v4 deleted 1.002 1 104
AF-Q328H6-F1-model_v4 Guanidinium exporter 0.9985 1 103 GO:0005886
GO:0022857
AF-A0A3A5JHG6-F1-model_v4 QacE family quaternary ammonium compound efflux SMR transporter 0.9973 2 103 GO:0005886
GO:0022857
AF-I6Z3E1-F1-model_v4 Cation membrane transporter 0.9971 1 102 GO:0005886
GO:0022857
AF-A0A561VJF6-F1-model_v4 Quaternary ammonium compound-resistance protein SugE 0.9968 1 104 GO:0005886
GO:0022857

Map