F473839
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 667 | 311 | 667 | 105 |
Family's Representative Sequence
| Representative Sequence | 3300012512|Ga0157327_1054108|Ga0157327_10541082 |
| Length | 109 |
| Sequence | MRKIRKGDNVVVITGRDKGKRGDVTRVLAEHVLVAGINQVKKHQRPNPMKNQTGGIVDKEMPIHLSNVMLVNPASGKGDRVGFKFLEAQGGAPARKVRFFKSNGEVVDV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 98 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 99 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 100 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 118 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 119 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 181 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 184 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 188 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 193 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 195 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 211 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 212 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 213 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 214 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 215 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 217 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 218 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 219 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 220 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 221 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 222 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 223 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 258 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 259 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 260 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 261 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 262 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 263 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 264 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 265 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 287 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 288 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 291 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 303 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 304 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 305 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 306 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 307 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 308 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 309 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.7 |
| Metatranscriptomes | 3.15 |
| Isolates | 0.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.2 |
| Nodule | 0 |
| Rhizoplane | 5.1 |
| Rhizosphere | 89.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_FSXC79173_b1 | 2010549000 | Bacteria | 811 |
| 2 | JGI24752J21851_1005316 | 3300001976 | Bacteria | 1682 |
| 3 | JGI24742J22300_10050452 | 3300002244 | Bacteria | 753 |
| 4 | rootH1_10004661 | 3300003316 | Bacteria | 2885 |
| 5 | rootH1_10004661 | 3300003323 | Bacteria | 2697 |
| 6 | rootL2_10064042 | 3300003322 | Bacteria | 1045 |
| 7 | rootH1_10087917 | 3300003323 | Bacteria | 1425 |
| 8 | Ga0065704_10146981 | 3300005289 | Bacteria | 1462 |
| 9 | Ga0070658_10770947 | 3300005327 | Bacteria | 835 |
| 10 | Ga0070658_10893930 | 3300005327 | Bacteria | 772 |
| 11 | Ga0070658_11239224 | 3300005327 | Bacteria | 648 |
| 12 | Ga0070658_12001909 | 3300005327 | Bacteria | 500 |
| 13 | Ga0070676_10034458 | 3300005328 | Bacteria | 2907 |
| 14 | Ga0070676_10084706 | 3300005328 | Bacteria | 1930 |
| 15 | Ga0070676_10105590 | 3300005328 | Bacteria | 1747 |
| 16 | Ga0070676_10658917 | 3300005328 | Bacteria | 761 |
| 17 | Ga0070676_10995701 | 3300005328 | Bacteria | 629 |
| 18 | Ga0070676_11182769 | 3300005328 | Bacteria | 580 |
| 19 | Ga0070683_100036912 | 3300005329 | Bacteria | 4471 |
| 20 | Ga0070690_100219365 | 3300005330 | Bacteria | 1332 |
| 21 | Ga0070690_100573051 | 3300005330 | Bacteria | 854 |
| 22 | Ga0070670_100049275 | 3300005331 | Bacteria | 3622 |
| 23 | Ga0070670_100516327 | 3300005331 | Bacteria | 1063 |
| 24 | Ga0070670_100693150 | 3300005331 | Bacteria | 916 |
| 25 | Ga0070670_100889294 | 3300005331 | Bacteria | 807 |
| 26 | Ga0070670_101099751 | 3300005331 | Bacteria | 725 |
| 27 | Ga0070677_10021939 | 3300005333 | Bacteria | 2347 |
| 28 | Ga0070677_10195851 | 3300005333 | Bacteria | 972 |
| 29 | Ga0068869_100037989 | 3300005334 | Bacteria | 3427 |
| 30 | Ga0068869_100683424 | 3300005334 | Bacteria | 874 |
| 31 | Ga0068869_101867977 | 3300005334 | Bacteria | 538 |
| 32 | Ga0070666_10045917 | 3300005335 | Bacteria | 2929 |
| 33 | Ga0070666_10183555 | 3300005335 | Bacteria | 1468 |
| 34 | Ga0070682_100121457 | 3300005337 | Bacteria | 1754 |
| 35 | Ga0070682_100347010 | 3300005337 | Bacteria | 1105 |
| 36 | Ga0070682_100782150 | 3300005337 | Bacteria | 773 |
| 37 | Ga0068868_100011188 | 3300005338 | Bacteria | 6533 |
| 38 | Ga0068868_100251645 | 3300005338 | Bacteria | 1487 |
| 39 | Ga0068868_100755715 | 3300005338 | Bacteria | 874 |
| 40 | Ga0068868_100853365 | 3300005338 | Bacteria | 825 |
| 41 | Ga0068868_102204895 | 3300005338 | Bacteria | 525 |
| 42 | Ga0070660_100650359 | 3300005339 | Bacteria | 883 |
| 43 | Ga0070660_101185422 | 3300005339 | Bacteria | 647 |
| 44 | Ga0070689_100022606 | 3300005340 | Bacteria | 4697 |
| 45 | Ga0070687_101070546 | 3300005343 | Unclassified | 588 |
| 46 | Ga0070661_100290407 | 3300005344 | Bacteria | 1270 |
| 47 | Ga0070668_100117321 | 3300005347 | Bacteria | 2123 |
| 48 | Ga0070668_100581630 | 3300005347 | Bacteria | 978 |
| 49 | Ga0070669_100038030 | 3300005353 | Bacteria | 3492 |
| 50 | Ga0070669_100328397 | 3300005353 | Bacteria | 1237 |
| 51 | Ga0070669_100779756 | 3300005353 | Bacteria | 811 |
| 52 | Ga0070669_101870626 | 3300005353 | Bacteria | 524 |
| 53 | Ga0070675_100008825 | 3300005354 | Bacteria | 7834 |
| 54 | Ga0070675_100011102 | 3300005354 | Bacteria | 7051 |
| 55 | Ga0070675_100078697 | 3300005354 | Bacteria | 2746 |
| 56 | Ga0070675_101850210 | 3300005354 | Bacteria | 557 |
| 57 | Ga0070671_100001413 | 3300005355 | Bacteria | 17942 |
| 58 | Ga0070671_100043910 | 3300005355 | Bacteria | 3714 |
| 59 | Ga0070671_100046754 | 3300005355 | Bacteria | 3599 |
| 60 | Ga0070671_100231377 | 3300005355 | Bacteria | 1568 |
| 61 | Ga0070671_100385170 | 3300005355 | Bacteria | 1198 |
| 62 | Ga0070671_100805762 | 3300005355 | Bacteria | 818 |
| 63 | Ga0070674_100004652 | 3300005356 | Bacteria | 7840 |
| 64 | Ga0070674_100096649 | 3300005356 | Bacteria | 2144 |
| 65 | Ga0070674_100464815 | 3300005356 | Bacteria | 1047 |
| 66 | Ga0070674_100810729 | 3300005356 | Bacteria | 809 |
| 67 | Ga0070674_101365702 | 3300005356 | Bacteria | 633 |
| 68 | Ga0070674_101582596 | 3300005356 | Bacteria | 590 |
| 69 | Ga0070673_100002406 | 3300005364 | Bacteria | 11383 |
| 70 | Ga0070673_100034303 | 3300005364 | Bacteria | 3838 |
| 71 | Ga0070673_100180192 | 3300005364 | Bacteria | 1808 |
| 72 | Ga0070673_100231366 | 3300005364 | Bacteria | 1603 |
| 73 | Ga0070673_100873619 | 3300005364 | Bacteria | 833 |
| 74 | Ga0070673_101526794 | 3300005364 | Bacteria | 630 |
| 75 | Ga0070688_100776035 | 3300005365 | Bacteria | 748 |
| 76 | Ga0070659_100039243 | 3300005366 | Bacteria | 3696 |
| 77 | Ga0070659_100300462 | 3300005366 | Bacteria | 1339 |
| 78 | Ga0070659_100494235 | 3300005366 | Bacteria | 1042 |
| 79 | Ga0070659_100959345 | 3300005366 | Bacteria | 749 |
| 80 | Ga0070667_100022362 | 3300005367 | Bacteria | 5245 |
| 81 | Ga0070667_100086170 | 3300005367 | Bacteria | 2694 |
| 82 | Ga0070667_100163030 | 3300005367 | Bacteria | 1965 |
| 83 | Ga0070667_100467584 | 3300005367 | Bacteria | 1153 |
| 84 | Ga0070667_101539402 | 3300005367 | Bacteria | 625 |
| 85 | Ga0070667_101637638 | 3300005367 | Bacteria | 605 |
| 86 | Ga0070713_100000028 | 3300005436 | Bacteria | 93227 |
| 87 | Ga0070701_10058119 | 3300005438 | Bacteria | 2029 |
| 88 | Ga0070701_10201334 | 3300005438 | Bacteria | 1177 |
| 89 | Ga0070711_100200043 | 3300005439 | Bacteria | 1541 |
| 90 | Ga0070705_100228096 | 3300005440 | Bacteria | 1294 |
| 91 | Ga0070700_100204485 | 3300005441 | Bacteria | 1389 |
| 92 | Ga0070708_100493044 | 3300005445 | Bacteria | 1156 |
| 93 | Ga0070708_100760858 | 3300005445 | Bacteria | 911 |
| 94 | Ga0070663_100066821 | 3300005455 | Bacteria | 2606 |
| 95 | Ga0070663_100098843 | 3300005455 | Bacteria | 2174 |
| 96 | Ga0070678_100000327 | 3300005456 | Bacteria | 22213 |
| 97 | Ga0070678_100026422 | 3300005456 | Bacteria | 3924 |
| 98 | Ga0070678_100082508 | 3300005456 | Bacteria | 2441 |
| 99 | Ga0070678_100087735 | 3300005456 | Bacteria | 2376 |
| 100 | Ga0070678_100748794 | 3300005456 | Bacteria | 884 |
| 101 | Ga0070678_102290273 | 3300005456 | Bacteria | 513 |
| 102 | Ga0070662_100051713 | 3300005457 | Bacteria | 2968 |
| 103 | Ga0070662_100174375 | 3300005457 | Bacteria | 1691 |
| 104 | Ga0070662_100763180 | 3300005457 | Bacteria | 821 |
| 105 | Ga0070662_101790447 | 3300005457 | Bacteria | 530 |
| 106 | Ga0070681_10375418 | 3300005458 | Bacteria | 1332 |
| 107 | Ga0068867_100064867 | 3300005459 | Bacteria | 2716 |
| 108 | Ga0068867_100080644 | 3300005459 | Bacteria | 2451 |
| 109 | Ga0068867_100091112 | 3300005459 | Bacteria | 2314 |
| 110 | Ga0070685_10253476 | 3300005466 | Bacteria | 1167 |
| 111 | Ga0070685_10652222 | 3300005466 | Bacteria | 763 |
| 112 | Ga0070706_101248200 | 3300005467 | Bacteria | 682 |
| 113 | Ga0070707_101777180 | 3300005468 | Bacteria | 584 |
| 114 | Ga0070684_100128821 | 3300005535 | Bacteria | 2282 |
| 115 | Ga0070684_100311540 | 3300005535 | Bacteria | 1445 |
| 116 | Ga0070697_101101688 | 3300005536 | Bacteria | 707 |
| 117 | Ga0068853_100185586 | 3300005539 | Bacteria | 1888 |
| 118 | Ga0068853_100379103 | 3300005539 | Bacteria | 1320 |
| 119 | Ga0070672_100003635 | 3300005543 | Bacteria | 10011 |
| 120 | Ga0070672_100010859 | 3300005543 | Bacteria | 6333 |
| 121 | Ga0070672_100120388 | 3300005543 | Bacteria | 2148 |
| 122 | Ga0070695_100171036 | 3300005545 | Bacteria | 1533 |
| 123 | Ga0070695_100779311 | 3300005545 | Bacteria | 765 |
| 124 | Ga0070693_100221817 | 3300005547 | Bacteria | 1239 |
| 125 | Ga0070665_100096850 | 3300005548 | Bacteria | 2955 |
| 126 | Ga0070665_100128413 | 3300005548 | Bacteria | 2538 |
| 127 | Ga0070665_101369850 | 3300005548 | Bacteria | 717 |
| 128 | Ga0070665_101540743 | 3300005548 | Bacteria | 673 |
| 129 | Ga0070704_101561729 | 3300005549 | Bacteria | 608 |
| 130 | Ga0068855_100114994 | 3300005563 | Bacteria | 3084 |
| 131 | Ga0070664_100879929 | 3300005564 | Bacteria | 839 |
| 132 | Ga0070664_101158090 | 3300005564 | Bacteria | 729 |
| 133 | Ga0068857_100323763 | 3300005577 | Bacteria | 1424 |
| 134 | Ga0068854_100083412 | 3300005578 | Bacteria | 2363 |
| 135 | Ga0068854_100243308 | 3300005578 | Bacteria | 1434 |
| 136 | Ga0068856_100042931 | 3300005614 | Bacteria | 4449 |
| 137 | Ga0068856_100044462 | 3300005614 | Bacteria | 4372 |
| 138 | Ga0070702_100564960 | 3300005615 | Bacteria | 847 |
| 139 | Ga0070702_100790184 | 3300005615 | Bacteria | 733 |
| 140 | Ga0068852_100023109 | 3300005616 | Bacteria | 4998 |
| 141 | Ga0068852_100172880 | 3300005616 | Bacteria | 2026 |
| 142 | Ga0068859_100092729 | 3300005617 | Bacteria | 3072 |
| 143 | Ga0068859_100199443 | 3300005617 | Bacteria | 2086 |
| 144 | Ga0068859_100463388 | 3300005617 | Bacteria | 1363 |
| 145 | Ga0068864_100052938 | 3300005618 | Bacteria | 3500 |
| 146 | Ga0068864_100090413 | 3300005618 | Bacteria | 2699 |
| 147 | Ga0068864_100290440 | 3300005618 | Bacteria | 1528 |
| 148 | Ga0068864_100322728 | 3300005618 | Bacteria | 1450 |
| 149 | Ga0068864_100344967 | 3300005618 | Bacteria | 1404 |
| 150 | Ga0068866_10051071 | 3300005718 | Bacteria | 2103 |
| 151 | Ga0068866_10738790 | 3300005718 | Bacteria | 679 |
| 152 | Ga0068861_100157835 | 3300005719 | Bacteria | 1868 |
| 153 | Ga0068861_100608985 | 3300005719 | Bacteria | 1004 |
| 154 | Ga0068861_101822766 | 3300005719 | Bacteria | 604 |
| 155 | Ga0068851_10024902 | 3300005834 | Bacteria | 2932 |
| 156 | Ga0068851_10038354 | 3300005834 | Bacteria | 2403 |
| 157 | Ga0068870_10040752 | 3300005840 | Bacteria | 2410 |
| 158 | Ga0068870_10699873 | 3300005840 | Bacteria | 699 |
| 159 | Ga0068863_100154561 | 3300005841 | Bacteria | 2196 |
| 160 | Ga0068863_100208630 | 3300005841 | Bacteria | 1881 |
| 161 | Ga0068863_100397529 | 3300005841 | Bacteria | 1347 |
| 162 | Ga0068863_101085569 | 3300005841 | Bacteria | 805 |
| 163 | Ga0068858_100004270 | 3300005842 | Bacteria | 14053 |
| 164 | Ga0068858_101795771 | 3300005842 | Bacteria | 606 |
| 165 | Ga0068860_100006244 | 3300005843 | Bacteria | 11972 |
| 166 | Ga0068860_100039483 | 3300005843 | Bacteria | 4514 |
| 167 | Ga0068860_100048811 | 3300005843 | Bacteria | 4034 |
| 168 | Ga0068860_101701234 | 3300005843 | Bacteria | 653 |
| 169 | Ga0068862_100065242 | 3300005844 | Bacteria | 3136 |
| 170 | Ga0068862_100170612 | 3300005844 | Bacteria | 1948 |
| 171 | Ga0068862_101241347 | 3300005844 | Bacteria | 745 |
| 172 | Ga0081455_10210306 | 3300005937 | Bacteria | 1450 |
| 173 | Ga0081539_10016553 | 3300005985 | Bacteria | 5252 |
| 174 | Ga0070717_10728593 | 3300006028 | Bacteria | 901 |
| 175 | Ga0070717_12126724 | 3300006028 | Bacteria | 505 |
| 176 | Ga0070712_100681582 | 3300006175 | Bacteria | 875 |
| 177 | Ga0097621_100043697 | 3300006237 | Bacteria | 3613 |
| 178 | Ga0097621_100122525 | 3300006237 | Bacteria | 2207 |
| 179 | Ga0097621_100272895 | 3300006237 | Bacteria | 1486 |
| 180 | Ga0097621_100529664 | 3300006237 | Bacteria | 1070 |
| 181 | Ga0068871_100013379 | 3300006358 | Bacteria | 6089 |
| 182 | Ga0068871_101440804 | 3300006358 | Unclassified | 650 |
| 183 | Ga0075428_100005627 | 3300006844 | Bacteria | 13923 |
| 184 | Ga0075428_100136599 | 3300006844 | Bacteria | 2666 |
| 185 | Ga0075428_101080657 | 3300006844 | Bacteria | 848 |
| 186 | Ga0075434_100745595 | 3300006871 | Bacteria | 996 |
| 187 | Ga0075434_101390664 | 3300006871 | Bacteria | 712 |
| 188 | Ga0075429_100176353 | 3300006880 | Bacteria | 1873 |
| 189 | Ga0068865_100027334 | 3300006881 | Bacteria | 3768 |
| 190 | Ga0068865_100047049 | 3300006881 | Bacteria | 2962 |
| 191 | Ga0068865_100121180 | 3300006881 | Bacteria | 1945 |
| 192 | Ga0068865_100406520 | 3300006881 | Bacteria | 1116 |
| 193 | Ga0075436_100297688 | 3300006914 | Bacteria | 1156 |
| 194 | Ga0075436_100833428 | 3300006914 | Bacteria | 688 |
| 195 | Ga0097620_100092731 | 3300006931 | Bacteria | 3072 |
| 196 | Ga0097620_100199432 | 3300006931 | Bacteria | 2086 |
| 197 | Ga0097620_100463394 | 3300006931 | Bacteria | 1363 |
| 198 | Ga0075435_101078312 | 3300007076 | Bacteria | 702 |
| 199 | Ga0075435_101315975 | 3300007076 | Bacteria | 633 |
| 200 | Ga0105240_10075753 | 3300009093 | Bacteria | 4149 |
| 201 | Ga0105240_10290716 | 3300009093 | Bacteria | 1874 |
| 202 | Ga0105240_12390537 | 3300009093 | Bacteria | 547 |
| 203 | Ga0111539_10029410 | 3300009094 | Bacteria | 6691 |
| 204 | Ga0111539_10100124 | 3300009094 | Bacteria | 3403 |
| 205 | Ga0111539_10104296 | 3300009094 | Bacteria | 3327 |
| 206 | Ga0111539_11069052 | 3300009094 | Bacteria | 938 |
| 207 | Ga0105245_10972752 | 3300009098 | Bacteria | 892 |
| 208 | Ga0105245_11817138 | 3300009098 | Bacteria | 662 |
| 209 | Ga0105245_12997962 | 3300009098 | Bacteria | 523 |
| 210 | Ga0105247_10025648 | 3300009101 | Bacteria | 3557 |
| 211 | Ga0105247_10424377 | 3300009101 | Unclassified | 953 |
| 212 | Ga0114129_10149274 | 3300009147 | Bacteria | 3199 |
| 213 | Ga0105243_10356474 | 3300009148 | Bacteria | 1345 |
| 214 | Ga0105241_10900004 | 3300009174 | Bacteria | 822 |
| 215 | Ga0105241_11711304 | 3300009174 | Bacteria | 611 |
| 216 | Ga0105242_10278392 | 3300009176 | Bacteria | 1518 |
| 217 | Ga0105248_10102257 | 3300009177 | Bacteria | 3230 |
| 218 | Ga0105248_10210633 | 3300009177 | Bacteria | 2190 |
| 219 | Ga0105248_11522987 | 3300009177 | Bacteria | 757 |
| 220 | Ga0105248_11726003 | 3300009177 | Bacteria | 710 |
| 221 | Ga0105248_11942552 | 3300009177 | Bacteria | 668 |
| 222 | Ga0105248_12194369 | 3300009177 | Bacteria | 628 |
| 223 | Ga0105237_10114912 | 3300009545 | Bacteria | 2685 |
| 224 | Ga0105237_10354686 | 3300009545 | Bacteria | 1471 |
| 225 | Ga0105249_10269224 | 3300009553 | Bacteria | 1696 |
| 226 | Ga0105249_10280371 | 3300009553 | Bacteria | 1664 |
| 227 | Ga0105249_12309106 | 3300009553 | Bacteria | 611 |
| 228 | Ga0105249_13240438 | 3300009553 | Bacteria | 523 |
| 229 | Ga0105239_11152857 | 3300010375 | Bacteria | 893 |
| 230 | Ga0105239_11516979 | 3300010375 | Bacteria | 774 |
| 231 | Ga0105239_12159720 | 3300010375 | Bacteria | 647 |
| 232 | Ga0105246_10225680 | 3300011119 | Bacteria | 1471 |
| 233 | Ga0105246_11055879 | 3300011119 | Bacteria | 739 |
| 234 | Ga0157336_1002805 | 3300012477 | Bacteria | 1010 |
| 235 | Ga0157322_1029736 | 3300012490 | Bacteria | 577 |
| 236 | Ga0157313_1050249 | 3300012503 | Bacteria | 540 |
| 237 | Ga0157327_1054108 | 3300012512 | Bacteria | 580 |
| 238 | Ga0157373_10063367 | 3300013100 | Bacteria | 2618 |
| 239 | Ga0157373_11053222 | 3300013100 | Bacteria | 609 |
| 240 | Ga0157371_10665099 | 3300013102 | Bacteria | 778 |
| 241 | Ga0157370_10003375 | 3300013104 | Bacteria | 18774 |
| 242 | Ga0157369_11122405 | 3300013105 | Bacteria | 803 |
| 243 | Ga0157374_10063292 | 3300013296 | Bacteria | 3469 |
| 244 | Ga0157374_10107792 | 3300013296 | Bacteria | 2677 |
| 245 | Ga0157378_10007984 | 3300013297 | Bacteria | 9239 |
| 246 | Ga0157378_10081895 | 3300013297 | Bacteria | 2918 |
| 247 | Ga0157378_10290591 | 3300013297 | Bacteria | 1579 |
| 248 | Ga0157378_10498122 | 3300013297 | Bacteria | 1217 |
| 249 | Ga0157378_12682145 | 3300013297 | Bacteria | 551 |
| 250 | Ga0163162_10033165 | 3300013306 | Bacteria | 5130 |
| 251 | Ga0163162_10121002 | 3300013306 | Bacteria | 2722 |
| 252 | Ga0163162_10138948 | 3300013306 | Bacteria | 2541 |
| 253 | Ga0163162_10590148 | 3300013306 | Bacteria | 1238 |
| 254 | Ga0163162_11067585 | 3300013306 | Bacteria | 914 |
| 255 | Ga0163162_12303188 | 3300013306 | Bacteria | 619 |
| 256 | Ga0163162_12475083 | 3300013306 | Bacteria | 597 |
| 257 | Ga0157372_10049576 | 3300013307 | Bacteria | 4669 |
| 258 | Ga0157372_11017425 | 3300013307 | Bacteria | 959 |
| 259 | Ga0157375_10026295 | 3300013308 | Bacteria | 5420 |
| 260 | Ga0157375_10047239 | 3300013308 | Bacteria | 4203 |
| 261 | Ga0157375_10102304 | 3300013308 | Bacteria | 2949 |
| 262 | Ga0157375_10246674 | 3300013308 | Bacteria | 1946 |
| 263 | Ga0157375_10325009 | 3300013308 | Bacteria | 1703 |
| 264 | Ga0157375_10544768 | 3300013308 | Bacteria | 1322 |
| 265 | Ga0157375_10815642 | 3300013308 | Bacteria | 1081 |
| 266 | Ga0157375_11497657 | 3300013308 | Bacteria | 796 |
| 267 | Ga0157375_11813563 | 3300013308 | Bacteria | 723 |
| 268 | Ga0163163_10151059 | 3300014325 | Bacteria | 2366 |
| 269 | Ga0163163_10381617 | 3300014325 | Bacteria | 1467 |
| 270 | Ga0163163_10982743 | 3300014325 | Bacteria | 907 |
| 271 | Ga0163163_11247530 | 3300014325 | Bacteria | 806 |
| 272 | Ga0163163_11946481 | 3300014325 | Bacteria | 648 |
| 273 | Ga0157380_10138399 | 3300014326 | Bacteria | 2088 |
| 274 | Ga0157380_11536852 | 3300014326 | Bacteria | 719 |
| 275 | Ga0182008_10130948 | 3300014497 | Bacteria | 1250 |
| 276 | Ga0182008_10170693 | 3300014497 | Bacteria | 1098 |
| 277 | Ga0157377_10450121 | 3300014745 | Bacteria | 889 |
| 278 | Ga0157379_10267841 | 3300014968 | Bacteria | 1553 |
| 279 | Ga0157379_11044175 | 3300014968 | Bacteria | 781 |
| 280 | Ga0157376_10036746 | 3300014969 | Bacteria | 3970 |
| 281 | Ga0157376_10054404 | 3300014969 | Bacteria | 3336 |
| 282 | Ga0157376_10068236 | 3300014969 | Bacteria | 3010 |
| 283 | Ga0157376_10693036 | 3300014969 | Bacteria | 1023 |
| 284 | Ga0157376_10751400 | 3300014969 | Bacteria | 984 |
| 285 | Ga0157376_10982462 | 3300014969 | Bacteria | 866 |
| 286 | Ga0163161_10223293 | 3300017792 | Unclassified | 1459 |
| 287 | Ga0163161_10281396 | 3300017792 | Bacteria | 1305 |
| 288 | Ga0163161_10592496 | 3300017792 | Bacteria | 913 |
| 289 | Ga0213872_10101361 | 3300021361 | Bacteria | 1283 |
| 290 | Ga0213872_10442081 | 3300021361 | Bacteria | 523 |
| 291 | Ga0213874_10144534 | 3300021377 | Bacteria | 826 |
| 292 | Ga0256744_112018 | 3300023309 | Bacteria | 4684 |
| 293 | Ga0207697_10126186 | 3300025315 | Bacteria | 1104 |
| 294 | Ga0207656_10027958 | 3300025321 | Bacteria | 2311 |
| 295 | Ga0207682_10106639 | 3300025893 | Bacteria | 1230 |
| 296 | Ga0207642_10073501 | 3300025899 | Bacteria | 1635 |
| 297 | Ga0207642_10081084 | 3300025899 | Bacteria | 1576 |
| 298 | Ga0207642_10487852 | 3300025899 | Bacteria | 752 |
| 299 | Ga0207710_10009562 | 3300025900 | Bacteria | 4077 |
| 300 | Ga0207688_10037377 | 3300025901 | Bacteria | 2692 |
| 301 | Ga0207680_10642314 | 3300025903 | Bacteria | 760 |
| 302 | Ga0207680_11034900 | 3300025903 | Bacteria | 588 |
| 303 | Ga0207647_10327037 | 3300025904 | Bacteria | 870 |
| 304 | Ga0207645_10062943 | 3300025907 | Bacteria | 2370 |
| 305 | Ga0207645_10172318 | 3300025907 | Bacteria | 1419 |
| 306 | Ga0207645_10202414 | 3300025907 | Bacteria | 1306 |
| 307 | Ga0207645_10270048 | 3300025907 | Bacteria | 1128 |
| 308 | Ga0207645_10358668 | 3300025907 | Bacteria | 976 |
| 309 | Ga0207645_10694587 | 3300025907 | Bacteria | 691 |
| 310 | Ga0207643_10007783 | 3300025908 | Bacteria | 5755 |
| 311 | Ga0207705_10962720 | 3300025909 | Bacteria | 660 |
| 312 | Ga0207654_10062727 | 3300025911 | Bacteria | 2179 |
| 313 | Ga0207695_10083172 | 3300025913 | Bacteria | 3234 |
| 314 | Ga0207671_10157809 | 3300025914 | Bacteria | 1756 |
| 315 | Ga0207671_10201922 | 3300025914 | Bacteria | 1553 |
| 316 | Ga0207693_10616275 | 3300025915 | Bacteria | 844 |
| 317 | Ga0207663_10251465 | 3300025916 | Bacteria | 1301 |
| 318 | Ga0207662_10493800 | 3300025918 | Bacteria | 842 |
| 319 | Ga0207662_10599252 | 3300025918 | Bacteria | 766 |
| 320 | Ga0207657_10331237 | 3300025919 | Bacteria | 1202 |
| 321 | Ga0207681_10068266 | 3300025923 | Bacteria | 2468 |
| 322 | Ga0207681_10637239 | 3300025923 | Bacteria | 883 |
| 323 | Ga0207681_10664201 | 3300025923 | Bacteria | 865 |
| 324 | Ga0207650_10004274 | 3300025925 | Bacteria | 9749 |
| 325 | Ga0207650_10009448 | 3300025925 | Bacteria | 6665 |
| 326 | Ga0207650_10017815 | 3300025925 | Bacteria | 4975 |
| 327 | Ga0207650_10018767 | 3300025925 | Bacteria | 4857 |
| 328 | Ga0207650_10873769 | 3300025925 | Bacteria | 763 |
| 329 | Ga0207659_10267157 | 3300025926 | Bacteria | 1394 |
| 330 | Ga0207659_10327483 | 3300025926 | Bacteria | 1265 |
| 331 | Ga0207659_11176435 | 3300025926 | Bacteria | 659 |
| 332 | Ga0207659_11318625 | 3300025926 | Bacteria | 619 |
| 333 | Ga0207659_11382301 | 3300025926 | Bacteria | 604 |
| 334 | Ga0207700_11716352 | 3300025928 | Bacteria | 553 |
| 335 | Ga0207664_10736803 | 3300025929 | Bacteria | 886 |
| 336 | Ga0207644_10000883 | 3300025931 | Bacteria | 18912 |
| 337 | Ga0207644_10076281 | 3300025931 | Bacteria | 2466 |
| 338 | Ga0207644_10119393 | 3300025931 | Bacteria | 2005 |
| 339 | Ga0207644_10154493 | 3300025931 | Bacteria | 1778 |
| 340 | Ga0207644_10179249 | 3300025931 | Bacteria | 1659 |
| 341 | Ga0207690_10047030 | 3300025932 | Bacteria | 2861 |
| 342 | Ga0207690_10265741 | 3300025932 | Bacteria | 1331 |
| 343 | Ga0207690_10513488 | 3300025932 | Bacteria | 970 |
| 344 | Ga0207690_10840035 | 3300025932 | Bacteria | 760 |
| 345 | Ga0207706_10035361 | 3300025933 | Bacteria | 4443 |
| 346 | Ga0207706_10089111 | 3300025933 | Bacteria | 2712 |
| 347 | Ga0207706_10271395 | 3300025933 | Bacteria | 1480 |
| 348 | Ga0207706_10503242 | 3300025933 | Bacteria | 1046 |
| 349 | Ga0207706_10530772 | 3300025933 | Bacteria | 1014 |
| 350 | Ga0207706_10743033 | 3300025933 | Bacteria | 836 |
| 351 | Ga0207706_11085226 | 3300025933 | Bacteria | 669 |
| 352 | Ga0207686_11266190 | 3300025934 | Bacteria | 605 |
| 353 | Ga0207709_11183660 | 3300025935 | Bacteria | 629 |
| 354 | Ga0207670_10207757 | 3300025936 | Bacteria | 1491 |
| 355 | Ga0207669_10132217 | 3300025937 | Bacteria | 1717 |
| 356 | Ga0207669_10132341 | 3300025937 | Bacteria | 1716 |
| 357 | Ga0207669_10235381 | 3300025937 | Bacteria | 1354 |
| 358 | Ga0207669_11239385 | 3300025937 | Bacteria | 633 |
| 359 | Ga0207704_10115963 | 3300025938 | Bacteria | 1821 |
| 360 | Ga0207704_10282747 | 3300025938 | Bacteria | 1262 |
| 361 | Ga0207704_10708738 | 3300025938 | Bacteria | 834 |
| 362 | Ga0207691_10006216 | 3300025940 | Bacteria | 11531 |
| 363 | Ga0207691_10025524 | 3300025940 | Bacteria | 5546 |
| 364 | Ga0207691_10045309 | 3300025940 | Bacteria | 4044 |
| 365 | Ga0207711_10095839 | 3300025941 | Bacteria | 2618 |
| 366 | Ga0207711_10604944 | 3300025941 | Bacteria | 1023 |
| 367 | Ga0207711_11456076 | 3300025941 | Bacteria | 628 |
| 368 | Ga0207689_10058818 | 3300025942 | Bacteria | 3162 |
| 369 | Ga0207689_10237998 | 3300025942 | Bacteria | 1505 |
| 370 | Ga0207689_10559590 | 3300025942 | Bacteria | 961 |
| 371 | Ga0207689_11393974 | 3300025942 | Bacteria | 587 |
| 372 | Ga0207661_10609477 | 3300025944 | Bacteria | 1002 |
| 373 | Ga0207679_10110578 | 3300025945 | Bacteria | 2168 |
| 374 | Ga0207679_10399474 | 3300025945 | Bacteria | 1209 |
| 375 | Ga0207679_10428698 | 3300025945 | Bacteria | 1168 |
| 376 | Ga0207679_10901310 | 3300025945 | Bacteria | 809 |
| 377 | Ga0207651_10210875 | 3300025960 | Bacteria | 1563 |
| 378 | Ga0207651_11349383 | 3300025960 | Bacteria | 641 |
| 379 | Ga0207651_11424838 | 3300025960 | Bacteria | 624 |
| 380 | Ga0207712_10204524 | 3300025961 | Bacteria | 1568 |
| 381 | Ga0207712_10875968 | 3300025961 | Bacteria | 792 |
| 382 | Ga0207712_11214831 | 3300025961 | Bacteria | 673 |
| 383 | Ga0207668_10216740 | 3300025972 | Bacteria | 1534 |
| 384 | Ga0207668_10472094 | 3300025972 | Bacteria | 1074 |
| 385 | Ga0207668_11324917 | 3300025972 | Bacteria | 648 |
| 386 | Ga0207668_11460419 | 3300025972 | Bacteria | 617 |
| 387 | Ga0207640_10004152 | 3300025981 | Bacteria | 7829 |
| 388 | Ga0207640_10325567 | 3300025981 | Bacteria | 1225 |
| 389 | Ga0207658_10041770 | 3300025986 | Bacteria | 3322 |
| 390 | Ga0207658_10261512 | 3300025986 | Bacteria | 1475 |
| 391 | Ga0207658_10447524 | 3300025986 | Bacteria | 1143 |
| 392 | Ga0207658_10719520 | 3300025986 | Bacteria | 903 |
| 393 | Ga0207658_10738490 | 3300025986 | Bacteria | 891 |
| 394 | Ga0207677_10003662 | 3300026023 | Bacteria | 8158 |
| 395 | Ga0207677_10206872 | 3300026023 | Bacteria | 1564 |
| 396 | Ga0207677_10270077 | 3300026023 | Bacteria | 1391 |
| 397 | Ga0207677_11193963 | 3300026023 | Bacteria | 696 |
| 398 | Ga0207703_10019203 | 3300026035 | Bacteria | 5338 |
| 399 | Ga0207703_10035587 | 3300026035 | Bacteria | 3957 |
| 400 | Ga0207703_10647877 | 3300026035 | Bacteria | 1002 |
| 401 | Ga0207703_11225635 | 3300026035 | Bacteria | 721 |
| 402 | Ga0207639_10397612 | 3300026041 | Bacteria | 1241 |
| 403 | Ga0207678_10005556 | 3300026067 | Bacteria | 11267 |
| 404 | Ga0207678_10356050 | 3300026067 | Bacteria | 1263 |
| 405 | Ga0207708_10174199 | 3300026075 | Bacteria | 1705 |
| 406 | Ga0207708_10214751 | 3300026075 | Bacteria | 1539 |
| 407 | Ga0207702_10074732 | 3300026078 | Bacteria | 2926 |
| 408 | Ga0207702_10128657 | 3300026078 | Bacteria | 2276 |
| 409 | Ga0207641_10002325 | 3300026088 | Bacteria | 17632 |
| 410 | Ga0207641_10007438 | 3300026088 | Bacteria | 9110 |
| 411 | Ga0207641_10055785 | 3300026088 | Bacteria | 3355 |
| 412 | Ga0207641_10306595 | 3300026088 | Bacteria | 1501 |
| 413 | Ga0207641_11511704 | 3300026088 | Bacteria | 673 |
| 414 | Ga0207641_12116010 | 3300026088 | Bacteria | 563 |
| 415 | Ga0207648_10005997 | 3300026089 | Bacteria | 12143 |
| 416 | Ga0207648_10154153 | 3300026089 | Bacteria | 2028 |
| 417 | Ga0207648_10538541 | 3300026089 | Bacteria | 1071 |
| 418 | Ga0207676_10005874 | 3300026095 | Bacteria | 8668 |
| 419 | Ga0207676_10080615 | 3300026095 | Bacteria | 2642 |
| 420 | Ga0207676_10083154 | 3300026095 | Bacteria | 2606 |
| 421 | Ga0207676_10210305 | 3300026095 | Bacteria | 1725 |
| 422 | Ga0207676_10833089 | 3300026095 | Bacteria | 901 |
| 423 | Ga0207676_10852583 | 3300026095 | Bacteria | 891 |
| 424 | Ga0207676_10855268 | 3300026095 | Bacteria | 890 |
| 425 | Ga0207674_10415385 | 3300026116 | Bacteria | 1300 |
| 426 | Ga0207675_100020639 | 3300026118 | Bacteria | 6140 |
| 427 | Ga0207675_100166548 | 3300026118 | Bacteria | 2105 |
| 428 | Ga0207675_100458287 | 3300026118 | Bacteria | 1264 |
| 429 | Ga0207675_100538668 | 3300026118 | Bacteria | 1165 |
| 430 | Ga0207675_101342193 | 3300026118 | Bacteria | 736 |
| 431 | Ga0207675_101898458 | 3300026118 | Bacteria | 614 |
| 432 | Ga0207683_10001392 | 3300026121 | Bacteria | 21816 |
| 433 | Ga0207683_10025934 | 3300026121 | Bacteria | 5059 |
| 434 | Ga0207683_10080176 | 3300026121 | Bacteria | 2895 |
| 435 | Ga0207683_10308643 | 3300026121 | Bacteria | 1448 |
| 436 | Ga0207683_10831464 | 3300026121 | Bacteria | 857 |
| 437 | Ga0207698_10035123 | 3300026142 | Bacteria | 3663 |
| 438 | Ga0207698_10091691 | 3300026142 | Bacteria | 2488 |
| 439 | Ga0209974_10010320 | 3300027876 | Bacteria | 3151 |
| 440 | Ga0209974_10113611 | 3300027876 | Bacteria | 955 |
| 441 | Ga0207428_10008889 | 3300027907 | Bacteria | 9048 |
| 442 | Ga0207428_10177011 | 3300027907 | Bacteria | 1613 |
| 443 | Ga0268266_10010307 | 3300028379 | Bacteria | 8174 |
| 444 | Ga0268266_10022673 | 3300028379 | Bacteria | 5345 |
| 445 | Ga0268266_10334088 | 3300028379 | Bacteria | 1421 |
| 446 | Ga0268266_10853193 | 3300028379 | Bacteria | 880 |
| 447 | Ga0268266_11719288 | 3300028379 | Bacteria | 602 |
| 448 | Ga0268265_10056316 | 3300028380 | Bacteria | 2990 |
| 449 | Ga0268265_10156946 | 3300028380 | Bacteria | 1927 |
| 450 | Ga0268264_10000102 | 3300028381 | Bacteria | 222526 |
| 451 | Ga0268264_10221924 | 3300028381 | Bacteria | 1740 |
| 452 | Ga0268264_10981412 | 3300028381 | Bacteria | 851 |
| 453 | Ga0268264_11008892 | 3300028381 | Bacteria | 839 |
| 454 | Ga0268264_12185674 | 3300028381 | Bacteria | 561 |
| 455 | Ga0265338_10316023 | 3300028800 | Bacteria | 1132 |
| 456 | Ga0307511_10056308 | 3300030521 | Bacteria | 3076 |
| 457 | Ga0265330_10004608 | 3300031235 | Bacteria | 6970 |
| 458 | Ga0265332_10001783 | 3300031238 | Bacteria | 11615 |
| 459 | Ga0265332_10193672 | 3300031238 | Bacteria | 846 |
| 460 | Ga0265340_10020617 | 3300031247 | Bacteria | 3384 |
| 461 | Ga0265331_10000635 | 3300031250 | Bacteria | 30467 |
| 462 | Ga0265327_10031432 | 3300031251 | Bacteria | 2983 |
| 463 | Ga0307408_100525650 | 3300031548 | Bacteria | 1040 |
| 464 | Ga0316575_10001575 | 3300031665 | Bacteria | 7413 |
| 465 | Ga0265314_10070955 | 3300031711 | Bacteria | 2332 |
| 466 | Ga0265342_10445975 | 3300031712 | Bacteria | 664 |
| 467 | Ga0307412_10348371 | 3300031911 | Bacteria | 1188 |
| 468 | Ga0307416_100230420 | 3300032002 | Bacteria | 1785 |
| 469 | Ga0307411_11042489 | 3300032005 | Bacteria | 734 |
| 470 | Ga0316593_10000049 | 3300032168 | Bacteria | 13299 |
| 471 | Ga0316593_10000058 | 3300032168 | Bacteria | 12691 |
| 472 | Ga0316593_10005257 | 3300032168 | Bacteria | 3398 |
| 473 | Ga0316593_10005293 | 3300032168 | Bacteria | 3388 |
| 474 | Ga0316593_10010662 | 3300032168 | Bacteria | 2645 |
| 475 | Ga0316593_10020416 | 3300032168 | Bacteria | 2060 |
| 476 | Ga0316593_10100138 | 3300032168 | Bacteria | 1027 |
| 477 | Ga0316593_10111466 | 3300032168 | Bacteria | 977 |
| 478 | Ga0307510_10000006 | 3300033180 | Bacteria | 566474 |
| 479 | Ga0307510_10029950 | 3300033180 | Bacteria | 6180 |
| 480 | Ga0316592_1051470 | 3300033524 | Bacteria | 920 |
| 481 | Ga0316588_1018137 | 3300033528 | Bacteria | 1574 |
| 482 | Ga0316588_1131490 | 3300033528 | Unclassified | 637 |
| 483 | Ga0316587_1000182 | 3300033529 | Bacteria | 5325 |
| 484 | Ga0316587_1012260 | 3300033529 | Bacteria | 1392 |
| 485 | Ga0316587_1015548 | 3300033529 | Bacteria | 1263 |
| 486 | Ga0316587_1108024 | 3300033529 | Bacteria | 539 |
| 487 | Ga0316596_1000880 | 3300033541 | Bacteria | 5653 |
| 488 | Ga0316596_1026187 | 3300033541 | Bacteria | 1503 |
| 489 | Ga0373923_0303929 | 3300035111 | Bacteria | 755 |
| 490 | Ga0373939_0062064 | 3300035114 | Bacteria | 1193 |
| 491 | Ga0373939_0403737 | 3300035114 | Bacteria | 567 |
| 492 | Ga0373924_0465545 | 3300035410 | Bacteria | 567 |
| 493 | Ga0373931_0552599 | 3300035691 | Bacteria | 748 |
| 494 | Ga0373931_0715389 | 3300035691 | Bacteria | 662 |
| 495 | Ga0373935_0131323 | 3300035692 | Bacteria | 1683 |
| 496 | Ga0373935_0313334 | 3300035692 | Bacteria | 1112 |
| 497 | Ga0373933_0068883 | 3300035724 | Bacteria | 2150 |
| 498 | Ga0373933_0360221 | 3300035724 | Bacteria | 946 |
| 499 | Ga0373937_0054320 | 3300036401 | Bacteria | 3675 |
| 500 | Ga0373925_0031180 | 3300037068 | Bacteria | 3916 |
| 501 | Ga0395900_0046031 | 3300037418 | Bacteria | 4493 |
| 502 | Ga0395905_0307437 | 3300037471 | Bacteria | 1474 |
| 503 | Ga0395901_0220488 | 3300038443 | Bacteria | 1983 |
| 504 | Ga0395901_0364811 | 3300038443 | Bacteria | 1489 |
| 505 | Ga0436365_1843324 | 3300039437 | Bacteria | 986 |
| 506 | Ga0436361_0015574 | 3300039447 | Bacteria | 1138 |
| 507 | Ga0436361_0020791 | 3300039447 | Bacteria | 531 |
| 508 | Ga0436363_0712517 | 3300039450 | Bacteria | 1172 |
| 509 | Ga0439447_168955 | 3300041407 | Bacteria | 504 |
| 510 | Ga0451805_115470 | 3300041461 | Bacteria | 559 |
| 511 | Ga0451807_2644321 | 3300041486 | Bacteria | 852 |
| 512 | Ga0451845_0449866 | 3300041501 | Bacteria | 511 |
| 513 | Ga0451851_0752822 | 3300041507 | Bacteria | 637 |
| 514 | Ga0451851_1147119 | 3300041507 | Bacteria | 839 |
| 515 | Ga0451853_2627193 | 3300041512 | Bacteria | 627 |
| 516 | Ga0451853_3854955 | 3300041512 | Bacteria | 583 |
| 517 | Ga0439435_0010142 | 3300042436 | Bacteria | 2228 |
| 518 | Ga0439460_0125495 | 3300042461 | Bacteria | 842 |
| 519 | Ga0450916_039082 | 3300042530 | Bacteria | 716 |
| 520 | Ga0451576_0077585 | 3300045051 | Bacteria | 3457 |
| 521 | Ga0495582_0685849 | 3300046473 | Bacteria | 593 |
| 522 | Ga0495606_0121911 | 3300046507 | Bacteria | 1560 |
| 523 | Ga0495608_0894358 | 3300046511 | Bacteria | 520 |
| 524 | Ga0495632_0032155 | 3300046519 | Bacteria | 2706 |
| 525 | Ga0495643_0036660 | 3300046522 | Bacteria | 2693 |
| 526 | Ga0495643_0245094 | 3300046522 | Bacteria | 839 |
| 527 | Ga0495648_0038970 | 3300046524 | Bacteria | 3031 |
| 528 | Ga0495640_0510207 | 3300046533 | Bacteria | 731 |
| 529 | Ga0495609_0236791 | 3300046538 | Bacteria | 755 |
| 530 | Ga0495668_0105281 | 3300046616 | Bacteria | 1543 |
| 531 | Ga0495625_0316795 | 3300046660 | Bacteria | 994 |
| 532 | Ga0495669_0182168 | 3300046684 | Bacteria | 1002 |
| 533 | Ga0495613_0095378 | 3300046689 | Bacteria | 2152 |
| 534 | Ga0495649_0300158 | 3300046694 | Bacteria | 818 |
| 535 | Ga0495581_0237132 | 3300047315 | Bacteria | 1067 |
| 536 | Ga0495636_0371815 | 3300047318 | Bacteria | 677 |
| 537 | Ga0495683_0468386 | 3300047323 | Bacteria | 515 |
| 538 | Ga0495687_029441 | 3300047443 | Bacteria | 2542 |
| 539 | Ga0495687_032507 | 3300047443 | Bacteria | 2380 |
| 540 | Ga0495675_0358107 | 3300047444 | Bacteria | 857 |
| 541 | Ga0495686_0591316 | 3300047472 | Bacteria | 576 |
| 542 | Ga0496100_0064332 | 3300048903 | Bacteria | 2427 |
| 543 | Ga0496100_0110723 | 3300048903 | Bacteria | 1907 |
| 544 | Ga0496101_0749609 | 3300048904 | Unclassified | 771 |
| 545 | Ga0496101_1359051 | 3300048904 | Bacteria | 555 |
| 546 | Ga0496101_1554436 | 3300048904 | Bacteria | 514 |
| 547 | Ga0496102_0003295 | 3300048905 | Bacteria | 13691 |
| 548 | Ga0496102_0218206 | 3300048905 | Bacteria | 1798 |
| 549 | Ga0496103_0040660 | 3300048906 | Bacteria | 2857 |
| 550 | Ga0496104_0290043 | 3300048907 | Bacteria | 1549 |
| 551 | Ga0496105_0562661 | 3300048908 | Bacteria | 889 |
| 552 | Ga0496106_0530886 | 3300048909 | Unclassified | 945 |
| 553 | Ga0496107_0444656 | 3300048910 | Unclassified | 963 |
| 554 | Ga0496107_0663132 | 3300048910 | Bacteria | 769 |
| 555 | Ga0496108_0051456 | 3300048911 | Bacteria | 3451 |
| 556 | Ga0496108_0168503 | 3300048911 | Bacteria | 1894 |
| 557 | Ga0496108_0409111 | 3300048911 | Bacteria | 1185 |
| 558 | Ga0496108_0812471 | 3300048911 | Unclassified | 806 |
| 559 | Ga0496108_1233528 | 3300048911 | Bacteria | 631 |
| 560 | Ga0496109_0001894 | 3300048912 | Bacteria | 17370 |
| 561 | Ga0496109_0128868 | 3300048912 | Bacteria | 2360 |
| 562 | Ga0496109_1784286 | 3300048912 | Bacteria | 548 |
| 563 | Ga0496110_0012098 | 3300048913 | Bacteria | 7089 |
| 564 | Ga0496112_0188174 | 3300048915 | Bacteria | 2027 |
| 565 | Ga0496112_1043092 | 3300048915 | Bacteria | 737 |
| 566 | Ga0496112_1636177 | 3300048915 | Bacteria | 557 |
| 567 | Ga0496113_0189425 | 3300048916 | Bacteria | 1633 |
| 568 | Ga0496113_0227897 | 3300048916 | Bacteria | 1486 |
| 569 | Ga0496114_0005126 | 3300048917 | Bacteria | 10216 |
| 570 | Ga0496114_0051718 | 3300048917 | Bacteria | 3421 |
| 571 | Ga0496115_0071247 | 3300048918 | Bacteria | 2819 |
| 572 | Ga0496115_0761495 | 3300048918 | Unclassified | 756 |
| 573 | Ga0496115_0798008 | 3300048918 | Bacteria | 735 |
| 574 | Ga0496117_0000787 | 3300048920 | Bacteria | 49745 |
| 575 | Ga0496118_0000032 | 3300048921 | Bacteria | 330072 |
| 576 | Ga0496119_0055285 | 3300048922 | Bacteria | 2411 |
| 577 | Ga0496119_0116851 | 3300048922 | Bacteria | 1471 |
| 578 | Ga0496120_0036388 | 3300048923 | Bacteria | 2930 |
| 579 | Ga0496120_0151997 | 3300048923 | Bacteria | 1162 |
| 580 | Ga0496121_0028362 | 3300048924 | Bacteria | 5213 |
| 581 | Ga0496121_0113839 | 3300048924 | Bacteria | 2057 |
| 582 | Ga0496124_0006228 | 3300048927 | Bacteria | 13069 |
| 583 | Ga0496125_0001378 | 3300048928 | Bacteria | 35674 |
| 584 | Ga0496126_0011396 | 3300048929 | Bacteria | 9209 |
| 585 | Ga0495682_0171445 | 3300049460 | Bacteria | 772 |
| 586 | Ga0501031_0003260 | 3300049568 | Bacteria | 10431 |
| 587 | Ga0501031_0009677 | 3300049568 | Bacteria | 6275 |
| 588 | Ga0501032_0000036 | 3300049569 | Bacteria | 117044 |
| 589 | Ga0501032_0023103 | 3300049569 | Bacteria | 4304 |
| 590 | Ga0501032_0028750 | 3300049569 | Bacteria | 3818 |
| 591 | Ga0501032_0358499 | 3300049569 | Bacteria | 939 |
| 592 | Ga0501032_1036574 | 3300049569 | Bacteria | 515 |
| 593 | Ga0501033_0001817 | 3300049570 | Bacteria | 18639 |
| 594 | Ga0501033_0003966 | 3300049570 | Bacteria | 11998 |
| 595 | Ga0501033_0016663 | 3300049570 | Bacteria | 5558 |
| 596 | Ga0501034_0003361 | 3300049571 | Bacteria | 18264 |
| 597 | Ga0501034_0017280 | 3300049571 | Bacteria | 7400 |
| 598 | Ga0501034_0417785 | 3300049571 | Bacteria | 1263 |
| 599 | Ga0501036_0000512 | 3300049572 | Bacteria | 27832 |
| 600 | Ga0501036_0001490 | 3300049572 | Bacteria | 18035 |
| 601 | Ga0501036_0002120 | 3300049572 | Bacteria | 15493 |
| 602 | Ga0501037_0001263 | 3300049573 | Bacteria | 18639 |
| 603 | Ga0501037_0157957 | 3300049573 | Bacteria | 1617 |
| 604 | Ga0501037_0379343 | 3300049573 | Bacteria | 972 |
| 605 | Ga0501037_0701742 | 3300049573 | Bacteria | 673 |
| 606 | Ga0501038_0003243 | 3300049574 | Bacteria | 15162 |
| 607 | Ga0501038_0004836 | 3300049574 | Bacteria | 12512 |
| 608 | Ga0501038_0055092 | 3300049574 | Bacteria | 3417 |
| 609 | Ga0501038_0189573 | 3300049574 | Bacteria | 1655 |
| 610 | Ga0501038_0413062 | 3300049574 | Bacteria | 1042 |
| 611 | Ga0501039_0011968 | 3300049575 | Bacteria | 6612 |
| 612 | Ga0501040_0000218 | 3300049576 | Bacteria | 33403 |
| 613 | Ga0501042_0000031 | 3300049578 | Bacteria | 46017 |
| 614 | Ga0501043_0000157 | 3300049579 | Bacteria | 62190 |
| 615 | Ga0501043_0006833 | 3300049579 | Bacteria | 9109 |
| 616 | Ga0501043_0016645 | 3300049579 | Bacteria | 5762 |
| 617 | Ga0501043_0373052 | 3300049579 | Bacteria | 1081 |
| 618 | Ga0501046_0002577 | 3300049580 | Bacteria | 16965 |
| 619 | Ga0501046_0004484 | 3300049580 | Bacteria | 12660 |
| 620 | Ga0501046_0309239 | 3300049580 | Bacteria | 1153 |
| 621 | Ga0501047_0002207 | 3300049581 | Bacteria | 18639 |
| 622 | Ga0501048_0002716 | 3300049582 | Bacteria | 13496 |
| 623 | Ga0501068_0001608 | 3300049584 | Bacteria | 12025 |
| 624 | Ga0501068_0004846 | 3300049584 | Bacteria | 7326 |
| 625 | Ga0501069_0258868 | 3300049585 | Bacteria | 1016 |
| 626 | Ga0501070_0090993 | 3300049586 | Bacteria | 2525 |
| 627 | Ga0501073_0048394 | 3300049589 | Bacteria | 2984 |
| 628 | Ga0501074_0060457 | 3300049590 | Bacteria | 2730 |
| 629 | Ga0501077_0131618 | 3300049593 | Bacteria | 1586 |
| 630 | Ga0501208_070567 | 3300049655 | Bacteria | 702 |
| 631 | Ga0501247_032709 | 3300049677 | Bacteria | 717 |
| 632 | Ga0501247_037686 | 3300049677 | Bacteria | 682 |
| 633 | Ga0501080_0206492 | 3300049742 | Bacteria | 1801 |
| 634 | Ga0501083_0031483 | 3300049744 | Bacteria | 3641 |
| 635 | Ga0501272_065513 | 3300049769 | Bacteria | 525 |
| 636 | Ga0501035_0000671 | 3300049822 | Bacteria | 37548 |
| 637 | Ga0501035_0008893 | 3300049822 | Bacteria | 9344 |
| 638 | Ga0501035_0015787 | 3300049822 | Bacteria | 6971 |
| 639 | Ga0501035_0234791 | 3300049822 | Bacteria | 1562 |
| 640 | Ga0501044_0000389 | 3300049823 | Bacteria | 54483 |
| 641 | Ga0501044_0000747 | 3300049823 | Bacteria | 39287 |
| 642 | Ga0501044_0220241 | 3300049823 | Bacteria | 1848 |
| 643 | Ga0501045_0006501 | 3300049824 | Bacteria | 8101 |
| 644 | nmdc:mga05p37_366836_c1 | 3300050507 | Bacteria | 1691 |
| 645 | nmdc:mga09592_121026_c1 | 3300050508 | Bacteria | 2248 |
| 646 | nmdc:mga09592_507837_c1 | 3300050508 | Bacteria | 1037 |
| 647 | nmdc:mga08y16_199488_c1 | 3300050511 | Bacteria | 2074 |
| 648 | nmdc:mga08y16_20173_c1 | 3300050511 | Bacteria | 7034 |
| 649 | nmdc:mga08y16_589314_c1 | 3300050511 | Bacteria | 1122 |
| 650 | nmdc:mga08y16_760951_c1 | 3300050511 | Bacteria | 964 |
| 651 | nmdc:mga0n895_1357379_c1 | 3300050512 | Bacteria | 680 |
| 652 | nmdc:mga0n895_853969_c1 | 3300050512 | Bacteria | 898 |
| 653 | nmdc:mga0rr50_1768315_c1 | 3300050513 | Bacteria | 520 |
| 654 | nmdc:mga08x19_277008_c1 | 3300050514 | Bacteria | 1162 |
| 655 | nmdc:mga08x19_665196_c1 | 3300050514 | Bacteria | 739 |
| 656 | Ga0495595_0208123 | 3300053084 | Bacteria | 975 |
| 657 | Ga0495619_0434586 | 3300053085 | Bacteria | 905 |
| 658 | Ga0500556_0000690 | 3300053104 | Bacteria | 20756 |
| 659 | Ga0500614_025617 | 3300053123 | Bacteria | 1404 |
| 660 | Ga0500559_0055356 | 3300053136 | Bacteria | 1759 |
| 661 | Ga0500577_0265469 | 3300053142 | Bacteria | 747 |
| 662 | Ga0500590_096636 | 3300053148 | Bacteria | 1425 |
| 663 | Ga0500633_0065316 | 3300053160 | Bacteria | 1289 |
| 664 | Ga0500639_108651 | 3300053163 | Bacteria | 1353 |
| 665 | Ga0587077_080226 | 3300059493 | Bacteria | 747 |
| 666 | Ga0587080_045007 | 3300059503 | Bacteria | 816 |
| 667 | Ga0501082_0750018 | 3300060353 | Bacteria | 854 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028800 | Ga0265338_10316023 | Ga0265338_103160233 | 90 |
| 2 | 3300012477 | Ga0157336_1002805 | Ga0157336_10028051 | 92 |
| 3 | 3300049569 | Ga0501032_0358499 | Ga0501032_0358499_236_553 | 93 |
| 4 | 3300049570 | Ga0501033_0016663 | Ga0501033_0016663_4136_4453 | 93 |
| 5 | 3300049573 | Ga0501037_0157957 | Ga0501037_0157957_1114_1431 | 93 |
| 6 | 3300049574 | Ga0501038_0189573 | Ga0501038_0189573_574_891 | 93 |
| 7 | iso_pu_bacteria | 2923525760 | 2923526650 | 101 |
| 8 | 3300005328 | Ga0070676_10034458 | Ga0070676_100344583 | 102 |
| 9 | 3300005328 | Ga0070676_10105590 | Ga0070676_101055903 | 102 |
| 10 | 3300005328 | Ga0070676_10658917 | Ga0070676_106589172 | 102 |
| 11 | 3300005328 | Ga0070676_10995701 | Ga0070676_109957011 | 102 |
| 12 | 3300005328 | Ga0070676_11182769 | Ga0070676_111827691 | 102 |
| 13 | 3300005330 | Ga0070690_100219365 | Ga0070690_1002193652 | 102 |
| 14 | 3300005331 | Ga0070670_100516327 | Ga0070670_1005163272 | 102 |
| 15 | 3300005331 | Ga0070670_100889294 | Ga0070670_1008892942 | 102 |
| 16 | 3300005331 | Ga0070670_101099751 | Ga0070670_1010997512 | 102 |
| 17 | 3300005333 | Ga0070677_10195851 | Ga0070677_101958512 | 102 |
| 18 | 3300005334 | Ga0068869_100037989 | Ga0068869_1000379894 | 102 |
| 19 | 3300005334 | Ga0068869_101867977 | Ga0068869_1018679771 | 102 |
| 20 | 3300005335 | Ga0070666_10045917 | Ga0070666_100459176 | 102 |
| 21 | 3300005338 | Ga0068868_102204895 | Ga0068868_1022048951 | 102 |
| 22 | 3300005340 | Ga0070689_100022606 | Ga0070689_1000226067 | 102 |
| 23 | 3300005347 | Ga0070668_100117321 | Ga0070668_1001173215 | 102 |
| 24 | 3300005347 | Ga0070668_100581630 | Ga0070668_1005816302 | 102 |
| 25 | 3300005353 | Ga0070669_100038030 | Ga0070669_1000380306 | 102 |
| 26 | 3300005354 | Ga0070675_100011102 | Ga0070675_1000111022 | 102 |
| 27 | 3300005354 | Ga0070675_100078697 | Ga0070675_1000786972 | 102 |
| 28 | 3300005354 | Ga0070675_101850210 | Ga0070675_1018502101 | 102 |
| 29 | 3300005355 | Ga0070671_100046754 | Ga0070671_1000467547 | 102 |
| 30 | 3300005355 | Ga0070671_100231377 | Ga0070671_1002313773 | 102 |
| 31 | 3300005355 | Ga0070671_100385170 | Ga0070671_1003851702 | 102 |
| 32 | 3300005356 | Ga0070674_100096649 | Ga0070674_1000966491 | 102 |
| 33 | 3300005356 | Ga0070674_101365702 | Ga0070674_1013657021 | 102 |
| 34 | 3300005356 | Ga0070674_101582596 | Ga0070674_1015825961 | 102 |
| 35 | 3300005364 | Ga0070673_100034303 | Ga0070673_1000343038 | 102 |
| 36 | 3300005364 | Ga0070673_100231366 | Ga0070673_1002313662 | 102 |
| 37 | 3300005364 | Ga0070673_100873619 | Ga0070673_1008736192 | 102 |
| 38 | 3300005367 | Ga0070667_100022362 | Ga0070667_1000223625 | 102 |
| 39 | 3300005367 | Ga0070667_100163030 | Ga0070667_1001630305 | 102 |
| 40 | 3300005367 | Ga0070667_101539402 | Ga0070667_1015394022 | 102 |
| 41 | 3300005438 | Ga0070701_10058119 | Ga0070701_100581192 | 102 |
| 42 | 3300005440 | Ga0070705_100228096 | Ga0070705_1002280962 | 102 |
| 43 | 3300005445 | Ga0070708_100493044 | Ga0070708_1004930442 | 102 |
| 44 | 3300005445 | Ga0070708_100760858 | Ga0070708_1007608582 | 102 |
| 45 | 3300005456 | Ga0070678_100026422 | Ga0070678_1000264223 | 102 |
| 46 | 3300005456 | Ga0070678_100082508 | Ga0070678_1000825082 | 102 |
| 47 | 3300005456 | Ga0070678_100748794 | Ga0070678_1007487941 | 102 |
| 48 | 3300005456 | Ga0070678_102290273 | Ga0070678_1022902732 | 102 |
| 49 | 3300005457 | Ga0070662_100051713 | Ga0070662_1000517132 | 102 |
| 50 | 3300005459 | Ga0068867_100064867 | Ga0068867_1000648672 | 102 |
| 51 | 3300005459 | Ga0068867_100080644 | Ga0068867_1000806443 | 102 |
| 52 | 3300005466 | Ga0070685_10253476 | Ga0070685_102534762 | 102 |
| 53 | 3300005466 | Ga0070685_10652222 | Ga0070685_106522222 | 102 |
| 54 | 3300005468 | Ga0070707_101777180 | Ga0070707_1017771802 | 102 |
| 55 | 3300005543 | Ga0070672_100010859 | Ga0070672_1000108599 | 102 |
| 56 | 3300005543 | Ga0070672_100120388 | Ga0070672_1001203882 | 102 |
| 57 | 3300005545 | Ga0070695_100171036 | Ga0070695_1001710363 | 102 |
| 58 | 3300005545 | Ga0070695_100779311 | Ga0070695_1007793111 | 102 |
| 59 | 3300005548 | Ga0070665_101369850 | Ga0070665_1013698502 | 102 |
| 60 | 3300005615 | Ga0070702_100790184 | Ga0070702_1007901842 | 102 |
| 61 | 3300005617 | Ga0068859_100199443 | Ga0068859_1001994435 | 102 |
| 62 | 3300005617 | Ga0068859_100463388 | Ga0068859_1004633883 | 102 |
| 63 | 3300005618 | Ga0068864_100290440 | Ga0068864_1002904402 | 102 |
| 64 | 3300005618 | Ga0068864_100322728 | Ga0068864_1003227282 | 102 |
| 65 | 3300005618 | Ga0068864_100344967 | Ga0068864_1003449672 | 102 |
| 66 | 3300005719 | Ga0068861_100157835 | Ga0068861_1001578352 | 102 |
| 67 | 3300005719 | Ga0068861_100608985 | Ga0068861_1006089852 | 102 |
| 68 | 3300005840 | Ga0068870_10040752 | Ga0068870_100407524 | 102 |
| 69 | 3300005841 | Ga0068863_100208630 | Ga0068863_1002086302 | 102 |
| 70 | 3300005841 | Ga0068863_100397529 | Ga0068863_1003975292 | 102 |
| 71 | 3300005841 | Ga0068863_101085569 | Ga0068863_1010855692 | 102 |
| 72 | 3300005843 | Ga0068860_100039483 | Ga0068860_1000394836 | 102 |
| 73 | 3300005843 | Ga0068860_100048811 | Ga0068860_1000488119 | 102 |
| 74 | 3300005843 | Ga0068860_101701234 | Ga0068860_1017012342 | 102 |
| 75 | 3300005844 | Ga0068862_100170612 | Ga0068862_1001706121 | 102 |
| 76 | 3300005985 | Ga0081539_10016553 | Ga0081539_100165538 | 102 |
| 77 | 3300006028 | Ga0070717_12126724 | Ga0070717_121267241 | 102 |
| 78 | 3300006237 | Ga0097621_100272895 | Ga0097621_1002728954 | 102 |
| 79 | 3300006237 | Ga0097621_100529664 | Ga0097621_1005296642 | 102 |
| 80 | 3300006844 | Ga0075428_100136599 | Ga0075428_1001365996 | 102 |
| 81 | 3300006871 | Ga0075434_101390664 | Ga0075434_1013906642 | 102 |
| 82 | 3300006881 | Ga0068865_100047049 | Ga0068865_1000470494 | 102 |
| 83 | 3300006914 | Ga0075436_100833428 | Ga0075436_1008334282 | 102 |
| 84 | 3300006931 | Ga0097620_100199432 | Ga0097620_1001994325 | 102 |
| 85 | 3300006931 | Ga0097620_100463394 | Ga0097620_1004633943 | 102 |
| 86 | 3300007076 | Ga0075435_101078312 | Ga0075435_1010783121 | 102 |
| 87 | 3300009098 | Ga0105245_10972752 | Ga0105245_109727522 | 102 |
| 88 | 3300009098 | Ga0105245_12997962 | Ga0105245_129979622 | 102 |
| 89 | 3300009148 | Ga0105243_10356474 | Ga0105243_103564743 | 102 |
| 90 | 3300009176 | Ga0105242_10278392 | Ga0105242_102783924 | 102 |
| 91 | 3300009177 | Ga0105248_10210633 | Ga0105248_102106333 | 102 |
| 92 | 3300009177 | Ga0105248_11522987 | Ga0105248_115229872 | 102 |
| 93 | 3300009177 | Ga0105248_11726003 | Ga0105248_117260031 | 102 |
| 94 | 3300009177 | Ga0105248_12194369 | Ga0105248_121943692 | 102 |
| 95 | 3300009553 | Ga0105249_10269224 | Ga0105249_102692244 | 102 |
| 96 | 3300009553 | Ga0105249_12309106 | Ga0105249_123091061 | 102 |
| 97 | 3300009553 | Ga0105249_13240438 | Ga0105249_132404382 | 102 |
| 98 | 3300012490 | Ga0157322_1029736 | Ga0157322_10297362 | 102 |
| 99 | 3300012503 | Ga0157313_1050249 | Ga0157313_10502492 | 102 |
| 100 | 3300012512 | Ga0157327_1054108 | Ga0157327_10541082 | 102 |
| 101 | 3300013297 | Ga0157378_10081895 | Ga0157378_100818956 | 102 |
| 102 | 3300013297 | Ga0157378_10498122 | Ga0157378_104981222 | 102 |
| 103 | 3300013297 | Ga0157378_12682145 | Ga0157378_126821451 | 102 |
| 104 | 3300013306 | Ga0163162_10033165 | Ga0163162_100331653 | 102 |
| 105 | 3300013306 | Ga0163162_12303188 | Ga0163162_123031881 | 102 |
| 106 | 3300013306 | Ga0163162_12475083 | Ga0163162_124750832 | 102 |
| 107 | 3300013308 | Ga0157375_10026295 | Ga0157375_1002629511 | 102 |
| 108 | 3300013308 | Ga0157375_10102304 | Ga0157375_101023045 | 102 |
| 109 | 3300013308 | Ga0157375_10246674 | Ga0157375_102466744 | 102 |
| 110 | 3300013308 | Ga0157375_11497657 | Ga0157375_114976572 | 102 |
| 111 | 3300014325 | Ga0163163_11247530 | Ga0163163_112475302 | 102 |
| 112 | 3300014325 | Ga0163163_11946481 | Ga0163163_119464812 | 102 |
| 113 | 3300014326 | Ga0157380_10138399 | Ga0157380_101383993 | 102 |
| 114 | 3300014326 | Ga0157380_11536852 | Ga0157380_115368522 | 102 |
| 115 | 3300014968 | Ga0157379_11044175 | Ga0157379_110441752 | 102 |
| 116 | 3300014969 | Ga0157376_10036746 | Ga0157376_100367463 | 102 |
| 117 | 3300014969 | Ga0157376_10054404 | Ga0157376_100544042 | 102 |
| 118 | 3300014969 | Ga0157376_10693036 | Ga0157376_106930361 | 102 |
| 119 | 3300017792 | Ga0163161_10281396 | Ga0163161_102813962 | 102 |
| 120 | 3300017792 | Ga0163161_10592496 | Ga0163161_105924962 | 102 |
| 121 | 3300021361 | Ga0213872_10442081 | Ga0213872_104420811 | 102 |
| 122 | 3300025315 | Ga0207697_10126186 | Ga0207697_101261862 | 102 |
| 123 | 3300025893 | Ga0207682_10106639 | Ga0207682_101066392 | 102 |
| 124 | 3300025899 | Ga0207642_10073501 | Ga0207642_100735013 | 102 |
| 125 | 3300025901 | Ga0207688_10037377 | Ga0207688_100373772 | 102 |
| 126 | 3300025903 | Ga0207680_11034900 | Ga0207680_110349002 | 102 |
| 127 | 3300025907 | Ga0207645_10062943 | Ga0207645_100629435 | 102 |
| 128 | 3300025907 | Ga0207645_10172318 | Ga0207645_101723182 | 102 |
| 129 | 3300025907 | Ga0207645_10270048 | Ga0207645_102700482 | 102 |
| 130 | 3300025907 | Ga0207645_10358668 | Ga0207645_103586682 | 102 |
| 131 | 3300025907 | Ga0207645_10694587 | Ga0207645_106945872 | 102 |
| 132 | 3300025908 | Ga0207643_10007783 | Ga0207643_1000778310 | 102 |
| 133 | 3300025918 | Ga0207662_10599252 | Ga0207662_105992522 | 102 |
| 134 | 3300025923 | Ga0207681_10068266 | Ga0207681_100682662 | 102 |
| 135 | 3300025923 | Ga0207681_10664201 | Ga0207681_106642012 | 102 |
| 136 | 3300025925 | Ga0207650_10009448 | Ga0207650_100094482 | 102 |
| 137 | 3300025925 | Ga0207650_10017815 | Ga0207650_100178153 | 102 |
| 138 | 3300025925 | Ga0207650_10873769 | Ga0207650_108737692 | 102 |
| 139 | 3300025926 | Ga0207659_10267157 | Ga0207659_102671574 | 102 |
| 140 | 3300025926 | Ga0207659_11176435 | Ga0207659_111764352 | 102 |
| 141 | 3300025926 | Ga0207659_11318625 | Ga0207659_113186252 | 102 |
| 142 | 3300025926 | Ga0207659_11382301 | Ga0207659_113823012 | 102 |
| 143 | 3300025931 | Ga0207644_10076281 | Ga0207644_100762816 | 102 |
| 144 | 3300025931 | Ga0207644_10119393 | Ga0207644_101193933 | 102 |
| 145 | 3300025931 | Ga0207644_10154493 | Ga0207644_101544933 | 102 |
| 146 | 3300025933 | Ga0207706_10035361 | Ga0207706_100353615 | 102 |
| 147 | 3300025933 | Ga0207706_11085226 | Ga0207706_110852262 | 102 |
| 148 | 3300025935 | Ga0207709_11183660 | Ga0207709_111836602 | 102 |
| 149 | 3300025936 | Ga0207670_10207757 | Ga0207670_102077573 | 102 |
| 150 | 3300025937 | Ga0207669_10132217 | Ga0207669_101322172 | 102 |
| 151 | 3300025937 | Ga0207669_10132341 | Ga0207669_101323412 | 102 |
| 152 | 3300025937 | Ga0207669_10235381 | Ga0207669_102353811 | 102 |
| 153 | 3300025938 | Ga0207704_10115963 | Ga0207704_101159635 | 102 |
| 154 | 3300025940 | Ga0207691_10025524 | Ga0207691_100255249 | 102 |
| 155 | 3300025940 | Ga0207691_10045309 | Ga0207691_100453096 | 102 |
| 156 | 3300025941 | Ga0207711_10604944 | Ga0207711_106049442 | 102 |
| 157 | 3300025941 | Ga0207711_11456076 | Ga0207711_114560762 | 102 |
| 158 | 3300025942 | Ga0207689_10058818 | Ga0207689_100588184 | 102 |
| 159 | 3300025942 | Ga0207689_11393974 | Ga0207689_113939742 | 102 |
| 160 | 3300025945 | Ga0207679_10399474 | Ga0207679_103994742 | 102 |
| 161 | 3300025945 | Ga0207679_10428698 | Ga0207679_104286982 | 102 |
| 162 | 3300025960 | Ga0207651_10210875 | Ga0207651_102108754 | 102 |
| 163 | 3300025960 | Ga0207651_11349383 | Ga0207651_113493832 | 102 |
| 164 | 3300025961 | Ga0207712_10204524 | Ga0207712_102045244 | 102 |
| 165 | 3300025961 | Ga0207712_10875968 | Ga0207712_108759682 | 102 |
| 166 | 3300025972 | Ga0207668_10216740 | Ga0207668_102167403 | 102 |
| 167 | 3300025972 | Ga0207668_10472094 | Ga0207668_104720942 | 102 |
| 168 | 3300025972 | Ga0207668_11324917 | Ga0207668_113249171 | 102 |
| 169 | 3300025972 | Ga0207668_11460419 | Ga0207668_114604192 | 102 |
| 170 | 3300025986 | Ga0207658_10261512 | Ga0207658_102615122 | 102 |
| 171 | 3300025986 | Ga0207658_10719520 | Ga0207658_107195202 | 102 |
| 172 | 3300025986 | Ga0207658_10738490 | Ga0207658_107384902 | 102 |
| 173 | 3300026023 | Ga0207677_11193963 | Ga0207677_111939632 | 102 |
| 174 | 3300026035 | Ga0207703_10035587 | Ga0207703_100355875 | 102 |
| 175 | 3300026075 | Ga0207708_10214751 | Ga0207708_102147514 | 102 |
| 176 | 3300026088 | Ga0207641_10007438 | Ga0207641_100074384 | 102 |
| 177 | 3300026088 | Ga0207641_10055785 | Ga0207641_100557857 | 102 |
| 178 | 3300026088 | Ga0207641_10306595 | Ga0207641_103065952 | 102 |
| 179 | 3300026088 | Ga0207641_11511704 | Ga0207641_115117042 | 102 |
| 180 | 3300026088 | Ga0207641_12116010 | Ga0207641_121160101 | 102 |
| 181 | 3300026089 | Ga0207648_10005997 | Ga0207648_1000599718 | 102 |
| 182 | 3300026089 | Ga0207648_10538541 | Ga0207648_105385411 | 102 |
| 183 | 3300026095 | Ga0207676_10005874 | Ga0207676_100058746 | 102 |
| 184 | 3300026095 | Ga0207676_10080615 | Ga0207676_100806152 | 102 |
| 185 | 3300026095 | Ga0207676_10083154 | Ga0207676_100831543 | 102 |
| 186 | 3300026095 | Ga0207676_10852583 | Ga0207676_108525832 | 102 |
| 187 | 3300026095 | Ga0207676_10855268 | Ga0207676_108552681 | 102 |
| 188 | 3300026118 | Ga0207675_100020639 | Ga0207675_1000206392 | 102 |
| 189 | 3300026118 | Ga0207675_100166548 | Ga0207675_1001665482 | 102 |
| 190 | 3300026118 | Ga0207675_100458287 | Ga0207675_1004582871 | 102 |
| 191 | 3300026118 | Ga0207675_100538668 | Ga0207675_1005386682 | 102 |
| 192 | 3300026121 | Ga0207683_10080176 | Ga0207683_100801765 | 102 |
| 193 | 3300026121 | Ga0207683_10308643 | Ga0207683_103086433 | 102 |
| 194 | 3300026121 | Ga0207683_10831464 | Ga0207683_108314642 | 102 |
| 195 | 3300028379 | Ga0268266_10334088 | Ga0268266_103340882 | 102 |
| 196 | 3300028379 | Ga0268266_11719288 | Ga0268266_117192881 | 102 |
| 197 | 3300028380 | Ga0268265_10156946 | Ga0268265_101569465 | 102 |
| 198 | 3300028381 | Ga0268264_10221924 | Ga0268264_102219243 | 102 |
| 199 | 3300028381 | Ga0268264_10981412 | Ga0268264_109814122 | 102 |
| 200 | 3300028381 | Ga0268264_11008892 | Ga0268264_110088922 | 102 |
| 201 | 3300028381 | Ga0268264_12185674 | Ga0268264_121856742 | 102 |
| 202 | 3300031235 | Ga0265330_10004608 | Ga0265330_1000460813 | 102 |
| 203 | 3300031238 | Ga0265332_10001783 | Ga0265332_1000178311 | 102 |
| 204 | 3300031250 | Ga0265331_10000635 | Ga0265331_1000063531 | 102 |
| 205 | 3300031251 | Ga0265327_10031432 | Ga0265327_100314325 | 102 |
| 206 | 3300031711 | Ga0265314_10070955 | Ga0265314_100709552 | 102 |
| 207 | 3300031712 | Ga0265342_10445975 | Ga0265342_104459751 | 102 |
| 208 | 3300032168 | Ga0316593_10005257 | Ga0316593_100052577 | 102 |
| 209 | 3300033529 | Ga0316587_1012260 | Ga0316587_10122602 | 102 |
| 210 | 3300035111 | Ga0373923_0303929 | Ga0373923_0303929_83_397 | 102 |
| 211 | 3300035114 | Ga0373939_0062064 | Ga0373939_0062064_227_541 | 102 |
| 212 | 3300035410 | Ga0373924_0465545 | Ga0373924_0465545_96_410 | 102 |
| 213 | 3300035692 | Ga0373935_0131323 | Ga0373935_0131323_1202_1516 | 102 |
| 214 | 3300035692 | Ga0373935_0313334 | Ga0373935_0313334_399_713 | 102 |
| 215 | 3300035724 | Ga0373933_0068883 | Ga0373933_0068883_186_500 | 102 |
| 216 | 3300035724 | Ga0373933_0360221 | Ga0373933_0360221_95_409 | 102 |
| 217 | 3300036401 | Ga0373937_0054320 | Ga0373937_0054320_2684_2998 | 102 |
| 218 | 3300037068 | Ga0373925_0031180 | Ga0373925_0031180_2865_3179 | 102 |
| 219 | 3300039447 | Ga0436361_0020791 | Ga0436361_0020791_163_477 | 102 |
| 220 | 3300041486 | Ga0451807_2644321 | Ga0451807_2644321_417_731 | 102 |
| 221 | 3300041501 | Ga0451845_0449866 | Ga0451845_0449866_108_422 | 102 |
| 222 | 3300041507 | Ga0451851_1147119 | Ga0451851_1147119_84_398 | 102 |
| 223 | 3300041512 | Ga0451853_2627193 | Ga0451853_2627193_184_498 | 102 |
| 224 | 3300046473 | Ga0495582_0685849 | Ga0495582_0685849_81_395 | 102 |
| 225 | 3300046511 | Ga0495608_0894358 | Ga0495608_0894358_23_337 | 102 |
| 226 | 3300046533 | Ga0495640_0510207 | Ga0495640_0510207_377_691 | 102 |
| 227 | 3300046684 | Ga0495669_0182168 | Ga0495669_0182168_211_525 | 102 |
| 228 | 3300046689 | Ga0495613_0095378 | Ga0495613_0095378_1592_1906 | 102 |
| 229 | 3300047315 | Ga0495581_0237132 | Ga0495581_0237132_671_985 | 102 |
| 230 | 3300047444 | Ga0495675_0358107 | Ga0495675_0358107_104_418 | 102 |
| 231 | 3300048904 | Ga0496101_1554436 | Ga0496101_1554436_73_387 | 102 |
| 232 | 3300048915 | Ga0496112_0188174 | Ga0496112_0188174_781_1095 | 102 |
| 233 | 3300050512 | nmdc:mga0n895_853969_c1 | nmdc:mga0n895_853969_c1_454_768 | 102 |
| 234 | 3300050513 | nmdc:mga0rr50_1768315_c1 | nmdc:mga0rr50_1768315_c1_100_414 | 102 |
| 235 | 3300050514 | nmdc:mga08x19_665196_c1 | nmdc:mga08x19_665196_c1_92_406 | 102 |
| 236 | 3300053084 | Ga0495595_0208123 | Ga0495595_0208123_316_630 | 102 |
| 237 | 3300053085 | Ga0495619_0434586 | Ga0495619_0434586_257_571 | 102 |
| 238 | 3300001976 | JGI24752J21851_1005316 | JGI24752J21851_10053162 | 103 |
| 239 | 3300002244 | JGI24742J22300_10050452 | JGI24742J22300_100504521 | 103 |
| 240 | 3300005327 | Ga0070658_10770947 | Ga0070658_107709472 | 103 |
| 241 | 3300005327 | Ga0070658_10893930 | Ga0070658_108939301 | 103 |
| 242 | 3300005327 | Ga0070658_11239224 | Ga0070658_112392242 | 103 |
| 243 | 3300005327 | Ga0070658_12001909 | Ga0070658_120019091 | 103 |
| 244 | 3300005328 | Ga0070676_10084706 | Ga0070676_100847064 | 103 |
| 245 | 3300005329 | Ga0070683_100036912 | Ga0070683_10003691210 | 103 |
| 246 | 3300005331 | Ga0070670_100049275 | Ga0070670_1000492754 | 103 |
| 247 | 3300005333 | Ga0070677_10021939 | Ga0070677_100219396 | 103 |
| 248 | 3300005334 | Ga0068869_100683424 | Ga0068869_1006834242 | 103 |
| 249 | 3300005335 | Ga0070666_10183555 | Ga0070666_101835551 | 103 |
| 250 | 3300005337 | Ga0070682_100121457 | Ga0070682_1001214572 | 103 |
| 251 | 3300005337 | Ga0070682_100347010 | Ga0070682_1003470101 | 103 |
| 252 | 3300005338 | Ga0068868_100011188 | Ga0068868_1000111882 | 103 |
| 253 | 3300005338 | Ga0068868_100251645 | Ga0068868_1002516453 | 103 |
| 254 | 3300005338 | Ga0068868_100853365 | Ga0068868_1008533651 | 103 |
| 255 | 3300005339 | Ga0070660_101185422 | Ga0070660_1011854222 | 103 |
| 256 | 3300005343 | Ga0070687_101070546 | Ga0070687_1010705462 | 103 |
| 257 | 3300005353 | Ga0070669_100328397 | Ga0070669_1003283972 | 103 |
| 258 | 3300005353 | Ga0070669_100779756 | Ga0070669_1007797562 | 103 |
| 259 | 3300005353 | Ga0070669_101870626 | Ga0070669_1018706261 | 103 |
| 260 | 3300005354 | Ga0070675_100008825 | Ga0070675_1000088255 | 103 |
| 261 | 3300005355 | Ga0070671_100001413 | Ga0070671_10000141318 | 103 |
| 262 | 3300005355 | Ga0070671_100805762 | Ga0070671_1008057622 | 103 |
| 263 | 3300005356 | Ga0070674_100004652 | Ga0070674_1000046522 | 103 |
| 264 | 3300005356 | Ga0070674_100464815 | Ga0070674_1004648152 | 103 |
| 265 | 3300005356 | Ga0070674_100810729 | Ga0070674_1008107292 | 103 |
| 266 | 3300005364 | Ga0070673_100002406 | Ga0070673_1000024064 | 103 |
| 267 | 3300005364 | Ga0070673_100180192 | Ga0070673_1001801922 | 103 |
| 268 | 3300005366 | Ga0070659_100039243 | Ga0070659_1000392437 | 103 |
| 269 | 3300005366 | Ga0070659_100300462 | Ga0070659_1003004622 | 103 |
| 270 | 3300005366 | Ga0070659_100494235 | Ga0070659_1004942352 | 103 |
| 271 | 3300005366 | Ga0070659_100959345 | Ga0070659_1009593451 | 103 |
| 272 | 3300005367 | Ga0070667_100467584 | Ga0070667_1004675842 | 103 |
| 273 | 3300005367 | Ga0070667_101637638 | Ga0070667_1016376381 | 103 |
| 274 | 3300005436 | Ga0070713_100000028 | Ga0070713_10000002824 | 103 |
| 275 | 3300005438 | Ga0070701_10201334 | Ga0070701_102013341 | 103 |
| 276 | 3300005439 | Ga0070711_100200043 | Ga0070711_1002000433 | 103 |
| 277 | 3300005441 | Ga0070700_100204485 | Ga0070700_1002044852 | 103 |
| 278 | 3300005455 | Ga0070663_100066821 | Ga0070663_1000668215 | 103 |
| 279 | 3300005456 | Ga0070678_100000327 | Ga0070678_10000032717 | 103 |
| 280 | 3300005456 | Ga0070678_100087735 | Ga0070678_1000877353 | 103 |
| 281 | 3300005457 | Ga0070662_100174375 | Ga0070662_1001743752 | 103 |
| 282 | 3300005457 | Ga0070662_100763180 | Ga0070662_1007631801 | 103 |
| 283 | 3300005457 | Ga0070662_101790447 | Ga0070662_1017904471 | 103 |
| 284 | 3300005459 | Ga0068867_100091112 | Ga0068867_1000911125 | 103 |
| 285 | 3300005467 | Ga0070706_101248200 | Ga0070706_1012482002 | 103 |
| 286 | 3300005535 | Ga0070684_100311540 | Ga0070684_1003115403 | 103 |
| 287 | 3300005536 | Ga0070697_101101688 | Ga0070697_1011016882 | 103 |
| 288 | 3300005539 | Ga0068853_100185586 | Ga0068853_1001855865 | 103 |
| 289 | 3300005543 | Ga0070672_100003635 | Ga0070672_1000036359 | 103 |
| 290 | 3300005548 | Ga0070665_100128413 | Ga0070665_1001284137 | 103 |
| 291 | 3300005548 | Ga0070665_101540743 | Ga0070665_1015407431 | 103 |
| 292 | 3300005549 | Ga0070704_101561729 | Ga0070704_1015617291 | 103 |
| 293 | 3300005564 | Ga0070664_100879929 | Ga0070664_1008799292 | 103 |
| 294 | 3300005578 | Ga0068854_100083412 | Ga0068854_1000834126 | 103 |
| 295 | 3300005614 | Ga0068856_100044462 | Ga0068856_1000444629 | 103 |
| 296 | 3300005615 | Ga0070702_100564960 | Ga0070702_1005649601 | 103 |
| 297 | 3300005616 | Ga0068852_100023109 | Ga0068852_1000231099 | 103 |
| 298 | 3300005618 | Ga0068864_100052938 | Ga0068864_1000529386 | 103 |
| 299 | 3300005718 | Ga0068866_10051071 | Ga0068866_100510712 | 103 |
| 300 | 3300005718 | Ga0068866_10738790 | Ga0068866_107387902 | 103 |
| 301 | 3300005719 | Ga0068861_101822766 | Ga0068861_1018227662 | 103 |
| 302 | 3300005834 | Ga0068851_10024902 | Ga0068851_100249024 | 103 |
| 303 | 3300005840 | Ga0068870_10699873 | Ga0068870_106998732 | 103 |
| 304 | 3300005842 | Ga0068858_101795771 | Ga0068858_1017957712 | 103 |
| 305 | 3300005844 | Ga0068862_101241347 | Ga0068862_1012413471 | 103 |
| 306 | 3300006028 | Ga0070717_10728593 | Ga0070717_107285932 | 103 |
| 307 | 3300006175 | Ga0070712_100681582 | Ga0070712_1006815822 | 103 |
| 308 | 3300006237 | Ga0097621_100043697 | Ga0097621_1000436975 | 103 |
| 309 | 3300006358 | Ga0068871_100013379 | Ga0068871_1000133792 | 103 |
| 310 | 3300006358 | Ga0068871_101440804 | Ga0068871_1014408041 | 103 |
| 311 | 3300006844 | Ga0075428_100005627 | Ga0075428_10000562716 | 103 |
| 312 | 3300006844 | Ga0075428_101080657 | Ga0075428_1010806572 | 103 |
| 313 | 3300006871 | Ga0075434_100745595 | Ga0075434_1007455952 | 103 |
| 314 | 3300006880 | Ga0075429_100176353 | Ga0075429_1001763534 | 103 |
| 315 | 3300006881 | Ga0068865_100027334 | Ga0068865_1000273347 | 103 |
| 316 | 3300006881 | Ga0068865_100121180 | Ga0068865_1001211805 | 103 |
| 317 | 3300006881 | Ga0068865_100406520 | Ga0068865_1004065202 | 103 |
| 318 | 3300006914 | Ga0075436_100297688 | Ga0075436_1002976882 | 103 |
| 319 | 3300007076 | Ga0075435_101315975 | Ga0075435_1013159752 | 103 |
| 320 | 3300009093 | Ga0105240_10290716 | Ga0105240_102907165 | 103 |
| 321 | 3300009094 | Ga0111539_10029410 | Ga0111539_100294107 | 103 |
| 322 | 3300009094 | Ga0111539_10100124 | Ga0111539_101001247 | 103 |
| 323 | 3300009094 | Ga0111539_10104296 | Ga0111539_101042967 | 103 |
| 324 | 3300009094 | Ga0111539_11069052 | Ga0111539_110690522 | 103 |
| 325 | 3300009098 | Ga0105245_11817138 | Ga0105245_118171381 | 103 |
| 326 | 3300009101 | Ga0105247_10424377 | Ga0105247_104243772 | 103 |
| 327 | 3300009147 | Ga0114129_10149274 | Ga0114129_101492743 | 103 |
| 328 | 3300009174 | Ga0105241_10900004 | Ga0105241_109000042 | 103 |
| 329 | 3300009177 | Ga0105248_11942552 | Ga0105248_119425522 | 103 |
| 330 | 3300010375 | Ga0105239_11152857 | Ga0105239_111528572 | 103 |
| 331 | 3300010375 | Ga0105239_12159720 | Ga0105239_121597202 | 103 |
| 332 | 3300011119 | Ga0105246_10225680 | Ga0105246_102256802 | 103 |
| 333 | 3300011119 | Ga0105246_11055879 | Ga0105246_110558792 | 103 |
| 334 | 3300013100 | Ga0157373_10063367 | Ga0157373_100633675 | 103 |
| 335 | 3300013102 | Ga0157371_10665099 | Ga0157371_106650992 | 103 |
| 336 | 3300013104 | Ga0157370_10003375 | Ga0157370_1000337514 | 103 |
| 337 | 3300013296 | Ga0157374_10063292 | Ga0157374_100632925 | 103 |
| 338 | 3300013296 | Ga0157374_10107792 | Ga0157374_101077922 | 103 |
| 339 | 3300013297 | Ga0157378_10007984 | Ga0157378_1000798414 | 103 |
| 340 | 3300013297 | Ga0157378_10290591 | Ga0157378_102905912 | 103 |
| 341 | 3300013306 | Ga0163162_10138948 | Ga0163162_101389484 | 103 |
| 342 | 3300013306 | Ga0163162_10590148 | Ga0163162_105901482 | 103 |
| 343 | 3300013306 | Ga0163162_11067585 | Ga0163162_110675851 | 103 |
| 344 | 3300013307 | Ga0157372_11017425 | Ga0157372_110174252 | 103 |
| 345 | 3300013308 | Ga0157375_10047239 | Ga0157375_100472396 | 103 |
| 346 | 3300013308 | Ga0157375_10325009 | Ga0157375_103250093 | 103 |
| 347 | 3300013308 | Ga0157375_10544768 | Ga0157375_105447681 | 103 |
| 348 | 3300013308 | Ga0157375_10815642 | Ga0157375_108156423 | 103 |
| 349 | 3300014325 | Ga0163163_10151059 | Ga0163163_101510596 | 103 |
| 350 | 3300014325 | Ga0163163_10982743 | Ga0163163_109827432 | 103 |
| 351 | 3300014497 | Ga0182008_10130948 | Ga0182008_101309481 | 103 |
| 352 | 3300014497 | Ga0182008_10170693 | Ga0182008_101706932 | 103 |
| 353 | 3300014745 | Ga0157377_10450121 | Ga0157377_104501212 | 103 |
| 354 | 3300014969 | Ga0157376_10068236 | Ga0157376_100682363 | 103 |
| 355 | 3300014969 | Ga0157376_10751400 | Ga0157376_107514002 | 103 |
| 356 | 3300017792 | Ga0163161_10223293 | Ga0163161_102232933 | 103 |
| 357 | 3300021361 | Ga0213872_10101361 | Ga0213872_101013612 | 103 |
| 358 | 3300021377 | Ga0213874_10144534 | Ga0213874_101445342 | 103 |
| 359 | 3300025899 | Ga0207642_10081084 | Ga0207642_100810842 | 103 |
| 360 | 3300025899 | Ga0207642_10487852 | Ga0207642_104878522 | 103 |
| 361 | 3300025903 | Ga0207680_10642314 | Ga0207680_106423142 | 103 |
| 362 | 3300025907 | Ga0207645_10202414 | Ga0207645_102024142 | 103 |
| 363 | 3300025909 | Ga0207705_10962720 | Ga0207705_109627202 | 103 |
| 364 | 3300025915 | Ga0207693_10616275 | Ga0207693_106162752 | 103 |
| 365 | 3300025916 | Ga0207663_10251465 | Ga0207663_102514652 | 103 |
| 366 | 3300025918 | Ga0207662_10493800 | Ga0207662_104938002 | 103 |
| 367 | 3300025923 | Ga0207681_10637239 | Ga0207681_106372392 | 103 |
| 368 | 3300025925 | Ga0207650_10004274 | Ga0207650_1000427410 | 103 |
| 369 | 3300025926 | Ga0207659_10327483 | Ga0207659_103274832 | 103 |
| 370 | 3300025929 | Ga0207664_10736803 | Ga0207664_107368031 | 103 |
| 371 | 3300025931 | Ga0207644_10000883 | Ga0207644_1000088327 | 103 |
| 372 | 3300025932 | Ga0207690_10047030 | Ga0207690_100470303 | 103 |
| 373 | 3300025932 | Ga0207690_10265741 | Ga0207690_102657412 | 103 |
| 374 | 3300025932 | Ga0207690_10513488 | Ga0207690_105134882 | 103 |
| 375 | 3300025932 | Ga0207690_10840035 | Ga0207690_108400352 | 103 |
| 376 | 3300025933 | Ga0207706_10089111 | Ga0207706_100891113 | 103 |
| 377 | 3300025933 | Ga0207706_10271395 | Ga0207706_102713952 | 103 |
| 378 | 3300025933 | Ga0207706_10503242 | Ga0207706_105032422 | 103 |
| 379 | 3300025933 | Ga0207706_10530772 | Ga0207706_105307722 | 103 |
| 380 | 3300025933 | Ga0207706_10743033 | Ga0207706_107430332 | 103 |
| 381 | 3300025934 | Ga0207686_11266190 | Ga0207686_112661902 | 103 |
| 382 | 3300025937 | Ga0207669_11239385 | Ga0207669_112393851 | 103 |
| 383 | 3300025938 | Ga0207704_10282747 | Ga0207704_102827473 | 103 |
| 384 | 3300025938 | Ga0207704_10708738 | Ga0207704_107087382 | 103 |
| 385 | 3300025940 | Ga0207691_10006216 | Ga0207691_1000621614 | 103 |
| 386 | 3300025942 | Ga0207689_10237998 | Ga0207689_102379982 | 103 |
| 387 | 3300025942 | Ga0207689_10559590 | Ga0207689_105595902 | 103 |
| 388 | 3300025944 | Ga0207661_10609477 | Ga0207661_106094772 | 103 |
| 389 | 3300025945 | Ga0207679_10110578 | Ga0207679_101105785 | 103 |
| 390 | 3300025960 | Ga0207651_11424838 | Ga0207651_114248382 | 103 |
| 391 | 3300025981 | Ga0207640_10004152 | Ga0207640_100041526 | 103 |
| 392 | 3300025986 | Ga0207658_10447524 | Ga0207658_104475243 | 103 |
| 393 | 3300026023 | Ga0207677_10003662 | Ga0207677_100036626 | 103 |
| 394 | 3300026023 | Ga0207677_10270077 | Ga0207677_102700772 | 103 |
| 395 | 3300026035 | Ga0207703_10647877 | Ga0207703_106478771 | 103 |
| 396 | 3300026035 | Ga0207703_11225635 | Ga0207703_112256352 | 103 |
| 397 | 3300026041 | Ga0207639_10397612 | Ga0207639_103976122 | 103 |
| 398 | 3300026067 | Ga0207678_10356050 | Ga0207678_103560502 | 103 |
| 399 | 3300026075 | Ga0207708_10174199 | Ga0207708_101741992 | 103 |
| 400 | 3300026078 | Ga0207702_10074732 | Ga0207702_100747322 | 103 |
| 401 | 3300026089 | Ga0207648_10154153 | Ga0207648_101541531 | 103 |
| 402 | 3300026095 | Ga0207676_10210305 | Ga0207676_102103054 | 103 |
| 403 | 3300026118 | Ga0207675_101898458 | Ga0207675_1018984582 | 103 |
| 404 | 3300026121 | Ga0207683_10001392 | Ga0207683_1000139224 | 103 |
| 405 | 3300026121 | Ga0207683_10025934 | Ga0207683_100259349 | 103 |
| 406 | 3300026142 | Ga0207698_10035123 | Ga0207698_100351232 | 103 |
| 407 | 3300027876 | Ga0209974_10010320 | Ga0209974_100103205 | 103 |
| 408 | 3300027876 | Ga0209974_10113611 | Ga0209974_101136112 | 103 |
| 409 | 3300027907 | Ga0207428_10008889 | Ga0207428_1000888910 | 103 |
| 410 | 3300027907 | Ga0207428_10177011 | Ga0207428_101770112 | 103 |
| 411 | 3300028379 | Ga0268266_10853193 | Ga0268266_108531932 | 103 |
| 412 | 3300031238 | Ga0265332_10193672 | Ga0265332_101936722 | 103 |
| 413 | 3300031247 | Ga0265340_10020617 | Ga0265340_100206176 | 103 |
| 414 | 3300031548 | Ga0307408_100525650 | Ga0307408_1005256501 | 103 |
| 415 | 3300031665 | Ga0316575_10001575 | Ga0316575_100015752 | 103 |
| 416 | 3300031911 | Ga0307412_10348371 | Ga0307412_103483713 | 103 |
| 417 | 3300032002 | Ga0307416_100230420 | Ga0307416_1002304206 | 103 |
| 418 | 3300032005 | Ga0307411_11042489 | Ga0307411_110424892 | 103 |
| 419 | 3300032168 | Ga0316593_10000049 | Ga0316593_1000004915 | 103 |
| 420 | 3300032168 | Ga0316593_10000058 | Ga0316593_1000005815 | 103 |
| 421 | 3300032168 | Ga0316593_10005293 | Ga0316593_100052939 | 103 |
| 422 | 3300032168 | Ga0316593_10010662 | Ga0316593_100106622 | 103 |
| 423 | 3300032168 | Ga0316593_10020416 | Ga0316593_100204163 | 103 |
| 424 | 3300032168 | Ga0316593_10100138 | Ga0316593_101001382 | 103 |
| 425 | 3300032168 | Ga0316593_10111466 | Ga0316593_101114662 | 103 |
| 426 | 3300033524 | Ga0316592_1051470 | Ga0316592_10514702 | 103 |
| 427 | 3300033528 | Ga0316588_1018137 | Ga0316588_10181372 | 103 |
| 428 | 3300033528 | Ga0316588_1131490 | Ga0316588_11314901 | 103 |
| 429 | 3300033529 | Ga0316587_1000182 | Ga0316587_10001822 | 103 |
| 430 | 3300033529 | Ga0316587_1015548 | Ga0316587_10155482 | 103 |
| 431 | 3300033529 | Ga0316587_1108024 | Ga0316587_11080241 | 103 |
| 432 | 3300033541 | Ga0316596_1000880 | Ga0316596_10008805 | 103 |
| 433 | 3300033541 | Ga0316596_1026187 | Ga0316596_10261873 | 103 |
| 434 | 3300035114 | Ga0373939_0403737 | Ga0373939_0403737_42_359 | 103 |
| 435 | 3300035691 | Ga0373931_0552599 | Ga0373931_0552599_16_333 | 103 |
| 436 | 3300037418 | Ga0395900_0046031 | Ga0395900_0046031_538_855 | 103 |
| 437 | 3300038443 | Ga0395901_0220488 | Ga0395901_0220488_390_707 | 103 |
| 438 | 3300038443 | Ga0395901_0364811 | Ga0395901_0364811_951_1268 | 103 |
| 439 | 3300039447 | Ga0436361_0015574 | Ga0436361_0015574_430_747 | 103 |
| 440 | 3300039450 | Ga0436363_0712517 | Ga0436363_0712517_379_696 | 103 |
| 441 | 3300041407 | Ga0439447_168955 | Ga0439447_168955_66_383 | 103 |
| 442 | 3300041507 | Ga0451851_0752822 | Ga0451851_0752822_198_515 | 103 |
| 443 | 3300041512 | Ga0451853_3854955 | Ga0451853_3854955_126_443 | 103 |
| 444 | 3300042436 | Ga0439435_0010142 | Ga0439435_0010142_1714_2031 | 103 |
| 445 | 3300042461 | Ga0439460_0125495 | Ga0439460_0125495_397_714 | 103 |
| 446 | 3300042530 | Ga0450916_039082 | Ga0450916_039082_178_495 | 103 |
| 447 | 3300045051 | Ga0451576_0077585 | Ga0451576_0077585_1461_1778 | 103 |
| 448 | 3300047318 | Ga0495636_0371815 | Ga0495636_0371815_244_561 | 103 |
| 449 | 3300048903 | Ga0496100_0064332 | Ga0496100_0064332_1687_2004 | 103 |
| 450 | 3300048904 | Ga0496101_0749609 | Ga0496101_0749609_202_519 | 103 |
| 451 | 3300048904 | Ga0496101_1359051 | Ga0496101_1359051_136_453 | 103 |
| 452 | 3300048905 | Ga0496102_0218206 | Ga0496102_0218206_1428_1745 | 103 |
| 453 | 3300048907 | Ga0496104_0290043 | Ga0496104_0290043_852_1169 | 103 |
| 454 | 3300048909 | Ga0496106_0530886 | Ga0496106_0530886_91_408 | 103 |
| 455 | 3300048910 | Ga0496107_0444656 | Ga0496107_0444656_476_793 | 103 |
| 456 | 3300048910 | Ga0496107_0663132 | Ga0496107_0663132_96_413 | 103 |
| 457 | 3300048911 | Ga0496108_0051456 | Ga0496108_0051456_715_1032 | 103 |
| 458 | 3300048911 | Ga0496108_0409111 | Ga0496108_0409111_205_522 | 103 |
| 459 | 3300048911 | Ga0496108_0812471 | Ga0496108_0812471_217_534 | 103 |
| 460 | 3300048911 | Ga0496108_1233528 | Ga0496108_1233528_35_352 | 103 |
| 461 | 3300048912 | Ga0496109_0001894 | Ga0496109_0001894_16490_16807 | 103 |
| 462 | 3300048912 | Ga0496109_0128868 | Ga0496109_0128868_1071_1388 | 103 |
| 463 | 3300048912 | Ga0496109_1784286 | Ga0496109_1784286_211_528 | 103 |
| 464 | 3300048913 | Ga0496110_0012098 | Ga0496110_0012098_3500_3817 | 103 |
| 465 | 3300048915 | Ga0496112_1043092 | Ga0496112_1043092_177_494 | 103 |
| 466 | 3300048916 | Ga0496113_0227897 | Ga0496113_0227897_861_1178 | 103 |
| 467 | 3300048917 | Ga0496114_0005126 | Ga0496114_0005126_1429_1746 | 103 |
| 468 | 3300048918 | Ga0496115_0761495 | Ga0496115_0761495_166_483 | 103 |
| 469 | 3300048918 | Ga0496115_0798008 | Ga0496115_0798008_244_561 | 103 |
| 470 | 3300049568 | Ga0501031_0003260 | Ga0501031_0003260_3933_4250 | 103 |
| 471 | 3300049568 | Ga0501031_0009677 | Ga0501031_0009677_4745_5062 | 103 |
| 472 | 3300049569 | Ga0501032_0000036 | Ga0501032_0000036_104587_104904 | 103 |
| 473 | 3300049569 | Ga0501032_0023103 | Ga0501032_0023103_183_500 | 103 |
| 474 | 3300049569 | Ga0501032_0028750 | Ga0501032_0028750_3107_3424 | 103 |
| 475 | 3300049569 | Ga0501032_1036574 | Ga0501032_1036574_58_375 | 103 |
| 476 | 3300049570 | Ga0501033_0001817 | Ga0501033_0001817_6182_6499 | 103 |
| 477 | 3300049570 | Ga0501033_0003966 | Ga0501033_0003966_4686_5003 | 103 |
| 478 | 3300049571 | Ga0501034_0003361 | Ga0501034_0003361_6182_6499 | 103 |
| 479 | 3300049571 | Ga0501034_0017280 | Ga0501034_0017280_2697_3014 | 103 |
| 480 | 3300049571 | Ga0501034_0417785 | Ga0501034_0417785_369_686 | 103 |
| 481 | 3300049572 | Ga0501036_0000512 | Ga0501036_0000512_26397_26714 | 103 |
| 482 | 3300049572 | Ga0501036_0001490 | Ga0501036_0001490_8692_9009 | 103 |
| 483 | 3300049572 | Ga0501036_0002120 | Ga0501036_0002120_6179_6496 | 103 |
| 484 | 3300049573 | Ga0501037_0001263 | Ga0501037_0001263_12141_12458 | 103 |
| 485 | 3300049573 | Ga0501037_0379343 | Ga0501037_0379343_52_369 | 103 |
| 486 | 3300049573 | Ga0501037_0701742 | Ga0501037_0701742_219_536 | 103 |
| 487 | 3300049574 | Ga0501038_0003243 | Ga0501038_0003243_12141_12458 | 103 |
| 488 | 3300049574 | Ga0501038_0004836 | Ga0501038_0004836_11874_12191 | 103 |
| 489 | 3300049574 | Ga0501038_0055092 | Ga0501038_0055092_30_347 | 103 |
| 490 | 3300049574 | Ga0501038_0413062 | Ga0501038_0413062_219_533 | 103 |
| 491 | 3300049575 | Ga0501039_0011968 | Ga0501039_0011968_2477_2794 | 103 |
| 492 | 3300049576 | Ga0501040_0000218 | Ga0501040_0000218_24993_25310 | 103 |
| 493 | 3300049578 | Ga0501042_0000031 | Ga0501042_0000031_12429_12746 | 103 |
| 494 | 3300049579 | Ga0501043_0000157 | Ga0501043_0000157_49733_50050 | 103 |
| 495 | 3300049579 | Ga0501043_0006833 | Ga0501043_0006833_6184_6501 | 103 |
| 496 | 3300049579 | Ga0501043_0016645 | Ga0501043_0016645_1125_1442 | 103 |
| 497 | 3300049579 | Ga0501043_0373052 | Ga0501043_0373052_290_607 | 103 |
| 498 | 3300049580 | Ga0501046_0002577 | Ga0501046_0002577_6161_6478 | 103 |
| 499 | 3300049580 | Ga0501046_0004484 | Ga0501046_0004484_6297_6614 | 103 |
| 500 | 3300049580 | Ga0501046_0309239 | Ga0501046_0309239_37_354 | 103 |
| 501 | 3300049581 | Ga0501047_0002207 | Ga0501047_0002207_12141_12458 | 103 |
| 502 | 3300049582 | Ga0501048_0002716 | Ga0501048_0002716_12112_12429 | 103 |
| 503 | 3300049584 | Ga0501068_0001608 | Ga0501068_0001608_7487_7804 | 103 |
| 504 | 3300049584 | Ga0501068_0004846 | Ga0501068_0004846_5757_6074 | 103 |
| 505 | 3300049585 | Ga0501069_0258868 | Ga0501069_0258868_118_435 | 103 |
| 506 | 3300049586 | Ga0501070_0090993 | Ga0501070_0090993_400_717 | 103 |
| 507 | 3300049589 | Ga0501073_0048394 | Ga0501073_0048394_930_1247 | 103 |
| 508 | 3300049590 | Ga0501074_0060457 | Ga0501074_0060457_2200_2517 | 103 |
| 509 | 3300049593 | Ga0501077_0131618 | Ga0501077_0131618_1094_1411 | 103 |
| 510 | 3300049655 | Ga0501208_070567 | Ga0501208_070567_137_454 | 103 |
| 511 | 3300049677 | Ga0501247_032709 | Ga0501247_032709_167_484 | 103 |
| 512 | 3300049677 | Ga0501247_037686 | Ga0501247_037686_320_637 | 103 |
| 513 | 3300049742 | Ga0501080_0206492 | Ga0501080_0206492_232_549 | 103 |
| 514 | 3300049744 | Ga0501083_0031483 | Ga0501083_0031483_121_438 | 103 |
| 515 | 3300049769 | Ga0501272_065513 | Ga0501272_065513_158_475 | 103 |
| 516 | 3300049822 | Ga0501035_0000671 | Ga0501035_0000671_12225_12542 | 103 |
| 517 | 3300049822 | Ga0501035_0008893 | Ga0501035_0008893_6182_6499 | 103 |
| 518 | 3300049822 | Ga0501035_0015787 | Ga0501035_0015787_6210_6527 | 103 |
| 519 | 3300049822 | Ga0501035_0234791 | Ga0501035_0234791_1107_1424 | 103 |
| 520 | 3300049823 | Ga0501044_0000389 | Ga0501044_0000389_6143_6460 | 103 |
| 521 | 3300049823 | Ga0501044_0000747 | Ga0501044_0000747_28365_28682 | 103 |
| 522 | 3300049823 | Ga0501044_0220241 | Ga0501044_0220241_1253_1570 | 103 |
| 523 | 3300049824 | Ga0501045_0006501 | Ga0501045_0006501_6182_6499 | 103 |
| 524 | 3300050507 | nmdc:mga05p37_366836_c1 | nmdc:mga05p37_366836_c1_638_955 | 103 |
| 525 | 3300050508 | nmdc:mga09592_121026_c1 | nmdc:mga09592_121026_c1_1436_1753 | 103 |
| 526 | 3300050508 | nmdc:mga09592_507837_c1 | nmdc:mga09592_507837_c1_466_783 | 103 |
| 527 | 3300050511 | nmdc:mga08y16_199488_c1 | nmdc:mga08y16_199488_c1_1616_1933 | 103 |
| 528 | 3300050511 | nmdc:mga08y16_20173_c1 | nmdc:mga08y16_20173_c1_780_1097 | 103 |
| 529 | 3300050511 | nmdc:mga08y16_589314_c1 | nmdc:mga08y16_589314_c1_225_542 | 103 |
| 530 | 3300050511 | nmdc:mga08y16_760951_c1 | nmdc:mga08y16_760951_c1_608_925 | 103 |
| 531 | 3300050512 | nmdc:mga0n895_1357379_c1 | nmdc:mga0n895_1357379_c1_211_528 | 103 |
| 532 | 3300050514 | nmdc:mga08x19_277008_c1 | nmdc:mga08x19_277008_c1_61_378 | 103 |
| 533 | 3300053104 | Ga0500556_0000690 | Ga0500556_0000690_17372_17689 | 103 |
| 534 | 3300060353 | Ga0501082_0750018 | Ga0501082_0750018_292_609 | 103 |
| 535 | 3300003316 | rootH1_10004661 | rootH1_100046611 | 104 |
| 536 | 3300003322 | rootL2_10064042 | rootL2_100640423 | 104 |
| 537 | 3300003323 | rootH1_10087917 | rootH1_100879174 | 104 |
| 538 | 3300005330 | Ga0070690_100573051 | Ga0070690_1005730512 | 104 |
| 539 | 3300005331 | Ga0070670_100693150 | Ga0070670_1006931502 | 104 |
| 540 | 3300005337 | Ga0070682_100782150 | Ga0070682_1007821501 | 104 |
| 541 | 3300005338 | Ga0068868_100755715 | Ga0068868_1007557152 | 104 |
| 542 | 3300005339 | Ga0070660_100650359 | Ga0070660_1006503591 | 104 |
| 543 | 3300005344 | Ga0070661_100290407 | Ga0070661_1002904072 | 104 |
| 544 | 3300005355 | Ga0070671_100043910 | Ga0070671_1000439106 | 104 |
| 545 | 3300005364 | Ga0070673_101526794 | Ga0070673_1015267942 | 104 |
| 546 | 3300005365 | Ga0070688_100776035 | Ga0070688_1007760351 | 104 |
| 547 | 3300005367 | Ga0070667_100086170 | Ga0070667_1000861706 | 104 |
| 548 | 3300005455 | Ga0070663_100098843 | Ga0070663_1000988435 | 104 |
| 549 | 3300005458 | Ga0070681_10375418 | Ga0070681_103754181 | 104 |
| 550 | 3300005535 | Ga0070684_100128821 | Ga0070684_1001288212 | 104 |
| 551 | 3300005539 | Ga0068853_100379103 | Ga0068853_1003791031 | 104 |
| 552 | 3300005547 | Ga0070693_100221817 | Ga0070693_1002218172 | 104 |
| 553 | 3300005548 | Ga0070665_100096850 | Ga0070665_1000968506 | 104 |
| 554 | 3300005563 | Ga0068855_100114994 | Ga0068855_1001149943 | 104 |
| 555 | 3300005564 | Ga0070664_101158090 | Ga0070664_1011580902 | 104 |
| 556 | 3300005577 | Ga0068857_100323763 | Ga0068857_1003237632 | 104 |
| 557 | 3300005578 | Ga0068854_100243308 | Ga0068854_1002433082 | 104 |
| 558 | 3300005614 | Ga0068856_100042931 | Ga0068856_1000429312 | 104 |
| 559 | 3300005616 | Ga0068852_100172880 | Ga0068852_1001728803 | 104 |
| 560 | 3300005617 | Ga0068859_100092729 | Ga0068859_1000927293 | 104 |
| 561 | 3300005618 | Ga0068864_100090413 | Ga0068864_1000904133 | 104 |
| 562 | 3300005834 | Ga0068851_10038354 | Ga0068851_100383542 | 104 |
| 563 | 3300005841 | Ga0068863_100154561 | Ga0068863_1001545612 | 104 |
| 564 | 3300005842 | Ga0068858_100004270 | Ga0068858_10000427012 | 104 |
| 565 | 3300005843 | Ga0068860_100006244 | Ga0068860_1000062446 | 104 |
| 566 | 3300005844 | Ga0068862_100065242 | Ga0068862_1000652424 | 104 |
| 567 | 3300005937 | Ga0081455_10210306 | Ga0081455_102103064 | 104 |
| 568 | 3300006237 | Ga0097621_100122525 | Ga0097621_1001225255 | 104 |
| 569 | 3300006931 | Ga0097620_100092731 | Ga0097620_1000927313 | 104 |
| 570 | 3300009093 | Ga0105240_10075753 | Ga0105240_100757534 | 104 |
| 571 | 3300009093 | Ga0105240_12390537 | Ga0105240_123905371 | 104 |
| 572 | 3300009101 | Ga0105247_10025648 | Ga0105247_100256485 | 104 |
| 573 | 3300009174 | Ga0105241_11711304 | Ga0105241_117113042 | 104 |
| 574 | 3300009177 | Ga0105248_10102257 | Ga0105248_101022577 | 104 |
| 575 | 3300009545 | Ga0105237_10114912 | Ga0105237_101149123 | 104 |
| 576 | 3300009545 | Ga0105237_10354686 | Ga0105237_103546864 | 104 |
| 577 | 3300009553 | Ga0105249_10280371 | Ga0105249_102803712 | 104 |
| 578 | 3300010375 | Ga0105239_11516979 | Ga0105239_115169792 | 104 |
| 579 | 3300013100 | Ga0157373_11053222 | Ga0157373_110532221 | 104 |
| 580 | 3300013105 | Ga0157369_11122405 | Ga0157369_111224052 | 104 |
| 581 | 3300013306 | Ga0163162_10121002 | Ga0163162_101210026 | 104 |
| 582 | 3300013307 | Ga0157372_10049576 | Ga0157372_100495764 | 104 |
| 583 | 3300013308 | Ga0157375_11813563 | Ga0157375_118135632 | 104 |
| 584 | 3300014325 | Ga0163163_10381617 | Ga0163163_103816172 | 104 |
| 585 | 3300014968 | Ga0157379_10267841 | Ga0157379_102678412 | 104 |
| 586 | 3300014969 | Ga0157376_10982462 | Ga0157376_109824623 | 104 |
| 587 | 3300025321 | Ga0207656_10027958 | Ga0207656_100279582 | 104 |
| 588 | 3300025900 | Ga0207710_10009562 | Ga0207710_1000956210 | 104 |
| 589 | 3300025904 | Ga0207647_10327037 | Ga0207647_103270372 | 104 |
| 590 | 3300025911 | Ga0207654_10062727 | Ga0207654_100627275 | 104 |
| 591 | 3300025913 | Ga0207695_10083172 | Ga0207695_100831726 | 104 |
| 592 | 3300025914 | Ga0207671_10157809 | Ga0207671_101578093 | 104 |
| 593 | 3300025914 | Ga0207671_10201922 | Ga0207671_102019224 | 104 |
| 594 | 3300025919 | Ga0207657_10331237 | Ga0207657_103312372 | 104 |
| 595 | 3300025925 | Ga0207650_10018767 | Ga0207650_100187674 | 104 |
| 596 | 3300025928 | Ga0207700_11716352 | Ga0207700_117163521 | 104 |
| 597 | 3300025931 | Ga0207644_10179249 | Ga0207644_101792492 | 104 |
| 598 | 3300025941 | Ga0207711_10095839 | Ga0207711_100958392 | 104 |
| 599 | 3300025945 | Ga0207679_10901310 | Ga0207679_109013102 | 104 |
| 600 | 3300025961 | Ga0207712_11214831 | Ga0207712_112148312 | 104 |
| 601 | 3300025981 | Ga0207640_10325567 | Ga0207640_103255673 | 104 |
| 602 | 3300025986 | Ga0207658_10041770 | Ga0207658_100417707 | 104 |
| 603 | 3300026023 | Ga0207677_10206872 | Ga0207677_102068722 | 104 |
| 604 | 3300026035 | Ga0207703_10019203 | Ga0207703_100192036 | 104 |
| 605 | 3300026067 | Ga0207678_10005556 | Ga0207678_100055565 | 104 |
| 606 | 3300026078 | Ga0207702_10128657 | Ga0207702_101286575 | 104 |
| 607 | 3300026088 | Ga0207641_10002325 | Ga0207641_1000232514 | 104 |
| 608 | 3300026095 | Ga0207676_10833089 | Ga0207676_108330892 | 104 |
| 609 | 3300026116 | Ga0207674_10415385 | Ga0207674_104153854 | 104 |
| 610 | 3300026118 | Ga0207675_101342193 | Ga0207675_1013421931 | 104 |
| 611 | 3300026142 | Ga0207698_10091691 | Ga0207698_100916914 | 104 |
| 612 | 3300028379 | Ga0268266_10010307 | Ga0268266_100103072 | 104 |
| 613 | 3300028379 | Ga0268266_10022673 | Ga0268266_100226732 | 104 |
| 614 | 3300028380 | Ga0268265_10056316 | Ga0268265_100563166 | 104 |
| 615 | 3300028381 | Ga0268264_10000102 | Ga0268264_1000010214 | 104 |
| 616 | 3300030521 | Ga0307511_10056308 | Ga0307511_100563085 | 104 |
| 617 | 3300033180 | Ga0307510_10000006 | Ga0307510_10000006345 | 104 |
| 618 | 3300033180 | Ga0307510_10029950 | Ga0307510_100299506 | 104 |
| 619 | 3300035691 | Ga0373931_0715389 | Ga0373931_0715389_303_623 | 104 |
| 620 | 3300037471 | Ga0395905_0307437 | Ga0395905_0307437_841_1161 | 104 |
| 621 | 3300039437 | Ga0436365_1843324 | Ga0436365_1843324_338_658 | 104 |
| 622 | 3300046507 | Ga0495606_0121911 | Ga0495606_0121911_1042_1362 | 104 |
| 623 | 3300046519 | Ga0495632_0032155 | Ga0495632_0032155_565_885 | 104 |
| 624 | 3300046522 | Ga0495643_0036660 | Ga0495643_0036660_2230_2550 | 104 |
| 625 | 3300046522 | Ga0495643_0245094 | Ga0495643_0245094_431_751 | 104 |
| 626 | 3300046524 | Ga0495648_0038970 | Ga0495648_0038970_940_1260 | 104 |
| 627 | 3300046538 | Ga0495609_0236791 | Ga0495609_0236791_40_360 | 104 |
| 628 | 3300046616 | Ga0495668_0105281 | Ga0495668_0105281_18_338 | 104 |
| 629 | 3300046660 | Ga0495625_0316795 | Ga0495625_0316795_246_566 | 104 |
| 630 | 3300046694 | Ga0495649_0300158 | Ga0495649_0300158_297_617 | 104 |
| 631 | 3300047323 | Ga0495683_0468386 | Ga0495683_0468386_40_360 | 104 |
| 632 | 3300047443 | Ga0495687_029441 | Ga0495687_029441_337_657 | 104 |
| 633 | 3300047443 | Ga0495687_032507 | Ga0495687_032507_1747_2067 | 104 |
| 634 | 3300047472 | Ga0495686_0591316 | Ga0495686_0591316_105_425 | 104 |
| 635 | 3300048903 | Ga0496100_0110723 | Ga0496100_0110723_1539_1859 | 104 |
| 636 | 3300048905 | Ga0496102_0003295 | Ga0496102_0003295_13180_13500 | 104 |
| 637 | 3300048906 | Ga0496103_0040660 | Ga0496103_0040660_1814_2134 | 104 |
| 638 | 3300048908 | Ga0496105_0562661 | Ga0496105_0562661_106_426 | 104 |
| 639 | 3300048911 | Ga0496108_0168503 | Ga0496108_0168503_301_621 | 104 |
| 640 | 3300048915 | Ga0496112_1636177 | Ga0496112_1636177_201_521 | 104 |
| 641 | 3300048916 | Ga0496113_0189425 | Ga0496113_0189425_629_949 | 104 |
| 642 | 3300048917 | Ga0496114_0051718 | Ga0496114_0051718_565_885 | 104 |
| 643 | 3300048918 | Ga0496115_0071247 | Ga0496115_0071247_2472_2792 | 104 |
| 644 | 3300048920 | Ga0496117_0000787 | Ga0496117_0000787_20313_20633 | 104 |
| 645 | 3300048921 | Ga0496118_0000032 | Ga0496118_0000032_238921_239241 | 104 |
| 646 | 3300048922 | Ga0496119_0055285 | Ga0496119_0055285_1518_1838 | 104 |
| 647 | 3300048922 | Ga0496119_0116851 | Ga0496119_0116851_485_805 | 104 |
| 648 | 3300048923 | Ga0496120_0036388 | Ga0496120_0036388_530_850 | 104 |
| 649 | 3300048923 | Ga0496120_0151997 | Ga0496120_0151997_667_987 | 104 |
| 650 | 3300048924 | Ga0496121_0028362 | Ga0496121_0028362_4191_4511 | 104 |
| 651 | 3300048924 | Ga0496121_0113839 | Ga0496121_0113839_510_830 | 104 |
| 652 | 3300048927 | Ga0496124_0006228 | Ga0496124_0006228_2962_3282 | 104 |
| 653 | 3300048928 | Ga0496125_0001378 | Ga0496125_0001378_6200_6520 | 104 |
| 654 | 3300048929 | Ga0496126_0011396 | Ga0496126_0011396_6106_6426 | 104 |
| 655 | 3300049460 | Ga0495682_0171445 | Ga0495682_0171445_137_457 | 104 |
| 656 | 3300053123 | Ga0500614_025617 | Ga0500614_025617_335_655 | 104 |
| 657 | 3300053136 | Ga0500559_0055356 | Ga0500559_0055356_729_1049 | 104 |
| 658 | 3300053142 | Ga0500577_0265469 | Ga0500577_0265469_361_681 | 104 |
| 659 | 3300053148 | Ga0500590_096636 | Ga0500590_096636_599_919 | 104 |
| 660 | 3300053160 | Ga0500633_0065316 | Ga0500633_0065316_151_471 | 104 |
| 661 | 3300053163 | Ga0500639_108651 | Ga0500639_108651_212_532 | 104 |
| 662 | 3300059493 | Ga0587077_080226 | Ga0587077_080226_28_348 | 104 |
| 663 | 3300059503 | Ga0587080_045007 | Ga0587080_045007_390_710 | 104 |
| 664 | 2010549000 | RicEn_FSXC79173_b1 | RicEn_573190 | 105 |
| 665 | 3300005289 | Ga0065704_10146981 | Ga0065704_101469814 | 105 |
| 666 | 3300023309 | Ga0256744_112018 | Ga0256744_1120182 | 105 |
| 667 | 3300041461 | Ga0451805_115470 | Ga0451805_115470_180_497 | 105 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7zq6-assembly1.cif.gz_u | 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain | 0.9447 | 2 | 104 |
| 8cgd-assembly1.cif.gz_t | clindamycin bound to the 50s subunit | 0.9408 | 2 | 104 |
| 7zq6-assembly1.cif.gz_u | 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain | 0.9349 | 2 | 104 |
| 8cgk-assembly1.cif.gz_t | lincomycin and avilamycin bound to the 50s subunit | 0.9343 | 2 | 104 |
| 8cgd-assembly1.cif.gz_t | clindamycin bound to the 50s subunit | 0.9311 | 2 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6KSP8_36_136_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8961 | 2 | 101 | 2.30.30.30 |
| af_Q55DJ4_14_116_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8819 | 2 | 102 | 2.30.30.30 |
| af_Q96A35_47_153_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8614 | 5 | 102 | 2.30.30.30 |
| af_P91353_98_211_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8495 | 1 | 101 | 2.30.30.30 |
| af_Q55DJ4_14_116_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8427 | 2 | 102 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A328R4V1-F1-model_v4 | deleted | 0.9324 | 2 | 104 |
|
| AF-A0A328R4V1-F1-model_v4 | deleted | 0.9237 | 2 | 104 |
|
| AF-A0A6S6RQV6-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9088 | 2 | 105 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2H0SJS4-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9077 | 3 | 105 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A3G2R041-F1-model_v4 | 50S ribosomal protein L24, chloroplastic | 0.9052 | 5 | 104 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:0009507 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar