F473839

General Info

Members Datasets Scaffolds Average Seq Length
667 311 667 105

Family's Representative Sequence

Representative Sequence 3300012512|Ga0157327_1054108|Ga0157327_10541082
Length 109
Sequence MRKIRKGDNVVVITGRDKGKRGDVTRVLAEHVLVAGINQVKKHQRPNPMKNQTGGIVDKEMPIHLSNVMLVNPASGKGDRVGFKFLEAQGGAPARKVRFFKSNGEVVDV

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
98 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
99 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
100 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
118 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
119 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
181 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
214 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
215 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
216 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
217 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
220 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
221 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
266 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
287 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
303 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
304 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
305 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
306 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
307 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
308 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
309 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.7
Metatranscriptomes 3.15
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 5.1
Rhizosphere 89.96
Stem 0
Stem Tuber 0
Unclassified 3.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC79173_b1 2010549000 Bacteria 811
2 JGI24752J21851_1005316 3300001976 Bacteria 1682
3 JGI24742J22300_10050452 3300002244 Bacteria 753
4 rootH1_10004661 3300003316 Bacteria 2885
5 rootH1_10004661 3300003323 Bacteria 2697
6 rootL2_10064042 3300003322 Bacteria 1045
7 rootH1_10087917 3300003323 Bacteria 1425
8 Ga0065704_10146981 3300005289 Bacteria 1462
9 Ga0070658_10770947 3300005327 Bacteria 835
10 Ga0070658_10893930 3300005327 Bacteria 772
11 Ga0070658_11239224 3300005327 Bacteria 648
12 Ga0070658_12001909 3300005327 Bacteria 500
13 Ga0070676_10034458 3300005328 Bacteria 2907
14 Ga0070676_10084706 3300005328 Bacteria 1930
15 Ga0070676_10105590 3300005328 Bacteria 1747
16 Ga0070676_10658917 3300005328 Bacteria 761
17 Ga0070676_10995701 3300005328 Bacteria 629
18 Ga0070676_11182769 3300005328 Bacteria 580
19 Ga0070683_100036912 3300005329 Bacteria 4471
20 Ga0070690_100219365 3300005330 Bacteria 1332
21 Ga0070690_100573051 3300005330 Bacteria 854
22 Ga0070670_100049275 3300005331 Bacteria 3622
23 Ga0070670_100516327 3300005331 Bacteria 1063
24 Ga0070670_100693150 3300005331 Bacteria 916
25 Ga0070670_100889294 3300005331 Bacteria 807
26 Ga0070670_101099751 3300005331 Bacteria 725
27 Ga0070677_10021939 3300005333 Bacteria 2347
28 Ga0070677_10195851 3300005333 Bacteria 972
29 Ga0068869_100037989 3300005334 Bacteria 3427
30 Ga0068869_100683424 3300005334 Bacteria 874
31 Ga0068869_101867977 3300005334 Bacteria 538
32 Ga0070666_10045917 3300005335 Bacteria 2929
33 Ga0070666_10183555 3300005335 Bacteria 1468
34 Ga0070682_100121457 3300005337 Bacteria 1754
35 Ga0070682_100347010 3300005337 Bacteria 1105
36 Ga0070682_100782150 3300005337 Bacteria 773
37 Ga0068868_100011188 3300005338 Bacteria 6533
38 Ga0068868_100251645 3300005338 Bacteria 1487
39 Ga0068868_100755715 3300005338 Bacteria 874
40 Ga0068868_100853365 3300005338 Bacteria 825
41 Ga0068868_102204895 3300005338 Bacteria 525
42 Ga0070660_100650359 3300005339 Bacteria 883
43 Ga0070660_101185422 3300005339 Bacteria 647
44 Ga0070689_100022606 3300005340 Bacteria 4697
45 Ga0070687_101070546 3300005343 Unclassified 588
46 Ga0070661_100290407 3300005344 Bacteria 1270
47 Ga0070668_100117321 3300005347 Bacteria 2123
48 Ga0070668_100581630 3300005347 Bacteria 978
49 Ga0070669_100038030 3300005353 Bacteria 3492
50 Ga0070669_100328397 3300005353 Bacteria 1237
51 Ga0070669_100779756 3300005353 Bacteria 811
52 Ga0070669_101870626 3300005353 Bacteria 524
53 Ga0070675_100008825 3300005354 Bacteria 7834
54 Ga0070675_100011102 3300005354 Bacteria 7051
55 Ga0070675_100078697 3300005354 Bacteria 2746
56 Ga0070675_101850210 3300005354 Bacteria 557
57 Ga0070671_100001413 3300005355 Bacteria 17942
58 Ga0070671_100043910 3300005355 Bacteria 3714
59 Ga0070671_100046754 3300005355 Bacteria 3599
60 Ga0070671_100231377 3300005355 Bacteria 1568
61 Ga0070671_100385170 3300005355 Bacteria 1198
62 Ga0070671_100805762 3300005355 Bacteria 818
63 Ga0070674_100004652 3300005356 Bacteria 7840
64 Ga0070674_100096649 3300005356 Bacteria 2144
65 Ga0070674_100464815 3300005356 Bacteria 1047
66 Ga0070674_100810729 3300005356 Bacteria 809
67 Ga0070674_101365702 3300005356 Bacteria 633
68 Ga0070674_101582596 3300005356 Bacteria 590
69 Ga0070673_100002406 3300005364 Bacteria 11383
70 Ga0070673_100034303 3300005364 Bacteria 3838
71 Ga0070673_100180192 3300005364 Bacteria 1808
72 Ga0070673_100231366 3300005364 Bacteria 1603
73 Ga0070673_100873619 3300005364 Bacteria 833
74 Ga0070673_101526794 3300005364 Bacteria 630
75 Ga0070688_100776035 3300005365 Bacteria 748
76 Ga0070659_100039243 3300005366 Bacteria 3696
77 Ga0070659_100300462 3300005366 Bacteria 1339
78 Ga0070659_100494235 3300005366 Bacteria 1042
79 Ga0070659_100959345 3300005366 Bacteria 749
80 Ga0070667_100022362 3300005367 Bacteria 5245
81 Ga0070667_100086170 3300005367 Bacteria 2694
82 Ga0070667_100163030 3300005367 Bacteria 1965
83 Ga0070667_100467584 3300005367 Bacteria 1153
84 Ga0070667_101539402 3300005367 Bacteria 625
85 Ga0070667_101637638 3300005367 Bacteria 605
86 Ga0070713_100000028 3300005436 Bacteria 93227
87 Ga0070701_10058119 3300005438 Bacteria 2029
88 Ga0070701_10201334 3300005438 Bacteria 1177
89 Ga0070711_100200043 3300005439 Bacteria 1541
90 Ga0070705_100228096 3300005440 Bacteria 1294
91 Ga0070700_100204485 3300005441 Bacteria 1389
92 Ga0070708_100493044 3300005445 Bacteria 1156
93 Ga0070708_100760858 3300005445 Bacteria 911
94 Ga0070663_100066821 3300005455 Bacteria 2606
95 Ga0070663_100098843 3300005455 Bacteria 2174
96 Ga0070678_100000327 3300005456 Bacteria 22213
97 Ga0070678_100026422 3300005456 Bacteria 3924
98 Ga0070678_100082508 3300005456 Bacteria 2441
99 Ga0070678_100087735 3300005456 Bacteria 2376
100 Ga0070678_100748794 3300005456 Bacteria 884
101 Ga0070678_102290273 3300005456 Bacteria 513
102 Ga0070662_100051713 3300005457 Bacteria 2968
103 Ga0070662_100174375 3300005457 Bacteria 1691
104 Ga0070662_100763180 3300005457 Bacteria 821
105 Ga0070662_101790447 3300005457 Bacteria 530
106 Ga0070681_10375418 3300005458 Bacteria 1332
107 Ga0068867_100064867 3300005459 Bacteria 2716
108 Ga0068867_100080644 3300005459 Bacteria 2451
109 Ga0068867_100091112 3300005459 Bacteria 2314
110 Ga0070685_10253476 3300005466 Bacteria 1167
111 Ga0070685_10652222 3300005466 Bacteria 763
112 Ga0070706_101248200 3300005467 Bacteria 682
113 Ga0070707_101777180 3300005468 Bacteria 584
114 Ga0070684_100128821 3300005535 Bacteria 2282
115 Ga0070684_100311540 3300005535 Bacteria 1445
116 Ga0070697_101101688 3300005536 Bacteria 707
117 Ga0068853_100185586 3300005539 Bacteria 1888
118 Ga0068853_100379103 3300005539 Bacteria 1320
119 Ga0070672_100003635 3300005543 Bacteria 10011
120 Ga0070672_100010859 3300005543 Bacteria 6333
121 Ga0070672_100120388 3300005543 Bacteria 2148
122 Ga0070695_100171036 3300005545 Bacteria 1533
123 Ga0070695_100779311 3300005545 Bacteria 765
124 Ga0070693_100221817 3300005547 Bacteria 1239
125 Ga0070665_100096850 3300005548 Bacteria 2955
126 Ga0070665_100128413 3300005548 Bacteria 2538
127 Ga0070665_101369850 3300005548 Bacteria 717
128 Ga0070665_101540743 3300005548 Bacteria 673
129 Ga0070704_101561729 3300005549 Bacteria 608
130 Ga0068855_100114994 3300005563 Bacteria 3084
131 Ga0070664_100879929 3300005564 Bacteria 839
132 Ga0070664_101158090 3300005564 Bacteria 729
133 Ga0068857_100323763 3300005577 Bacteria 1424
134 Ga0068854_100083412 3300005578 Bacteria 2363
135 Ga0068854_100243308 3300005578 Bacteria 1434
136 Ga0068856_100042931 3300005614 Bacteria 4449
137 Ga0068856_100044462 3300005614 Bacteria 4372
138 Ga0070702_100564960 3300005615 Bacteria 847
139 Ga0070702_100790184 3300005615 Bacteria 733
140 Ga0068852_100023109 3300005616 Bacteria 4998
141 Ga0068852_100172880 3300005616 Bacteria 2026
142 Ga0068859_100092729 3300005617 Bacteria 3072
143 Ga0068859_100199443 3300005617 Bacteria 2086
144 Ga0068859_100463388 3300005617 Bacteria 1363
145 Ga0068864_100052938 3300005618 Bacteria 3500
146 Ga0068864_100090413 3300005618 Bacteria 2699
147 Ga0068864_100290440 3300005618 Bacteria 1528
148 Ga0068864_100322728 3300005618 Bacteria 1450
149 Ga0068864_100344967 3300005618 Bacteria 1404
150 Ga0068866_10051071 3300005718 Bacteria 2103
151 Ga0068866_10738790 3300005718 Bacteria 679
152 Ga0068861_100157835 3300005719 Bacteria 1868
153 Ga0068861_100608985 3300005719 Bacteria 1004
154 Ga0068861_101822766 3300005719 Bacteria 604
155 Ga0068851_10024902 3300005834 Bacteria 2932
156 Ga0068851_10038354 3300005834 Bacteria 2403
157 Ga0068870_10040752 3300005840 Bacteria 2410
158 Ga0068870_10699873 3300005840 Bacteria 699
159 Ga0068863_100154561 3300005841 Bacteria 2196
160 Ga0068863_100208630 3300005841 Bacteria 1881
161 Ga0068863_100397529 3300005841 Bacteria 1347
162 Ga0068863_101085569 3300005841 Bacteria 805
163 Ga0068858_100004270 3300005842 Bacteria 14053
164 Ga0068858_101795771 3300005842 Bacteria 606
165 Ga0068860_100006244 3300005843 Bacteria 11972
166 Ga0068860_100039483 3300005843 Bacteria 4514
167 Ga0068860_100048811 3300005843 Bacteria 4034
168 Ga0068860_101701234 3300005843 Bacteria 653
169 Ga0068862_100065242 3300005844 Bacteria 3136
170 Ga0068862_100170612 3300005844 Bacteria 1948
171 Ga0068862_101241347 3300005844 Bacteria 745
172 Ga0081455_10210306 3300005937 Bacteria 1450
173 Ga0081539_10016553 3300005985 Bacteria 5252
174 Ga0070717_10728593 3300006028 Bacteria 901
175 Ga0070717_12126724 3300006028 Bacteria 505
176 Ga0070712_100681582 3300006175 Bacteria 875
177 Ga0097621_100043697 3300006237 Bacteria 3613
178 Ga0097621_100122525 3300006237 Bacteria 2207
179 Ga0097621_100272895 3300006237 Bacteria 1486
180 Ga0097621_100529664 3300006237 Bacteria 1070
181 Ga0068871_100013379 3300006358 Bacteria 6089
182 Ga0068871_101440804 3300006358 Unclassified 650
183 Ga0075428_100005627 3300006844 Bacteria 13923
184 Ga0075428_100136599 3300006844 Bacteria 2666
185 Ga0075428_101080657 3300006844 Bacteria 848
186 Ga0075434_100745595 3300006871 Bacteria 996
187 Ga0075434_101390664 3300006871 Bacteria 712
188 Ga0075429_100176353 3300006880 Bacteria 1873
189 Ga0068865_100027334 3300006881 Bacteria 3768
190 Ga0068865_100047049 3300006881 Bacteria 2962
191 Ga0068865_100121180 3300006881 Bacteria 1945
192 Ga0068865_100406520 3300006881 Bacteria 1116
193 Ga0075436_100297688 3300006914 Bacteria 1156
194 Ga0075436_100833428 3300006914 Bacteria 688
195 Ga0097620_100092731 3300006931 Bacteria 3072
196 Ga0097620_100199432 3300006931 Bacteria 2086
197 Ga0097620_100463394 3300006931 Bacteria 1363
198 Ga0075435_101078312 3300007076 Bacteria 702
199 Ga0075435_101315975 3300007076 Bacteria 633
200 Ga0105240_10075753 3300009093 Bacteria 4149
201 Ga0105240_10290716 3300009093 Bacteria 1874
202 Ga0105240_12390537 3300009093 Bacteria 547
203 Ga0111539_10029410 3300009094 Bacteria 6691
204 Ga0111539_10100124 3300009094 Bacteria 3403
205 Ga0111539_10104296 3300009094 Bacteria 3327
206 Ga0111539_11069052 3300009094 Bacteria 938
207 Ga0105245_10972752 3300009098 Bacteria 892
208 Ga0105245_11817138 3300009098 Bacteria 662
209 Ga0105245_12997962 3300009098 Bacteria 523
210 Ga0105247_10025648 3300009101 Bacteria 3557
211 Ga0105247_10424377 3300009101 Unclassified 953
212 Ga0114129_10149274 3300009147 Bacteria 3199
213 Ga0105243_10356474 3300009148 Bacteria 1345
214 Ga0105241_10900004 3300009174 Bacteria 822
215 Ga0105241_11711304 3300009174 Bacteria 611
216 Ga0105242_10278392 3300009176 Bacteria 1518
217 Ga0105248_10102257 3300009177 Bacteria 3230
218 Ga0105248_10210633 3300009177 Bacteria 2190
219 Ga0105248_11522987 3300009177 Bacteria 757
220 Ga0105248_11726003 3300009177 Bacteria 710
221 Ga0105248_11942552 3300009177 Bacteria 668
222 Ga0105248_12194369 3300009177 Bacteria 628
223 Ga0105237_10114912 3300009545 Bacteria 2685
224 Ga0105237_10354686 3300009545 Bacteria 1471
225 Ga0105249_10269224 3300009553 Bacteria 1696
226 Ga0105249_10280371 3300009553 Bacteria 1664
227 Ga0105249_12309106 3300009553 Bacteria 611
228 Ga0105249_13240438 3300009553 Bacteria 523
229 Ga0105239_11152857 3300010375 Bacteria 893
230 Ga0105239_11516979 3300010375 Bacteria 774
231 Ga0105239_12159720 3300010375 Bacteria 647
232 Ga0105246_10225680 3300011119 Bacteria 1471
233 Ga0105246_11055879 3300011119 Bacteria 739
234 Ga0157336_1002805 3300012477 Bacteria 1010
235 Ga0157322_1029736 3300012490 Bacteria 577
236 Ga0157313_1050249 3300012503 Bacteria 540
237 Ga0157327_1054108 3300012512 Bacteria 580
238 Ga0157373_10063367 3300013100 Bacteria 2618
239 Ga0157373_11053222 3300013100 Bacteria 609
240 Ga0157371_10665099 3300013102 Bacteria 778
241 Ga0157370_10003375 3300013104 Bacteria 18774
242 Ga0157369_11122405 3300013105 Bacteria 803
243 Ga0157374_10063292 3300013296 Bacteria 3469
244 Ga0157374_10107792 3300013296 Bacteria 2677
245 Ga0157378_10007984 3300013297 Bacteria 9239
246 Ga0157378_10081895 3300013297 Bacteria 2918
247 Ga0157378_10290591 3300013297 Bacteria 1579
248 Ga0157378_10498122 3300013297 Bacteria 1217
249 Ga0157378_12682145 3300013297 Bacteria 551
250 Ga0163162_10033165 3300013306 Bacteria 5130
251 Ga0163162_10121002 3300013306 Bacteria 2722
252 Ga0163162_10138948 3300013306 Bacteria 2541
253 Ga0163162_10590148 3300013306 Bacteria 1238
254 Ga0163162_11067585 3300013306 Bacteria 914
255 Ga0163162_12303188 3300013306 Bacteria 619
256 Ga0163162_12475083 3300013306 Bacteria 597
257 Ga0157372_10049576 3300013307 Bacteria 4669
258 Ga0157372_11017425 3300013307 Bacteria 959
259 Ga0157375_10026295 3300013308 Bacteria 5420
260 Ga0157375_10047239 3300013308 Bacteria 4203
261 Ga0157375_10102304 3300013308 Bacteria 2949
262 Ga0157375_10246674 3300013308 Bacteria 1946
263 Ga0157375_10325009 3300013308 Bacteria 1703
264 Ga0157375_10544768 3300013308 Bacteria 1322
265 Ga0157375_10815642 3300013308 Bacteria 1081
266 Ga0157375_11497657 3300013308 Bacteria 796
267 Ga0157375_11813563 3300013308 Bacteria 723
268 Ga0163163_10151059 3300014325 Bacteria 2366
269 Ga0163163_10381617 3300014325 Bacteria 1467
270 Ga0163163_10982743 3300014325 Bacteria 907
271 Ga0163163_11247530 3300014325 Bacteria 806
272 Ga0163163_11946481 3300014325 Bacteria 648
273 Ga0157380_10138399 3300014326 Bacteria 2088
274 Ga0157380_11536852 3300014326 Bacteria 719
275 Ga0182008_10130948 3300014497 Bacteria 1250
276 Ga0182008_10170693 3300014497 Bacteria 1098
277 Ga0157377_10450121 3300014745 Bacteria 889
278 Ga0157379_10267841 3300014968 Bacteria 1553
279 Ga0157379_11044175 3300014968 Bacteria 781
280 Ga0157376_10036746 3300014969 Bacteria 3970
281 Ga0157376_10054404 3300014969 Bacteria 3336
282 Ga0157376_10068236 3300014969 Bacteria 3010
283 Ga0157376_10693036 3300014969 Bacteria 1023
284 Ga0157376_10751400 3300014969 Bacteria 984
285 Ga0157376_10982462 3300014969 Bacteria 866
286 Ga0163161_10223293 3300017792 Unclassified 1459
287 Ga0163161_10281396 3300017792 Bacteria 1305
288 Ga0163161_10592496 3300017792 Bacteria 913
289 Ga0213872_10101361 3300021361 Bacteria 1283
290 Ga0213872_10442081 3300021361 Bacteria 523
291 Ga0213874_10144534 3300021377 Bacteria 826
292 Ga0256744_112018 3300023309 Bacteria 4684
293 Ga0207697_10126186 3300025315 Bacteria 1104
294 Ga0207656_10027958 3300025321 Bacteria 2311
295 Ga0207682_10106639 3300025893 Bacteria 1230
296 Ga0207642_10073501 3300025899 Bacteria 1635
297 Ga0207642_10081084 3300025899 Bacteria 1576
298 Ga0207642_10487852 3300025899 Bacteria 752
299 Ga0207710_10009562 3300025900 Bacteria 4077
300 Ga0207688_10037377 3300025901 Bacteria 2692
301 Ga0207680_10642314 3300025903 Bacteria 760
302 Ga0207680_11034900 3300025903 Bacteria 588
303 Ga0207647_10327037 3300025904 Bacteria 870
304 Ga0207645_10062943 3300025907 Bacteria 2370
305 Ga0207645_10172318 3300025907 Bacteria 1419
306 Ga0207645_10202414 3300025907 Bacteria 1306
307 Ga0207645_10270048 3300025907 Bacteria 1128
308 Ga0207645_10358668 3300025907 Bacteria 976
309 Ga0207645_10694587 3300025907 Bacteria 691
310 Ga0207643_10007783 3300025908 Bacteria 5755
311 Ga0207705_10962720 3300025909 Bacteria 660
312 Ga0207654_10062727 3300025911 Bacteria 2179
313 Ga0207695_10083172 3300025913 Bacteria 3234
314 Ga0207671_10157809 3300025914 Bacteria 1756
315 Ga0207671_10201922 3300025914 Bacteria 1553
316 Ga0207693_10616275 3300025915 Bacteria 844
317 Ga0207663_10251465 3300025916 Bacteria 1301
318 Ga0207662_10493800 3300025918 Bacteria 842
319 Ga0207662_10599252 3300025918 Bacteria 766
320 Ga0207657_10331237 3300025919 Bacteria 1202
321 Ga0207681_10068266 3300025923 Bacteria 2468
322 Ga0207681_10637239 3300025923 Bacteria 883
323 Ga0207681_10664201 3300025923 Bacteria 865
324 Ga0207650_10004274 3300025925 Bacteria 9749
325 Ga0207650_10009448 3300025925 Bacteria 6665
326 Ga0207650_10017815 3300025925 Bacteria 4975
327 Ga0207650_10018767 3300025925 Bacteria 4857
328 Ga0207650_10873769 3300025925 Bacteria 763
329 Ga0207659_10267157 3300025926 Bacteria 1394
330 Ga0207659_10327483 3300025926 Bacteria 1265
331 Ga0207659_11176435 3300025926 Bacteria 659
332 Ga0207659_11318625 3300025926 Bacteria 619
333 Ga0207659_11382301 3300025926 Bacteria 604
334 Ga0207700_11716352 3300025928 Bacteria 553
335 Ga0207664_10736803 3300025929 Bacteria 886
336 Ga0207644_10000883 3300025931 Bacteria 18912
337 Ga0207644_10076281 3300025931 Bacteria 2466
338 Ga0207644_10119393 3300025931 Bacteria 2005
339 Ga0207644_10154493 3300025931 Bacteria 1778
340 Ga0207644_10179249 3300025931 Bacteria 1659
341 Ga0207690_10047030 3300025932 Bacteria 2861
342 Ga0207690_10265741 3300025932 Bacteria 1331
343 Ga0207690_10513488 3300025932 Bacteria 970
344 Ga0207690_10840035 3300025932 Bacteria 760
345 Ga0207706_10035361 3300025933 Bacteria 4443
346 Ga0207706_10089111 3300025933 Bacteria 2712
347 Ga0207706_10271395 3300025933 Bacteria 1480
348 Ga0207706_10503242 3300025933 Bacteria 1046
349 Ga0207706_10530772 3300025933 Bacteria 1014
350 Ga0207706_10743033 3300025933 Bacteria 836
351 Ga0207706_11085226 3300025933 Bacteria 669
352 Ga0207686_11266190 3300025934 Bacteria 605
353 Ga0207709_11183660 3300025935 Bacteria 629
354 Ga0207670_10207757 3300025936 Bacteria 1491
355 Ga0207669_10132217 3300025937 Bacteria 1717
356 Ga0207669_10132341 3300025937 Bacteria 1716
357 Ga0207669_10235381 3300025937 Bacteria 1354
358 Ga0207669_11239385 3300025937 Bacteria 633
359 Ga0207704_10115963 3300025938 Bacteria 1821
360 Ga0207704_10282747 3300025938 Bacteria 1262
361 Ga0207704_10708738 3300025938 Bacteria 834
362 Ga0207691_10006216 3300025940 Bacteria 11531
363 Ga0207691_10025524 3300025940 Bacteria 5546
364 Ga0207691_10045309 3300025940 Bacteria 4044
365 Ga0207711_10095839 3300025941 Bacteria 2618
366 Ga0207711_10604944 3300025941 Bacteria 1023
367 Ga0207711_11456076 3300025941 Bacteria 628
368 Ga0207689_10058818 3300025942 Bacteria 3162
369 Ga0207689_10237998 3300025942 Bacteria 1505
370 Ga0207689_10559590 3300025942 Bacteria 961
371 Ga0207689_11393974 3300025942 Bacteria 587
372 Ga0207661_10609477 3300025944 Bacteria 1002
373 Ga0207679_10110578 3300025945 Bacteria 2168
374 Ga0207679_10399474 3300025945 Bacteria 1209
375 Ga0207679_10428698 3300025945 Bacteria 1168
376 Ga0207679_10901310 3300025945 Bacteria 809
377 Ga0207651_10210875 3300025960 Bacteria 1563
378 Ga0207651_11349383 3300025960 Bacteria 641
379 Ga0207651_11424838 3300025960 Bacteria 624
380 Ga0207712_10204524 3300025961 Bacteria 1568
381 Ga0207712_10875968 3300025961 Bacteria 792
382 Ga0207712_11214831 3300025961 Bacteria 673
383 Ga0207668_10216740 3300025972 Bacteria 1534
384 Ga0207668_10472094 3300025972 Bacteria 1074
385 Ga0207668_11324917 3300025972 Bacteria 648
386 Ga0207668_11460419 3300025972 Bacteria 617
387 Ga0207640_10004152 3300025981 Bacteria 7829
388 Ga0207640_10325567 3300025981 Bacteria 1225
389 Ga0207658_10041770 3300025986 Bacteria 3322
390 Ga0207658_10261512 3300025986 Bacteria 1475
391 Ga0207658_10447524 3300025986 Bacteria 1143
392 Ga0207658_10719520 3300025986 Bacteria 903
393 Ga0207658_10738490 3300025986 Bacteria 891
394 Ga0207677_10003662 3300026023 Bacteria 8158
395 Ga0207677_10206872 3300026023 Bacteria 1564
396 Ga0207677_10270077 3300026023 Bacteria 1391
397 Ga0207677_11193963 3300026023 Bacteria 696
398 Ga0207703_10019203 3300026035 Bacteria 5338
399 Ga0207703_10035587 3300026035 Bacteria 3957
400 Ga0207703_10647877 3300026035 Bacteria 1002
401 Ga0207703_11225635 3300026035 Bacteria 721
402 Ga0207639_10397612 3300026041 Bacteria 1241
403 Ga0207678_10005556 3300026067 Bacteria 11267
404 Ga0207678_10356050 3300026067 Bacteria 1263
405 Ga0207708_10174199 3300026075 Bacteria 1705
406 Ga0207708_10214751 3300026075 Bacteria 1539
407 Ga0207702_10074732 3300026078 Bacteria 2926
408 Ga0207702_10128657 3300026078 Bacteria 2276
409 Ga0207641_10002325 3300026088 Bacteria 17632
410 Ga0207641_10007438 3300026088 Bacteria 9110
411 Ga0207641_10055785 3300026088 Bacteria 3355
412 Ga0207641_10306595 3300026088 Bacteria 1501
413 Ga0207641_11511704 3300026088 Bacteria 673
414 Ga0207641_12116010 3300026088 Bacteria 563
415 Ga0207648_10005997 3300026089 Bacteria 12143
416 Ga0207648_10154153 3300026089 Bacteria 2028
417 Ga0207648_10538541 3300026089 Bacteria 1071
418 Ga0207676_10005874 3300026095 Bacteria 8668
419 Ga0207676_10080615 3300026095 Bacteria 2642
420 Ga0207676_10083154 3300026095 Bacteria 2606
421 Ga0207676_10210305 3300026095 Bacteria 1725
422 Ga0207676_10833089 3300026095 Bacteria 901
423 Ga0207676_10852583 3300026095 Bacteria 891
424 Ga0207676_10855268 3300026095 Bacteria 890
425 Ga0207674_10415385 3300026116 Bacteria 1300
426 Ga0207675_100020639 3300026118 Bacteria 6140
427 Ga0207675_100166548 3300026118 Bacteria 2105
428 Ga0207675_100458287 3300026118 Bacteria 1264
429 Ga0207675_100538668 3300026118 Bacteria 1165
430 Ga0207675_101342193 3300026118 Bacteria 736
431 Ga0207675_101898458 3300026118 Bacteria 614
432 Ga0207683_10001392 3300026121 Bacteria 21816
433 Ga0207683_10025934 3300026121 Bacteria 5059
434 Ga0207683_10080176 3300026121 Bacteria 2895
435 Ga0207683_10308643 3300026121 Bacteria 1448
436 Ga0207683_10831464 3300026121 Bacteria 857
437 Ga0207698_10035123 3300026142 Bacteria 3663
438 Ga0207698_10091691 3300026142 Bacteria 2488
439 Ga0209974_10010320 3300027876 Bacteria 3151
440 Ga0209974_10113611 3300027876 Bacteria 955
441 Ga0207428_10008889 3300027907 Bacteria 9048
442 Ga0207428_10177011 3300027907 Bacteria 1613
443 Ga0268266_10010307 3300028379 Bacteria 8174
444 Ga0268266_10022673 3300028379 Bacteria 5345
445 Ga0268266_10334088 3300028379 Bacteria 1421
446 Ga0268266_10853193 3300028379 Bacteria 880
447 Ga0268266_11719288 3300028379 Bacteria 602
448 Ga0268265_10056316 3300028380 Bacteria 2990
449 Ga0268265_10156946 3300028380 Bacteria 1927
450 Ga0268264_10000102 3300028381 Bacteria 222526
451 Ga0268264_10221924 3300028381 Bacteria 1740
452 Ga0268264_10981412 3300028381 Bacteria 851
453 Ga0268264_11008892 3300028381 Bacteria 839
454 Ga0268264_12185674 3300028381 Bacteria 561
455 Ga0265338_10316023 3300028800 Bacteria 1132
456 Ga0307511_10056308 3300030521 Bacteria 3076
457 Ga0265330_10004608 3300031235 Bacteria 6970
458 Ga0265332_10001783 3300031238 Bacteria 11615
459 Ga0265332_10193672 3300031238 Bacteria 846
460 Ga0265340_10020617 3300031247 Bacteria 3384
461 Ga0265331_10000635 3300031250 Bacteria 30467
462 Ga0265327_10031432 3300031251 Bacteria 2983
463 Ga0307408_100525650 3300031548 Bacteria 1040
464 Ga0316575_10001575 3300031665 Bacteria 7413
465 Ga0265314_10070955 3300031711 Bacteria 2332
466 Ga0265342_10445975 3300031712 Bacteria 664
467 Ga0307412_10348371 3300031911 Bacteria 1188
468 Ga0307416_100230420 3300032002 Bacteria 1785
469 Ga0307411_11042489 3300032005 Bacteria 734
470 Ga0316593_10000049 3300032168 Bacteria 13299
471 Ga0316593_10000058 3300032168 Bacteria 12691
472 Ga0316593_10005257 3300032168 Bacteria 3398
473 Ga0316593_10005293 3300032168 Bacteria 3388
474 Ga0316593_10010662 3300032168 Bacteria 2645
475 Ga0316593_10020416 3300032168 Bacteria 2060
476 Ga0316593_10100138 3300032168 Bacteria 1027
477 Ga0316593_10111466 3300032168 Bacteria 977
478 Ga0307510_10000006 3300033180 Bacteria 566474
479 Ga0307510_10029950 3300033180 Bacteria 6180
480 Ga0316592_1051470 3300033524 Bacteria 920
481 Ga0316588_1018137 3300033528 Bacteria 1574
482 Ga0316588_1131490 3300033528 Unclassified 637
483 Ga0316587_1000182 3300033529 Bacteria 5325
484 Ga0316587_1012260 3300033529 Bacteria 1392
485 Ga0316587_1015548 3300033529 Bacteria 1263
486 Ga0316587_1108024 3300033529 Bacteria 539
487 Ga0316596_1000880 3300033541 Bacteria 5653
488 Ga0316596_1026187 3300033541 Bacteria 1503
489 Ga0373923_0303929 3300035111 Bacteria 755
490 Ga0373939_0062064 3300035114 Bacteria 1193
491 Ga0373939_0403737 3300035114 Bacteria 567
492 Ga0373924_0465545 3300035410 Bacteria 567
493 Ga0373931_0552599 3300035691 Bacteria 748
494 Ga0373931_0715389 3300035691 Bacteria 662
495 Ga0373935_0131323 3300035692 Bacteria 1683
496 Ga0373935_0313334 3300035692 Bacteria 1112
497 Ga0373933_0068883 3300035724 Bacteria 2150
498 Ga0373933_0360221 3300035724 Bacteria 946
499 Ga0373937_0054320 3300036401 Bacteria 3675
500 Ga0373925_0031180 3300037068 Bacteria 3916
501 Ga0395900_0046031 3300037418 Bacteria 4493
502 Ga0395905_0307437 3300037471 Bacteria 1474
503 Ga0395901_0220488 3300038443 Bacteria 1983
504 Ga0395901_0364811 3300038443 Bacteria 1489
505 Ga0436365_1843324 3300039437 Bacteria 986
506 Ga0436361_0015574 3300039447 Bacteria 1138
507 Ga0436361_0020791 3300039447 Bacteria 531
508 Ga0436363_0712517 3300039450 Bacteria 1172
509 Ga0439447_168955 3300041407 Bacteria 504
510 Ga0451805_115470 3300041461 Bacteria 559
511 Ga0451807_2644321 3300041486 Bacteria 852
512 Ga0451845_0449866 3300041501 Bacteria 511
513 Ga0451851_0752822 3300041507 Bacteria 637
514 Ga0451851_1147119 3300041507 Bacteria 839
515 Ga0451853_2627193 3300041512 Bacteria 627
516 Ga0451853_3854955 3300041512 Bacteria 583
517 Ga0439435_0010142 3300042436 Bacteria 2228
518 Ga0439460_0125495 3300042461 Bacteria 842
519 Ga0450916_039082 3300042530 Bacteria 716
520 Ga0451576_0077585 3300045051 Bacteria 3457
521 Ga0495582_0685849 3300046473 Bacteria 593
522 Ga0495606_0121911 3300046507 Bacteria 1560
523 Ga0495608_0894358 3300046511 Bacteria 520
524 Ga0495632_0032155 3300046519 Bacteria 2706
525 Ga0495643_0036660 3300046522 Bacteria 2693
526 Ga0495643_0245094 3300046522 Bacteria 839
527 Ga0495648_0038970 3300046524 Bacteria 3031
528 Ga0495640_0510207 3300046533 Bacteria 731
529 Ga0495609_0236791 3300046538 Bacteria 755
530 Ga0495668_0105281 3300046616 Bacteria 1543
531 Ga0495625_0316795 3300046660 Bacteria 994
532 Ga0495669_0182168 3300046684 Bacteria 1002
533 Ga0495613_0095378 3300046689 Bacteria 2152
534 Ga0495649_0300158 3300046694 Bacteria 818
535 Ga0495581_0237132 3300047315 Bacteria 1067
536 Ga0495636_0371815 3300047318 Bacteria 677
537 Ga0495683_0468386 3300047323 Bacteria 515
538 Ga0495687_029441 3300047443 Bacteria 2542
539 Ga0495687_032507 3300047443 Bacteria 2380
540 Ga0495675_0358107 3300047444 Bacteria 857
541 Ga0495686_0591316 3300047472 Bacteria 576
542 Ga0496100_0064332 3300048903 Bacteria 2427
543 Ga0496100_0110723 3300048903 Bacteria 1907
544 Ga0496101_0749609 3300048904 Unclassified 771
545 Ga0496101_1359051 3300048904 Bacteria 555
546 Ga0496101_1554436 3300048904 Bacteria 514
547 Ga0496102_0003295 3300048905 Bacteria 13691
548 Ga0496102_0218206 3300048905 Bacteria 1798
549 Ga0496103_0040660 3300048906 Bacteria 2857
550 Ga0496104_0290043 3300048907 Bacteria 1549
551 Ga0496105_0562661 3300048908 Bacteria 889
552 Ga0496106_0530886 3300048909 Unclassified 945
553 Ga0496107_0444656 3300048910 Unclassified 963
554 Ga0496107_0663132 3300048910 Bacteria 769
555 Ga0496108_0051456 3300048911 Bacteria 3451
556 Ga0496108_0168503 3300048911 Bacteria 1894
557 Ga0496108_0409111 3300048911 Bacteria 1185
558 Ga0496108_0812471 3300048911 Unclassified 806
559 Ga0496108_1233528 3300048911 Bacteria 631
560 Ga0496109_0001894 3300048912 Bacteria 17370
561 Ga0496109_0128868 3300048912 Bacteria 2360
562 Ga0496109_1784286 3300048912 Bacteria 548
563 Ga0496110_0012098 3300048913 Bacteria 7089
564 Ga0496112_0188174 3300048915 Bacteria 2027
565 Ga0496112_1043092 3300048915 Bacteria 737
566 Ga0496112_1636177 3300048915 Bacteria 557
567 Ga0496113_0189425 3300048916 Bacteria 1633
568 Ga0496113_0227897 3300048916 Bacteria 1486
569 Ga0496114_0005126 3300048917 Bacteria 10216
570 Ga0496114_0051718 3300048917 Bacteria 3421
571 Ga0496115_0071247 3300048918 Bacteria 2819
572 Ga0496115_0761495 3300048918 Unclassified 756
573 Ga0496115_0798008 3300048918 Bacteria 735
574 Ga0496117_0000787 3300048920 Bacteria 49745
575 Ga0496118_0000032 3300048921 Bacteria 330072
576 Ga0496119_0055285 3300048922 Bacteria 2411
577 Ga0496119_0116851 3300048922 Bacteria 1471
578 Ga0496120_0036388 3300048923 Bacteria 2930
579 Ga0496120_0151997 3300048923 Bacteria 1162
580 Ga0496121_0028362 3300048924 Bacteria 5213
581 Ga0496121_0113839 3300048924 Bacteria 2057
582 Ga0496124_0006228 3300048927 Bacteria 13069
583 Ga0496125_0001378 3300048928 Bacteria 35674
584 Ga0496126_0011396 3300048929 Bacteria 9209
585 Ga0495682_0171445 3300049460 Bacteria 772
586 Ga0501031_0003260 3300049568 Bacteria 10431
587 Ga0501031_0009677 3300049568 Bacteria 6275
588 Ga0501032_0000036 3300049569 Bacteria 117044
589 Ga0501032_0023103 3300049569 Bacteria 4304
590 Ga0501032_0028750 3300049569 Bacteria 3818
591 Ga0501032_0358499 3300049569 Bacteria 939
592 Ga0501032_1036574 3300049569 Bacteria 515
593 Ga0501033_0001817 3300049570 Bacteria 18639
594 Ga0501033_0003966 3300049570 Bacteria 11998
595 Ga0501033_0016663 3300049570 Bacteria 5558
596 Ga0501034_0003361 3300049571 Bacteria 18264
597 Ga0501034_0017280 3300049571 Bacteria 7400
598 Ga0501034_0417785 3300049571 Bacteria 1263
599 Ga0501036_0000512 3300049572 Bacteria 27832
600 Ga0501036_0001490 3300049572 Bacteria 18035
601 Ga0501036_0002120 3300049572 Bacteria 15493
602 Ga0501037_0001263 3300049573 Bacteria 18639
603 Ga0501037_0157957 3300049573 Bacteria 1617
604 Ga0501037_0379343 3300049573 Bacteria 972
605 Ga0501037_0701742 3300049573 Bacteria 673
606 Ga0501038_0003243 3300049574 Bacteria 15162
607 Ga0501038_0004836 3300049574 Bacteria 12512
608 Ga0501038_0055092 3300049574 Bacteria 3417
609 Ga0501038_0189573 3300049574 Bacteria 1655
610 Ga0501038_0413062 3300049574 Bacteria 1042
611 Ga0501039_0011968 3300049575 Bacteria 6612
612 Ga0501040_0000218 3300049576 Bacteria 33403
613 Ga0501042_0000031 3300049578 Bacteria 46017
614 Ga0501043_0000157 3300049579 Bacteria 62190
615 Ga0501043_0006833 3300049579 Bacteria 9109
616 Ga0501043_0016645 3300049579 Bacteria 5762
617 Ga0501043_0373052 3300049579 Bacteria 1081
618 Ga0501046_0002577 3300049580 Bacteria 16965
619 Ga0501046_0004484 3300049580 Bacteria 12660
620 Ga0501046_0309239 3300049580 Bacteria 1153
621 Ga0501047_0002207 3300049581 Bacteria 18639
622 Ga0501048_0002716 3300049582 Bacteria 13496
623 Ga0501068_0001608 3300049584 Bacteria 12025
624 Ga0501068_0004846 3300049584 Bacteria 7326
625 Ga0501069_0258868 3300049585 Bacteria 1016
626 Ga0501070_0090993 3300049586 Bacteria 2525
627 Ga0501073_0048394 3300049589 Bacteria 2984
628 Ga0501074_0060457 3300049590 Bacteria 2730
629 Ga0501077_0131618 3300049593 Bacteria 1586
630 Ga0501208_070567 3300049655 Bacteria 702
631 Ga0501247_032709 3300049677 Bacteria 717
632 Ga0501247_037686 3300049677 Bacteria 682
633 Ga0501080_0206492 3300049742 Bacteria 1801
634 Ga0501083_0031483 3300049744 Bacteria 3641
635 Ga0501272_065513 3300049769 Bacteria 525
636 Ga0501035_0000671 3300049822 Bacteria 37548
637 Ga0501035_0008893 3300049822 Bacteria 9344
638 Ga0501035_0015787 3300049822 Bacteria 6971
639 Ga0501035_0234791 3300049822 Bacteria 1562
640 Ga0501044_0000389 3300049823 Bacteria 54483
641 Ga0501044_0000747 3300049823 Bacteria 39287
642 Ga0501044_0220241 3300049823 Bacteria 1848
643 Ga0501045_0006501 3300049824 Bacteria 8101
644 nmdc:mga05p37_366836_c1 3300050507 Bacteria 1691
645 nmdc:mga09592_121026_c1 3300050508 Bacteria 2248
646 nmdc:mga09592_507837_c1 3300050508 Bacteria 1037
647 nmdc:mga08y16_199488_c1 3300050511 Bacteria 2074
648 nmdc:mga08y16_20173_c1 3300050511 Bacteria 7034
649 nmdc:mga08y16_589314_c1 3300050511 Bacteria 1122
650 nmdc:mga08y16_760951_c1 3300050511 Bacteria 964
651 nmdc:mga0n895_1357379_c1 3300050512 Bacteria 680
652 nmdc:mga0n895_853969_c1 3300050512 Bacteria 898
653 nmdc:mga0rr50_1768315_c1 3300050513 Bacteria 520
654 nmdc:mga08x19_277008_c1 3300050514 Bacteria 1162
655 nmdc:mga08x19_665196_c1 3300050514 Bacteria 739
656 Ga0495595_0208123 3300053084 Bacteria 975
657 Ga0495619_0434586 3300053085 Bacteria 905
658 Ga0500556_0000690 3300053104 Bacteria 20756
659 Ga0500614_025617 3300053123 Bacteria 1404
660 Ga0500559_0055356 3300053136 Bacteria 1759
661 Ga0500577_0265469 3300053142 Bacteria 747
662 Ga0500590_096636 3300053148 Bacteria 1425
663 Ga0500633_0065316 3300053160 Bacteria 1289
664 Ga0500639_108651 3300053163 Bacteria 1353
665 Ga0587077_080226 3300059493 Bacteria 747
666 Ga0587080_045007 3300059503 Bacteria 816
667 Ga0501082_0750018 3300060353 Bacteria 854

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10316023 Ga0265338_103160233 90
2 3300012477 Ga0157336_1002805 Ga0157336_10028051 92
3 3300049569 Ga0501032_0358499 Ga0501032_0358499_236_553 93
4 3300049570 Ga0501033_0016663 Ga0501033_0016663_4136_4453 93
5 3300049573 Ga0501037_0157957 Ga0501037_0157957_1114_1431 93
6 3300049574 Ga0501038_0189573 Ga0501038_0189573_574_891 93
7 iso_pu_bacteria 2923525760 2923526650 101
8 3300005328 Ga0070676_10034458 Ga0070676_100344583 102
9 3300005328 Ga0070676_10105590 Ga0070676_101055903 102
10 3300005328 Ga0070676_10658917 Ga0070676_106589172 102
11 3300005328 Ga0070676_10995701 Ga0070676_109957011 102
12 3300005328 Ga0070676_11182769 Ga0070676_111827691 102
13 3300005330 Ga0070690_100219365 Ga0070690_1002193652 102
14 3300005331 Ga0070670_100516327 Ga0070670_1005163272 102
15 3300005331 Ga0070670_100889294 Ga0070670_1008892942 102
16 3300005331 Ga0070670_101099751 Ga0070670_1010997512 102
17 3300005333 Ga0070677_10195851 Ga0070677_101958512 102
18 3300005334 Ga0068869_100037989 Ga0068869_1000379894 102
19 3300005334 Ga0068869_101867977 Ga0068869_1018679771 102
20 3300005335 Ga0070666_10045917 Ga0070666_100459176 102
21 3300005338 Ga0068868_102204895 Ga0068868_1022048951 102
22 3300005340 Ga0070689_100022606 Ga0070689_1000226067 102
23 3300005347 Ga0070668_100117321 Ga0070668_1001173215 102
24 3300005347 Ga0070668_100581630 Ga0070668_1005816302 102
25 3300005353 Ga0070669_100038030 Ga0070669_1000380306 102
26 3300005354 Ga0070675_100011102 Ga0070675_1000111022 102
27 3300005354 Ga0070675_100078697 Ga0070675_1000786972 102
28 3300005354 Ga0070675_101850210 Ga0070675_1018502101 102
29 3300005355 Ga0070671_100046754 Ga0070671_1000467547 102
30 3300005355 Ga0070671_100231377 Ga0070671_1002313773 102
31 3300005355 Ga0070671_100385170 Ga0070671_1003851702 102
32 3300005356 Ga0070674_100096649 Ga0070674_1000966491 102
33 3300005356 Ga0070674_101365702 Ga0070674_1013657021 102
34 3300005356 Ga0070674_101582596 Ga0070674_1015825961 102
35 3300005364 Ga0070673_100034303 Ga0070673_1000343038 102
36 3300005364 Ga0070673_100231366 Ga0070673_1002313662 102
37 3300005364 Ga0070673_100873619 Ga0070673_1008736192 102
38 3300005367 Ga0070667_100022362 Ga0070667_1000223625 102
39 3300005367 Ga0070667_100163030 Ga0070667_1001630305 102
40 3300005367 Ga0070667_101539402 Ga0070667_1015394022 102
41 3300005438 Ga0070701_10058119 Ga0070701_100581192 102
42 3300005440 Ga0070705_100228096 Ga0070705_1002280962 102
43 3300005445 Ga0070708_100493044 Ga0070708_1004930442 102
44 3300005445 Ga0070708_100760858 Ga0070708_1007608582 102
45 3300005456 Ga0070678_100026422 Ga0070678_1000264223 102
46 3300005456 Ga0070678_100082508 Ga0070678_1000825082 102
47 3300005456 Ga0070678_100748794 Ga0070678_1007487941 102
48 3300005456 Ga0070678_102290273 Ga0070678_1022902732 102
49 3300005457 Ga0070662_100051713 Ga0070662_1000517132 102
50 3300005459 Ga0068867_100064867 Ga0068867_1000648672 102
51 3300005459 Ga0068867_100080644 Ga0068867_1000806443 102
52 3300005466 Ga0070685_10253476 Ga0070685_102534762 102
53 3300005466 Ga0070685_10652222 Ga0070685_106522222 102
54 3300005468 Ga0070707_101777180 Ga0070707_1017771802 102
55 3300005543 Ga0070672_100010859 Ga0070672_1000108599 102
56 3300005543 Ga0070672_100120388 Ga0070672_1001203882 102
57 3300005545 Ga0070695_100171036 Ga0070695_1001710363 102
58 3300005545 Ga0070695_100779311 Ga0070695_1007793111 102
59 3300005548 Ga0070665_101369850 Ga0070665_1013698502 102
60 3300005615 Ga0070702_100790184 Ga0070702_1007901842 102
61 3300005617 Ga0068859_100199443 Ga0068859_1001994435 102
62 3300005617 Ga0068859_100463388 Ga0068859_1004633883 102
63 3300005618 Ga0068864_100290440 Ga0068864_1002904402 102
64 3300005618 Ga0068864_100322728 Ga0068864_1003227282 102
65 3300005618 Ga0068864_100344967 Ga0068864_1003449672 102
66 3300005719 Ga0068861_100157835 Ga0068861_1001578352 102
67 3300005719 Ga0068861_100608985 Ga0068861_1006089852 102
68 3300005840 Ga0068870_10040752 Ga0068870_100407524 102
69 3300005841 Ga0068863_100208630 Ga0068863_1002086302 102
70 3300005841 Ga0068863_100397529 Ga0068863_1003975292 102
71 3300005841 Ga0068863_101085569 Ga0068863_1010855692 102
72 3300005843 Ga0068860_100039483 Ga0068860_1000394836 102
73 3300005843 Ga0068860_100048811 Ga0068860_1000488119 102
74 3300005843 Ga0068860_101701234 Ga0068860_1017012342 102
75 3300005844 Ga0068862_100170612 Ga0068862_1001706121 102
76 3300005985 Ga0081539_10016553 Ga0081539_100165538 102
77 3300006028 Ga0070717_12126724 Ga0070717_121267241 102
78 3300006237 Ga0097621_100272895 Ga0097621_1002728954 102
79 3300006237 Ga0097621_100529664 Ga0097621_1005296642 102
80 3300006844 Ga0075428_100136599 Ga0075428_1001365996 102
81 3300006871 Ga0075434_101390664 Ga0075434_1013906642 102
82 3300006881 Ga0068865_100047049 Ga0068865_1000470494 102
83 3300006914 Ga0075436_100833428 Ga0075436_1008334282 102
84 3300006931 Ga0097620_100199432 Ga0097620_1001994325 102
85 3300006931 Ga0097620_100463394 Ga0097620_1004633943 102
86 3300007076 Ga0075435_101078312 Ga0075435_1010783121 102
87 3300009098 Ga0105245_10972752 Ga0105245_109727522 102
88 3300009098 Ga0105245_12997962 Ga0105245_129979622 102
89 3300009148 Ga0105243_10356474 Ga0105243_103564743 102
90 3300009176 Ga0105242_10278392 Ga0105242_102783924 102
91 3300009177 Ga0105248_10210633 Ga0105248_102106333 102
92 3300009177 Ga0105248_11522987 Ga0105248_115229872 102
93 3300009177 Ga0105248_11726003 Ga0105248_117260031 102
94 3300009177 Ga0105248_12194369 Ga0105248_121943692 102
95 3300009553 Ga0105249_10269224 Ga0105249_102692244 102
96 3300009553 Ga0105249_12309106 Ga0105249_123091061 102
97 3300009553 Ga0105249_13240438 Ga0105249_132404382 102
98 3300012490 Ga0157322_1029736 Ga0157322_10297362 102
99 3300012503 Ga0157313_1050249 Ga0157313_10502492 102
100 3300012512 Ga0157327_1054108 Ga0157327_10541082 102
101 3300013297 Ga0157378_10081895 Ga0157378_100818956 102
102 3300013297 Ga0157378_10498122 Ga0157378_104981222 102
103 3300013297 Ga0157378_12682145 Ga0157378_126821451 102
104 3300013306 Ga0163162_10033165 Ga0163162_100331653 102
105 3300013306 Ga0163162_12303188 Ga0163162_123031881 102
106 3300013306 Ga0163162_12475083 Ga0163162_124750832 102
107 3300013308 Ga0157375_10026295 Ga0157375_1002629511 102
108 3300013308 Ga0157375_10102304 Ga0157375_101023045 102
109 3300013308 Ga0157375_10246674 Ga0157375_102466744 102
110 3300013308 Ga0157375_11497657 Ga0157375_114976572 102
111 3300014325 Ga0163163_11247530 Ga0163163_112475302 102
112 3300014325 Ga0163163_11946481 Ga0163163_119464812 102
113 3300014326 Ga0157380_10138399 Ga0157380_101383993 102
114 3300014326 Ga0157380_11536852 Ga0157380_115368522 102
115 3300014968 Ga0157379_11044175 Ga0157379_110441752 102
116 3300014969 Ga0157376_10036746 Ga0157376_100367463 102
117 3300014969 Ga0157376_10054404 Ga0157376_100544042 102
118 3300014969 Ga0157376_10693036 Ga0157376_106930361 102
119 3300017792 Ga0163161_10281396 Ga0163161_102813962 102
120 3300017792 Ga0163161_10592496 Ga0163161_105924962 102
121 3300021361 Ga0213872_10442081 Ga0213872_104420811 102
122 3300025315 Ga0207697_10126186 Ga0207697_101261862 102
123 3300025893 Ga0207682_10106639 Ga0207682_101066392 102
124 3300025899 Ga0207642_10073501 Ga0207642_100735013 102
125 3300025901 Ga0207688_10037377 Ga0207688_100373772 102
126 3300025903 Ga0207680_11034900 Ga0207680_110349002 102
127 3300025907 Ga0207645_10062943 Ga0207645_100629435 102
128 3300025907 Ga0207645_10172318 Ga0207645_101723182 102
129 3300025907 Ga0207645_10270048 Ga0207645_102700482 102
130 3300025907 Ga0207645_10358668 Ga0207645_103586682 102
131 3300025907 Ga0207645_10694587 Ga0207645_106945872 102
132 3300025908 Ga0207643_10007783 Ga0207643_1000778310 102
133 3300025918 Ga0207662_10599252 Ga0207662_105992522 102
134 3300025923 Ga0207681_10068266 Ga0207681_100682662 102
135 3300025923 Ga0207681_10664201 Ga0207681_106642012 102
136 3300025925 Ga0207650_10009448 Ga0207650_100094482 102
137 3300025925 Ga0207650_10017815 Ga0207650_100178153 102
138 3300025925 Ga0207650_10873769 Ga0207650_108737692 102
139 3300025926 Ga0207659_10267157 Ga0207659_102671574 102
140 3300025926 Ga0207659_11176435 Ga0207659_111764352 102
141 3300025926 Ga0207659_11318625 Ga0207659_113186252 102
142 3300025926 Ga0207659_11382301 Ga0207659_113823012 102
143 3300025931 Ga0207644_10076281 Ga0207644_100762816 102
144 3300025931 Ga0207644_10119393 Ga0207644_101193933 102
145 3300025931 Ga0207644_10154493 Ga0207644_101544933 102
146 3300025933 Ga0207706_10035361 Ga0207706_100353615 102
147 3300025933 Ga0207706_11085226 Ga0207706_110852262 102
148 3300025935 Ga0207709_11183660 Ga0207709_111836602 102
149 3300025936 Ga0207670_10207757 Ga0207670_102077573 102
150 3300025937 Ga0207669_10132217 Ga0207669_101322172 102
151 3300025937 Ga0207669_10132341 Ga0207669_101323412 102
152 3300025937 Ga0207669_10235381 Ga0207669_102353811 102
153 3300025938 Ga0207704_10115963 Ga0207704_101159635 102
154 3300025940 Ga0207691_10025524 Ga0207691_100255249 102
155 3300025940 Ga0207691_10045309 Ga0207691_100453096 102
156 3300025941 Ga0207711_10604944 Ga0207711_106049442 102
157 3300025941 Ga0207711_11456076 Ga0207711_114560762 102
158 3300025942 Ga0207689_10058818 Ga0207689_100588184 102
159 3300025942 Ga0207689_11393974 Ga0207689_113939742 102
160 3300025945 Ga0207679_10399474 Ga0207679_103994742 102
161 3300025945 Ga0207679_10428698 Ga0207679_104286982 102
162 3300025960 Ga0207651_10210875 Ga0207651_102108754 102
163 3300025960 Ga0207651_11349383 Ga0207651_113493832 102
164 3300025961 Ga0207712_10204524 Ga0207712_102045244 102
165 3300025961 Ga0207712_10875968 Ga0207712_108759682 102
166 3300025972 Ga0207668_10216740 Ga0207668_102167403 102
167 3300025972 Ga0207668_10472094 Ga0207668_104720942 102
168 3300025972 Ga0207668_11324917 Ga0207668_113249171 102
169 3300025972 Ga0207668_11460419 Ga0207668_114604192 102
170 3300025986 Ga0207658_10261512 Ga0207658_102615122 102
171 3300025986 Ga0207658_10719520 Ga0207658_107195202 102
172 3300025986 Ga0207658_10738490 Ga0207658_107384902 102
173 3300026023 Ga0207677_11193963 Ga0207677_111939632 102
174 3300026035 Ga0207703_10035587 Ga0207703_100355875 102
175 3300026075 Ga0207708_10214751 Ga0207708_102147514 102
176 3300026088 Ga0207641_10007438 Ga0207641_100074384 102
177 3300026088 Ga0207641_10055785 Ga0207641_100557857 102
178 3300026088 Ga0207641_10306595 Ga0207641_103065952 102
179 3300026088 Ga0207641_11511704 Ga0207641_115117042 102
180 3300026088 Ga0207641_12116010 Ga0207641_121160101 102
181 3300026089 Ga0207648_10005997 Ga0207648_1000599718 102
182 3300026089 Ga0207648_10538541 Ga0207648_105385411 102
183 3300026095 Ga0207676_10005874 Ga0207676_100058746 102
184 3300026095 Ga0207676_10080615 Ga0207676_100806152 102
185 3300026095 Ga0207676_10083154 Ga0207676_100831543 102
186 3300026095 Ga0207676_10852583 Ga0207676_108525832 102
187 3300026095 Ga0207676_10855268 Ga0207676_108552681 102
188 3300026118 Ga0207675_100020639 Ga0207675_1000206392 102
189 3300026118 Ga0207675_100166548 Ga0207675_1001665482 102
190 3300026118 Ga0207675_100458287 Ga0207675_1004582871 102
191 3300026118 Ga0207675_100538668 Ga0207675_1005386682 102
192 3300026121 Ga0207683_10080176 Ga0207683_100801765 102
193 3300026121 Ga0207683_10308643 Ga0207683_103086433 102
194 3300026121 Ga0207683_10831464 Ga0207683_108314642 102
195 3300028379 Ga0268266_10334088 Ga0268266_103340882 102
196 3300028379 Ga0268266_11719288 Ga0268266_117192881 102
197 3300028380 Ga0268265_10156946 Ga0268265_101569465 102
198 3300028381 Ga0268264_10221924 Ga0268264_102219243 102
199 3300028381 Ga0268264_10981412 Ga0268264_109814122 102
200 3300028381 Ga0268264_11008892 Ga0268264_110088922 102
201 3300028381 Ga0268264_12185674 Ga0268264_121856742 102
202 3300031235 Ga0265330_10004608 Ga0265330_1000460813 102
203 3300031238 Ga0265332_10001783 Ga0265332_1000178311 102
204 3300031250 Ga0265331_10000635 Ga0265331_1000063531 102
205 3300031251 Ga0265327_10031432 Ga0265327_100314325 102
206 3300031711 Ga0265314_10070955 Ga0265314_100709552 102
207 3300031712 Ga0265342_10445975 Ga0265342_104459751 102
208 3300032168 Ga0316593_10005257 Ga0316593_100052577 102
209 3300033529 Ga0316587_1012260 Ga0316587_10122602 102
210 3300035111 Ga0373923_0303929 Ga0373923_0303929_83_397 102
211 3300035114 Ga0373939_0062064 Ga0373939_0062064_227_541 102
212 3300035410 Ga0373924_0465545 Ga0373924_0465545_96_410 102
213 3300035692 Ga0373935_0131323 Ga0373935_0131323_1202_1516 102
214 3300035692 Ga0373935_0313334 Ga0373935_0313334_399_713 102
215 3300035724 Ga0373933_0068883 Ga0373933_0068883_186_500 102
216 3300035724 Ga0373933_0360221 Ga0373933_0360221_95_409 102
217 3300036401 Ga0373937_0054320 Ga0373937_0054320_2684_2998 102
218 3300037068 Ga0373925_0031180 Ga0373925_0031180_2865_3179 102
219 3300039447 Ga0436361_0020791 Ga0436361_0020791_163_477 102
220 3300041486 Ga0451807_2644321 Ga0451807_2644321_417_731 102
221 3300041501 Ga0451845_0449866 Ga0451845_0449866_108_422 102
222 3300041507 Ga0451851_1147119 Ga0451851_1147119_84_398 102
223 3300041512 Ga0451853_2627193 Ga0451853_2627193_184_498 102
224 3300046473 Ga0495582_0685849 Ga0495582_0685849_81_395 102
225 3300046511 Ga0495608_0894358 Ga0495608_0894358_23_337 102
226 3300046533 Ga0495640_0510207 Ga0495640_0510207_377_691 102
227 3300046684 Ga0495669_0182168 Ga0495669_0182168_211_525 102
228 3300046689 Ga0495613_0095378 Ga0495613_0095378_1592_1906 102
229 3300047315 Ga0495581_0237132 Ga0495581_0237132_671_985 102
230 3300047444 Ga0495675_0358107 Ga0495675_0358107_104_418 102
231 3300048904 Ga0496101_1554436 Ga0496101_1554436_73_387 102
232 3300048915 Ga0496112_0188174 Ga0496112_0188174_781_1095 102
233 3300050512 nmdc:mga0n895_853969_c1 nmdc:mga0n895_853969_c1_454_768 102
234 3300050513 nmdc:mga0rr50_1768315_c1 nmdc:mga0rr50_1768315_c1_100_414 102
235 3300050514 nmdc:mga08x19_665196_c1 nmdc:mga08x19_665196_c1_92_406 102
236 3300053084 Ga0495595_0208123 Ga0495595_0208123_316_630 102
237 3300053085 Ga0495619_0434586 Ga0495619_0434586_257_571 102
238 3300001976 JGI24752J21851_1005316 JGI24752J21851_10053162 103
239 3300002244 JGI24742J22300_10050452 JGI24742J22300_100504521 103
240 3300005327 Ga0070658_10770947 Ga0070658_107709472 103
241 3300005327 Ga0070658_10893930 Ga0070658_108939301 103
242 3300005327 Ga0070658_11239224 Ga0070658_112392242 103
243 3300005327 Ga0070658_12001909 Ga0070658_120019091 103
244 3300005328 Ga0070676_10084706 Ga0070676_100847064 103
245 3300005329 Ga0070683_100036912 Ga0070683_10003691210 103
246 3300005331 Ga0070670_100049275 Ga0070670_1000492754 103
247 3300005333 Ga0070677_10021939 Ga0070677_100219396 103
248 3300005334 Ga0068869_100683424 Ga0068869_1006834242 103
249 3300005335 Ga0070666_10183555 Ga0070666_101835551 103
250 3300005337 Ga0070682_100121457 Ga0070682_1001214572 103
251 3300005337 Ga0070682_100347010 Ga0070682_1003470101 103
252 3300005338 Ga0068868_100011188 Ga0068868_1000111882 103
253 3300005338 Ga0068868_100251645 Ga0068868_1002516453 103
254 3300005338 Ga0068868_100853365 Ga0068868_1008533651 103
255 3300005339 Ga0070660_101185422 Ga0070660_1011854222 103
256 3300005343 Ga0070687_101070546 Ga0070687_1010705462 103
257 3300005353 Ga0070669_100328397 Ga0070669_1003283972 103
258 3300005353 Ga0070669_100779756 Ga0070669_1007797562 103
259 3300005353 Ga0070669_101870626 Ga0070669_1018706261 103
260 3300005354 Ga0070675_100008825 Ga0070675_1000088255 103
261 3300005355 Ga0070671_100001413 Ga0070671_10000141318 103
262 3300005355 Ga0070671_100805762 Ga0070671_1008057622 103
263 3300005356 Ga0070674_100004652 Ga0070674_1000046522 103
264 3300005356 Ga0070674_100464815 Ga0070674_1004648152 103
265 3300005356 Ga0070674_100810729 Ga0070674_1008107292 103
266 3300005364 Ga0070673_100002406 Ga0070673_1000024064 103
267 3300005364 Ga0070673_100180192 Ga0070673_1001801922 103
268 3300005366 Ga0070659_100039243 Ga0070659_1000392437 103
269 3300005366 Ga0070659_100300462 Ga0070659_1003004622 103
270 3300005366 Ga0070659_100494235 Ga0070659_1004942352 103
271 3300005366 Ga0070659_100959345 Ga0070659_1009593451 103
272 3300005367 Ga0070667_100467584 Ga0070667_1004675842 103
273 3300005367 Ga0070667_101637638 Ga0070667_1016376381 103
274 3300005436 Ga0070713_100000028 Ga0070713_10000002824 103
275 3300005438 Ga0070701_10201334 Ga0070701_102013341 103
276 3300005439 Ga0070711_100200043 Ga0070711_1002000433 103
277 3300005441 Ga0070700_100204485 Ga0070700_1002044852 103
278 3300005455 Ga0070663_100066821 Ga0070663_1000668215 103
279 3300005456 Ga0070678_100000327 Ga0070678_10000032717 103
280 3300005456 Ga0070678_100087735 Ga0070678_1000877353 103
281 3300005457 Ga0070662_100174375 Ga0070662_1001743752 103
282 3300005457 Ga0070662_100763180 Ga0070662_1007631801 103
283 3300005457 Ga0070662_101790447 Ga0070662_1017904471 103
284 3300005459 Ga0068867_100091112 Ga0068867_1000911125 103
285 3300005467 Ga0070706_101248200 Ga0070706_1012482002 103
286 3300005535 Ga0070684_100311540 Ga0070684_1003115403 103
287 3300005536 Ga0070697_101101688 Ga0070697_1011016882 103
288 3300005539 Ga0068853_100185586 Ga0068853_1001855865 103
289 3300005543 Ga0070672_100003635 Ga0070672_1000036359 103
290 3300005548 Ga0070665_100128413 Ga0070665_1001284137 103
291 3300005548 Ga0070665_101540743 Ga0070665_1015407431 103
292 3300005549 Ga0070704_101561729 Ga0070704_1015617291 103
293 3300005564 Ga0070664_100879929 Ga0070664_1008799292 103
294 3300005578 Ga0068854_100083412 Ga0068854_1000834126 103
295 3300005614 Ga0068856_100044462 Ga0068856_1000444629 103
296 3300005615 Ga0070702_100564960 Ga0070702_1005649601 103
297 3300005616 Ga0068852_100023109 Ga0068852_1000231099 103
298 3300005618 Ga0068864_100052938 Ga0068864_1000529386 103
299 3300005718 Ga0068866_10051071 Ga0068866_100510712 103
300 3300005718 Ga0068866_10738790 Ga0068866_107387902 103
301 3300005719 Ga0068861_101822766 Ga0068861_1018227662 103
302 3300005834 Ga0068851_10024902 Ga0068851_100249024 103
303 3300005840 Ga0068870_10699873 Ga0068870_106998732 103
304 3300005842 Ga0068858_101795771 Ga0068858_1017957712 103
305 3300005844 Ga0068862_101241347 Ga0068862_1012413471 103
306 3300006028 Ga0070717_10728593 Ga0070717_107285932 103
307 3300006175 Ga0070712_100681582 Ga0070712_1006815822 103
308 3300006237 Ga0097621_100043697 Ga0097621_1000436975 103
309 3300006358 Ga0068871_100013379 Ga0068871_1000133792 103
310 3300006358 Ga0068871_101440804 Ga0068871_1014408041 103
311 3300006844 Ga0075428_100005627 Ga0075428_10000562716 103
312 3300006844 Ga0075428_101080657 Ga0075428_1010806572 103
313 3300006871 Ga0075434_100745595 Ga0075434_1007455952 103
314 3300006880 Ga0075429_100176353 Ga0075429_1001763534 103
315 3300006881 Ga0068865_100027334 Ga0068865_1000273347 103
316 3300006881 Ga0068865_100121180 Ga0068865_1001211805 103
317 3300006881 Ga0068865_100406520 Ga0068865_1004065202 103
318 3300006914 Ga0075436_100297688 Ga0075436_1002976882 103
319 3300007076 Ga0075435_101315975 Ga0075435_1013159752 103
320 3300009093 Ga0105240_10290716 Ga0105240_102907165 103
321 3300009094 Ga0111539_10029410 Ga0111539_100294107 103
322 3300009094 Ga0111539_10100124 Ga0111539_101001247 103
323 3300009094 Ga0111539_10104296 Ga0111539_101042967 103
324 3300009094 Ga0111539_11069052 Ga0111539_110690522 103
325 3300009098 Ga0105245_11817138 Ga0105245_118171381 103
326 3300009101 Ga0105247_10424377 Ga0105247_104243772 103
327 3300009147 Ga0114129_10149274 Ga0114129_101492743 103
328 3300009174 Ga0105241_10900004 Ga0105241_109000042 103
329 3300009177 Ga0105248_11942552 Ga0105248_119425522 103
330 3300010375 Ga0105239_11152857 Ga0105239_111528572 103
331 3300010375 Ga0105239_12159720 Ga0105239_121597202 103
332 3300011119 Ga0105246_10225680 Ga0105246_102256802 103
333 3300011119 Ga0105246_11055879 Ga0105246_110558792 103
334 3300013100 Ga0157373_10063367 Ga0157373_100633675 103
335 3300013102 Ga0157371_10665099 Ga0157371_106650992 103
336 3300013104 Ga0157370_10003375 Ga0157370_1000337514 103
337 3300013296 Ga0157374_10063292 Ga0157374_100632925 103
338 3300013296 Ga0157374_10107792 Ga0157374_101077922 103
339 3300013297 Ga0157378_10007984 Ga0157378_1000798414 103
340 3300013297 Ga0157378_10290591 Ga0157378_102905912 103
341 3300013306 Ga0163162_10138948 Ga0163162_101389484 103
342 3300013306 Ga0163162_10590148 Ga0163162_105901482 103
343 3300013306 Ga0163162_11067585 Ga0163162_110675851 103
344 3300013307 Ga0157372_11017425 Ga0157372_110174252 103
345 3300013308 Ga0157375_10047239 Ga0157375_100472396 103
346 3300013308 Ga0157375_10325009 Ga0157375_103250093 103
347 3300013308 Ga0157375_10544768 Ga0157375_105447681 103
348 3300013308 Ga0157375_10815642 Ga0157375_108156423 103
349 3300014325 Ga0163163_10151059 Ga0163163_101510596 103
350 3300014325 Ga0163163_10982743 Ga0163163_109827432 103
351 3300014497 Ga0182008_10130948 Ga0182008_101309481 103
352 3300014497 Ga0182008_10170693 Ga0182008_101706932 103
353 3300014745 Ga0157377_10450121 Ga0157377_104501212 103
354 3300014969 Ga0157376_10068236 Ga0157376_100682363 103
355 3300014969 Ga0157376_10751400 Ga0157376_107514002 103
356 3300017792 Ga0163161_10223293 Ga0163161_102232933 103
357 3300021361 Ga0213872_10101361 Ga0213872_101013612 103
358 3300021377 Ga0213874_10144534 Ga0213874_101445342 103
359 3300025899 Ga0207642_10081084 Ga0207642_100810842 103
360 3300025899 Ga0207642_10487852 Ga0207642_104878522 103
361 3300025903 Ga0207680_10642314 Ga0207680_106423142 103
362 3300025907 Ga0207645_10202414 Ga0207645_102024142 103
363 3300025909 Ga0207705_10962720 Ga0207705_109627202 103
364 3300025915 Ga0207693_10616275 Ga0207693_106162752 103
365 3300025916 Ga0207663_10251465 Ga0207663_102514652 103
366 3300025918 Ga0207662_10493800 Ga0207662_104938002 103
367 3300025923 Ga0207681_10637239 Ga0207681_106372392 103
368 3300025925 Ga0207650_10004274 Ga0207650_1000427410 103
369 3300025926 Ga0207659_10327483 Ga0207659_103274832 103
370 3300025929 Ga0207664_10736803 Ga0207664_107368031 103
371 3300025931 Ga0207644_10000883 Ga0207644_1000088327 103
372 3300025932 Ga0207690_10047030 Ga0207690_100470303 103
373 3300025932 Ga0207690_10265741 Ga0207690_102657412 103
374 3300025932 Ga0207690_10513488 Ga0207690_105134882 103
375 3300025932 Ga0207690_10840035 Ga0207690_108400352 103
376 3300025933 Ga0207706_10089111 Ga0207706_100891113 103
377 3300025933 Ga0207706_10271395 Ga0207706_102713952 103
378 3300025933 Ga0207706_10503242 Ga0207706_105032422 103
379 3300025933 Ga0207706_10530772 Ga0207706_105307722 103
380 3300025933 Ga0207706_10743033 Ga0207706_107430332 103
381 3300025934 Ga0207686_11266190 Ga0207686_112661902 103
382 3300025937 Ga0207669_11239385 Ga0207669_112393851 103
383 3300025938 Ga0207704_10282747 Ga0207704_102827473 103
384 3300025938 Ga0207704_10708738 Ga0207704_107087382 103
385 3300025940 Ga0207691_10006216 Ga0207691_1000621614 103
386 3300025942 Ga0207689_10237998 Ga0207689_102379982 103
387 3300025942 Ga0207689_10559590 Ga0207689_105595902 103
388 3300025944 Ga0207661_10609477 Ga0207661_106094772 103
389 3300025945 Ga0207679_10110578 Ga0207679_101105785 103
390 3300025960 Ga0207651_11424838 Ga0207651_114248382 103
391 3300025981 Ga0207640_10004152 Ga0207640_100041526 103
392 3300025986 Ga0207658_10447524 Ga0207658_104475243 103
393 3300026023 Ga0207677_10003662 Ga0207677_100036626 103
394 3300026023 Ga0207677_10270077 Ga0207677_102700772 103
395 3300026035 Ga0207703_10647877 Ga0207703_106478771 103
396 3300026035 Ga0207703_11225635 Ga0207703_112256352 103
397 3300026041 Ga0207639_10397612 Ga0207639_103976122 103
398 3300026067 Ga0207678_10356050 Ga0207678_103560502 103
399 3300026075 Ga0207708_10174199 Ga0207708_101741992 103
400 3300026078 Ga0207702_10074732 Ga0207702_100747322 103
401 3300026089 Ga0207648_10154153 Ga0207648_101541531 103
402 3300026095 Ga0207676_10210305 Ga0207676_102103054 103
403 3300026118 Ga0207675_101898458 Ga0207675_1018984582 103
404 3300026121 Ga0207683_10001392 Ga0207683_1000139224 103
405 3300026121 Ga0207683_10025934 Ga0207683_100259349 103
406 3300026142 Ga0207698_10035123 Ga0207698_100351232 103
407 3300027876 Ga0209974_10010320 Ga0209974_100103205 103
408 3300027876 Ga0209974_10113611 Ga0209974_101136112 103
409 3300027907 Ga0207428_10008889 Ga0207428_1000888910 103
410 3300027907 Ga0207428_10177011 Ga0207428_101770112 103
411 3300028379 Ga0268266_10853193 Ga0268266_108531932 103
412 3300031238 Ga0265332_10193672 Ga0265332_101936722 103
413 3300031247 Ga0265340_10020617 Ga0265340_100206176 103
414 3300031548 Ga0307408_100525650 Ga0307408_1005256501 103
415 3300031665 Ga0316575_10001575 Ga0316575_100015752 103
416 3300031911 Ga0307412_10348371 Ga0307412_103483713 103
417 3300032002 Ga0307416_100230420 Ga0307416_1002304206 103
418 3300032005 Ga0307411_11042489 Ga0307411_110424892 103
419 3300032168 Ga0316593_10000049 Ga0316593_1000004915 103
420 3300032168 Ga0316593_10000058 Ga0316593_1000005815 103
421 3300032168 Ga0316593_10005293 Ga0316593_100052939 103
422 3300032168 Ga0316593_10010662 Ga0316593_100106622 103
423 3300032168 Ga0316593_10020416 Ga0316593_100204163 103
424 3300032168 Ga0316593_10100138 Ga0316593_101001382 103
425 3300032168 Ga0316593_10111466 Ga0316593_101114662 103
426 3300033524 Ga0316592_1051470 Ga0316592_10514702 103
427 3300033528 Ga0316588_1018137 Ga0316588_10181372 103
428 3300033528 Ga0316588_1131490 Ga0316588_11314901 103
429 3300033529 Ga0316587_1000182 Ga0316587_10001822 103
430 3300033529 Ga0316587_1015548 Ga0316587_10155482 103
431 3300033529 Ga0316587_1108024 Ga0316587_11080241 103
432 3300033541 Ga0316596_1000880 Ga0316596_10008805 103
433 3300033541 Ga0316596_1026187 Ga0316596_10261873 103
434 3300035114 Ga0373939_0403737 Ga0373939_0403737_42_359 103
435 3300035691 Ga0373931_0552599 Ga0373931_0552599_16_333 103
436 3300037418 Ga0395900_0046031 Ga0395900_0046031_538_855 103
437 3300038443 Ga0395901_0220488 Ga0395901_0220488_390_707 103
438 3300038443 Ga0395901_0364811 Ga0395901_0364811_951_1268 103
439 3300039447 Ga0436361_0015574 Ga0436361_0015574_430_747 103
440 3300039450 Ga0436363_0712517 Ga0436363_0712517_379_696 103
441 3300041407 Ga0439447_168955 Ga0439447_168955_66_383 103
442 3300041507 Ga0451851_0752822 Ga0451851_0752822_198_515 103
443 3300041512 Ga0451853_3854955 Ga0451853_3854955_126_443 103
444 3300042436 Ga0439435_0010142 Ga0439435_0010142_1714_2031 103
445 3300042461 Ga0439460_0125495 Ga0439460_0125495_397_714 103
446 3300042530 Ga0450916_039082 Ga0450916_039082_178_495 103
447 3300045051 Ga0451576_0077585 Ga0451576_0077585_1461_1778 103
448 3300047318 Ga0495636_0371815 Ga0495636_0371815_244_561 103
449 3300048903 Ga0496100_0064332 Ga0496100_0064332_1687_2004 103
450 3300048904 Ga0496101_0749609 Ga0496101_0749609_202_519 103
451 3300048904 Ga0496101_1359051 Ga0496101_1359051_136_453 103
452 3300048905 Ga0496102_0218206 Ga0496102_0218206_1428_1745 103
453 3300048907 Ga0496104_0290043 Ga0496104_0290043_852_1169 103
454 3300048909 Ga0496106_0530886 Ga0496106_0530886_91_408 103
455 3300048910 Ga0496107_0444656 Ga0496107_0444656_476_793 103
456 3300048910 Ga0496107_0663132 Ga0496107_0663132_96_413 103
457 3300048911 Ga0496108_0051456 Ga0496108_0051456_715_1032 103
458 3300048911 Ga0496108_0409111 Ga0496108_0409111_205_522 103
459 3300048911 Ga0496108_0812471 Ga0496108_0812471_217_534 103
460 3300048911 Ga0496108_1233528 Ga0496108_1233528_35_352 103
461 3300048912 Ga0496109_0001894 Ga0496109_0001894_16490_16807 103
462 3300048912 Ga0496109_0128868 Ga0496109_0128868_1071_1388 103
463 3300048912 Ga0496109_1784286 Ga0496109_1784286_211_528 103
464 3300048913 Ga0496110_0012098 Ga0496110_0012098_3500_3817 103
465 3300048915 Ga0496112_1043092 Ga0496112_1043092_177_494 103
466 3300048916 Ga0496113_0227897 Ga0496113_0227897_861_1178 103
467 3300048917 Ga0496114_0005126 Ga0496114_0005126_1429_1746 103
468 3300048918 Ga0496115_0761495 Ga0496115_0761495_166_483 103
469 3300048918 Ga0496115_0798008 Ga0496115_0798008_244_561 103
470 3300049568 Ga0501031_0003260 Ga0501031_0003260_3933_4250 103
471 3300049568 Ga0501031_0009677 Ga0501031_0009677_4745_5062 103
472 3300049569 Ga0501032_0000036 Ga0501032_0000036_104587_104904 103
473 3300049569 Ga0501032_0023103 Ga0501032_0023103_183_500 103
474 3300049569 Ga0501032_0028750 Ga0501032_0028750_3107_3424 103
475 3300049569 Ga0501032_1036574 Ga0501032_1036574_58_375 103
476 3300049570 Ga0501033_0001817 Ga0501033_0001817_6182_6499 103
477 3300049570 Ga0501033_0003966 Ga0501033_0003966_4686_5003 103
478 3300049571 Ga0501034_0003361 Ga0501034_0003361_6182_6499 103
479 3300049571 Ga0501034_0017280 Ga0501034_0017280_2697_3014 103
480 3300049571 Ga0501034_0417785 Ga0501034_0417785_369_686 103
481 3300049572 Ga0501036_0000512 Ga0501036_0000512_26397_26714 103
482 3300049572 Ga0501036_0001490 Ga0501036_0001490_8692_9009 103
483 3300049572 Ga0501036_0002120 Ga0501036_0002120_6179_6496 103
484 3300049573 Ga0501037_0001263 Ga0501037_0001263_12141_12458 103
485 3300049573 Ga0501037_0379343 Ga0501037_0379343_52_369 103
486 3300049573 Ga0501037_0701742 Ga0501037_0701742_219_536 103
487 3300049574 Ga0501038_0003243 Ga0501038_0003243_12141_12458 103
488 3300049574 Ga0501038_0004836 Ga0501038_0004836_11874_12191 103
489 3300049574 Ga0501038_0055092 Ga0501038_0055092_30_347 103
490 3300049574 Ga0501038_0413062 Ga0501038_0413062_219_533 103
491 3300049575 Ga0501039_0011968 Ga0501039_0011968_2477_2794 103
492 3300049576 Ga0501040_0000218 Ga0501040_0000218_24993_25310 103
493 3300049578 Ga0501042_0000031 Ga0501042_0000031_12429_12746 103
494 3300049579 Ga0501043_0000157 Ga0501043_0000157_49733_50050 103
495 3300049579 Ga0501043_0006833 Ga0501043_0006833_6184_6501 103
496 3300049579 Ga0501043_0016645 Ga0501043_0016645_1125_1442 103
497 3300049579 Ga0501043_0373052 Ga0501043_0373052_290_607 103
498 3300049580 Ga0501046_0002577 Ga0501046_0002577_6161_6478 103
499 3300049580 Ga0501046_0004484 Ga0501046_0004484_6297_6614 103
500 3300049580 Ga0501046_0309239 Ga0501046_0309239_37_354 103
501 3300049581 Ga0501047_0002207 Ga0501047_0002207_12141_12458 103
502 3300049582 Ga0501048_0002716 Ga0501048_0002716_12112_12429 103
503 3300049584 Ga0501068_0001608 Ga0501068_0001608_7487_7804 103
504 3300049584 Ga0501068_0004846 Ga0501068_0004846_5757_6074 103
505 3300049585 Ga0501069_0258868 Ga0501069_0258868_118_435 103
506 3300049586 Ga0501070_0090993 Ga0501070_0090993_400_717 103
507 3300049589 Ga0501073_0048394 Ga0501073_0048394_930_1247 103
508 3300049590 Ga0501074_0060457 Ga0501074_0060457_2200_2517 103
509 3300049593 Ga0501077_0131618 Ga0501077_0131618_1094_1411 103
510 3300049655 Ga0501208_070567 Ga0501208_070567_137_454 103
511 3300049677 Ga0501247_032709 Ga0501247_032709_167_484 103
512 3300049677 Ga0501247_037686 Ga0501247_037686_320_637 103
513 3300049742 Ga0501080_0206492 Ga0501080_0206492_232_549 103
514 3300049744 Ga0501083_0031483 Ga0501083_0031483_121_438 103
515 3300049769 Ga0501272_065513 Ga0501272_065513_158_475 103
516 3300049822 Ga0501035_0000671 Ga0501035_0000671_12225_12542 103
517 3300049822 Ga0501035_0008893 Ga0501035_0008893_6182_6499 103
518 3300049822 Ga0501035_0015787 Ga0501035_0015787_6210_6527 103
519 3300049822 Ga0501035_0234791 Ga0501035_0234791_1107_1424 103
520 3300049823 Ga0501044_0000389 Ga0501044_0000389_6143_6460 103
521 3300049823 Ga0501044_0000747 Ga0501044_0000747_28365_28682 103
522 3300049823 Ga0501044_0220241 Ga0501044_0220241_1253_1570 103
523 3300049824 Ga0501045_0006501 Ga0501045_0006501_6182_6499 103
524 3300050507 nmdc:mga05p37_366836_c1 nmdc:mga05p37_366836_c1_638_955 103
525 3300050508 nmdc:mga09592_121026_c1 nmdc:mga09592_121026_c1_1436_1753 103
526 3300050508 nmdc:mga09592_507837_c1 nmdc:mga09592_507837_c1_466_783 103
527 3300050511 nmdc:mga08y16_199488_c1 nmdc:mga08y16_199488_c1_1616_1933 103
528 3300050511 nmdc:mga08y16_20173_c1 nmdc:mga08y16_20173_c1_780_1097 103
529 3300050511 nmdc:mga08y16_589314_c1 nmdc:mga08y16_589314_c1_225_542 103
530 3300050511 nmdc:mga08y16_760951_c1 nmdc:mga08y16_760951_c1_608_925 103
531 3300050512 nmdc:mga0n895_1357379_c1 nmdc:mga0n895_1357379_c1_211_528 103
532 3300050514 nmdc:mga08x19_277008_c1 nmdc:mga08x19_277008_c1_61_378 103
533 3300053104 Ga0500556_0000690 Ga0500556_0000690_17372_17689 103
534 3300060353 Ga0501082_0750018 Ga0501082_0750018_292_609 103
535 3300003316 rootH1_10004661 rootH1_100046611 104
536 3300003322 rootL2_10064042 rootL2_100640423 104
537 3300003323 rootH1_10087917 rootH1_100879174 104
538 3300005330 Ga0070690_100573051 Ga0070690_1005730512 104
539 3300005331 Ga0070670_100693150 Ga0070670_1006931502 104
540 3300005337 Ga0070682_100782150 Ga0070682_1007821501 104
541 3300005338 Ga0068868_100755715 Ga0068868_1007557152 104
542 3300005339 Ga0070660_100650359 Ga0070660_1006503591 104
543 3300005344 Ga0070661_100290407 Ga0070661_1002904072 104
544 3300005355 Ga0070671_100043910 Ga0070671_1000439106 104
545 3300005364 Ga0070673_101526794 Ga0070673_1015267942 104
546 3300005365 Ga0070688_100776035 Ga0070688_1007760351 104
547 3300005367 Ga0070667_100086170 Ga0070667_1000861706 104
548 3300005455 Ga0070663_100098843 Ga0070663_1000988435 104
549 3300005458 Ga0070681_10375418 Ga0070681_103754181 104
550 3300005535 Ga0070684_100128821 Ga0070684_1001288212 104
551 3300005539 Ga0068853_100379103 Ga0068853_1003791031 104
552 3300005547 Ga0070693_100221817 Ga0070693_1002218172 104
553 3300005548 Ga0070665_100096850 Ga0070665_1000968506 104
554 3300005563 Ga0068855_100114994 Ga0068855_1001149943 104
555 3300005564 Ga0070664_101158090 Ga0070664_1011580902 104
556 3300005577 Ga0068857_100323763 Ga0068857_1003237632 104
557 3300005578 Ga0068854_100243308 Ga0068854_1002433082 104
558 3300005614 Ga0068856_100042931 Ga0068856_1000429312 104
559 3300005616 Ga0068852_100172880 Ga0068852_1001728803 104
560 3300005617 Ga0068859_100092729 Ga0068859_1000927293 104
561 3300005618 Ga0068864_100090413 Ga0068864_1000904133 104
562 3300005834 Ga0068851_10038354 Ga0068851_100383542 104
563 3300005841 Ga0068863_100154561 Ga0068863_1001545612 104
564 3300005842 Ga0068858_100004270 Ga0068858_10000427012 104
565 3300005843 Ga0068860_100006244 Ga0068860_1000062446 104
566 3300005844 Ga0068862_100065242 Ga0068862_1000652424 104
567 3300005937 Ga0081455_10210306 Ga0081455_102103064 104
568 3300006237 Ga0097621_100122525 Ga0097621_1001225255 104
569 3300006931 Ga0097620_100092731 Ga0097620_1000927313 104
570 3300009093 Ga0105240_10075753 Ga0105240_100757534 104
571 3300009093 Ga0105240_12390537 Ga0105240_123905371 104
572 3300009101 Ga0105247_10025648 Ga0105247_100256485 104
573 3300009174 Ga0105241_11711304 Ga0105241_117113042 104
574 3300009177 Ga0105248_10102257 Ga0105248_101022577 104
575 3300009545 Ga0105237_10114912 Ga0105237_101149123 104
576 3300009545 Ga0105237_10354686 Ga0105237_103546864 104
577 3300009553 Ga0105249_10280371 Ga0105249_102803712 104
578 3300010375 Ga0105239_11516979 Ga0105239_115169792 104
579 3300013100 Ga0157373_11053222 Ga0157373_110532221 104
580 3300013105 Ga0157369_11122405 Ga0157369_111224052 104
581 3300013306 Ga0163162_10121002 Ga0163162_101210026 104
582 3300013307 Ga0157372_10049576 Ga0157372_100495764 104
583 3300013308 Ga0157375_11813563 Ga0157375_118135632 104
584 3300014325 Ga0163163_10381617 Ga0163163_103816172 104
585 3300014968 Ga0157379_10267841 Ga0157379_102678412 104
586 3300014969 Ga0157376_10982462 Ga0157376_109824623 104
587 3300025321 Ga0207656_10027958 Ga0207656_100279582 104
588 3300025900 Ga0207710_10009562 Ga0207710_1000956210 104
589 3300025904 Ga0207647_10327037 Ga0207647_103270372 104
590 3300025911 Ga0207654_10062727 Ga0207654_100627275 104
591 3300025913 Ga0207695_10083172 Ga0207695_100831726 104
592 3300025914 Ga0207671_10157809 Ga0207671_101578093 104
593 3300025914 Ga0207671_10201922 Ga0207671_102019224 104
594 3300025919 Ga0207657_10331237 Ga0207657_103312372 104
595 3300025925 Ga0207650_10018767 Ga0207650_100187674 104
596 3300025928 Ga0207700_11716352 Ga0207700_117163521 104
597 3300025931 Ga0207644_10179249 Ga0207644_101792492 104
598 3300025941 Ga0207711_10095839 Ga0207711_100958392 104
599 3300025945 Ga0207679_10901310 Ga0207679_109013102 104
600 3300025961 Ga0207712_11214831 Ga0207712_112148312 104
601 3300025981 Ga0207640_10325567 Ga0207640_103255673 104
602 3300025986 Ga0207658_10041770 Ga0207658_100417707 104
603 3300026023 Ga0207677_10206872 Ga0207677_102068722 104
604 3300026035 Ga0207703_10019203 Ga0207703_100192036 104
605 3300026067 Ga0207678_10005556 Ga0207678_100055565 104
606 3300026078 Ga0207702_10128657 Ga0207702_101286575 104
607 3300026088 Ga0207641_10002325 Ga0207641_1000232514 104
608 3300026095 Ga0207676_10833089 Ga0207676_108330892 104
609 3300026116 Ga0207674_10415385 Ga0207674_104153854 104
610 3300026118 Ga0207675_101342193 Ga0207675_1013421931 104
611 3300026142 Ga0207698_10091691 Ga0207698_100916914 104
612 3300028379 Ga0268266_10010307 Ga0268266_100103072 104
613 3300028379 Ga0268266_10022673 Ga0268266_100226732 104
614 3300028380 Ga0268265_10056316 Ga0268265_100563166 104
615 3300028381 Ga0268264_10000102 Ga0268264_1000010214 104
616 3300030521 Ga0307511_10056308 Ga0307511_100563085 104
617 3300033180 Ga0307510_10000006 Ga0307510_10000006345 104
618 3300033180 Ga0307510_10029950 Ga0307510_100299506 104
619 3300035691 Ga0373931_0715389 Ga0373931_0715389_303_623 104
620 3300037471 Ga0395905_0307437 Ga0395905_0307437_841_1161 104
621 3300039437 Ga0436365_1843324 Ga0436365_1843324_338_658 104
622 3300046507 Ga0495606_0121911 Ga0495606_0121911_1042_1362 104
623 3300046519 Ga0495632_0032155 Ga0495632_0032155_565_885 104
624 3300046522 Ga0495643_0036660 Ga0495643_0036660_2230_2550 104
625 3300046522 Ga0495643_0245094 Ga0495643_0245094_431_751 104
626 3300046524 Ga0495648_0038970 Ga0495648_0038970_940_1260 104
627 3300046538 Ga0495609_0236791 Ga0495609_0236791_40_360 104
628 3300046616 Ga0495668_0105281 Ga0495668_0105281_18_338 104
629 3300046660 Ga0495625_0316795 Ga0495625_0316795_246_566 104
630 3300046694 Ga0495649_0300158 Ga0495649_0300158_297_617 104
631 3300047323 Ga0495683_0468386 Ga0495683_0468386_40_360 104
632 3300047443 Ga0495687_029441 Ga0495687_029441_337_657 104
633 3300047443 Ga0495687_032507 Ga0495687_032507_1747_2067 104
634 3300047472 Ga0495686_0591316 Ga0495686_0591316_105_425 104
635 3300048903 Ga0496100_0110723 Ga0496100_0110723_1539_1859 104
636 3300048905 Ga0496102_0003295 Ga0496102_0003295_13180_13500 104
637 3300048906 Ga0496103_0040660 Ga0496103_0040660_1814_2134 104
638 3300048908 Ga0496105_0562661 Ga0496105_0562661_106_426 104
639 3300048911 Ga0496108_0168503 Ga0496108_0168503_301_621 104
640 3300048915 Ga0496112_1636177 Ga0496112_1636177_201_521 104
641 3300048916 Ga0496113_0189425 Ga0496113_0189425_629_949 104
642 3300048917 Ga0496114_0051718 Ga0496114_0051718_565_885 104
643 3300048918 Ga0496115_0071247 Ga0496115_0071247_2472_2792 104
644 3300048920 Ga0496117_0000787 Ga0496117_0000787_20313_20633 104
645 3300048921 Ga0496118_0000032 Ga0496118_0000032_238921_239241 104
646 3300048922 Ga0496119_0055285 Ga0496119_0055285_1518_1838 104
647 3300048922 Ga0496119_0116851 Ga0496119_0116851_485_805 104
648 3300048923 Ga0496120_0036388 Ga0496120_0036388_530_850 104
649 3300048923 Ga0496120_0151997 Ga0496120_0151997_667_987 104
650 3300048924 Ga0496121_0028362 Ga0496121_0028362_4191_4511 104
651 3300048924 Ga0496121_0113839 Ga0496121_0113839_510_830 104
652 3300048927 Ga0496124_0006228 Ga0496124_0006228_2962_3282 104
653 3300048928 Ga0496125_0001378 Ga0496125_0001378_6200_6520 104
654 3300048929 Ga0496126_0011396 Ga0496126_0011396_6106_6426 104
655 3300049460 Ga0495682_0171445 Ga0495682_0171445_137_457 104
656 3300053123 Ga0500614_025617 Ga0500614_025617_335_655 104
657 3300053136 Ga0500559_0055356 Ga0500559_0055356_729_1049 104
658 3300053142 Ga0500577_0265469 Ga0500577_0265469_361_681 104
659 3300053148 Ga0500590_096636 Ga0500590_096636_599_919 104
660 3300053160 Ga0500633_0065316 Ga0500633_0065316_151_471 104
661 3300053163 Ga0500639_108651 Ga0500639_108651_212_532 104
662 3300059493 Ga0587077_080226 Ga0587077_080226_28_348 104
663 3300059503 Ga0587080_045007 Ga0587080_045007_390_710 104
664 2010549000 RicEn_FSXC79173_b1 RicEn_573190 105
665 3300005289 Ga0065704_10146981 Ga0065704_101469814 105
666 3300023309 Ga0256744_112018 Ga0256744_1120182 105
667 3300041461 Ga0451805_115470 Ga0451805_115470_180_497 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

37

107

0.9

PF00467

KOW

KOW motif

6

35

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zq6-assembly1.cif.gz_u 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain 0.9447 2 104
8cgd-assembly1.cif.gz_t clindamycin bound to the 50s subunit 0.9408 2 104
7zq6-assembly1.cif.gz_u 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain 0.9349 2 104
8cgk-assembly1.cif.gz_t lincomycin and avilamycin bound to the 50s subunit 0.9343 2 104
8cgd-assembly1.cif.gz_t clindamycin bound to the 50s subunit 0.9311 2 104
ID Description Score Start End Superfamily
af_C6KSP8_36_136_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8961 2 101 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8819 2 102 2.30.30.30
af_Q96A35_47_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8614 5 102 2.30.30.30
af_P91353_98_211_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8495 1 101 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8427 2 102 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A328R4V1-F1-model_v4 deleted 0.9324 2 104
AF-A0A328R4V1-F1-model_v4 deleted 0.9237 2 104
AF-A0A6S6RQV6-F1-model_v4 Large ribosomal subunit protein uL24 0.9088 2 105 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2H0SJS4-F1-model_v4 Large ribosomal subunit protein uL24 0.9077 3 105 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3G2R041-F1-model_v4 50S ribosomal protein L24, chloroplastic 0.9052 5 104 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:0009507
GO:1990904

Feature Viewer

pLDDT pTM Quality
88.73 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map