F473817

General Info

Members Datasets Scaffolds Average Seq Length
667 334 1334 205

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100136915|Ga0068868_1001369152
Length 237
Sequence VHRGHLSAGSGARLVVRRARPAEVGRAVVRCCPAVLFYEPHLRDTSLLPHDPFKAAIAPRPIGWVSTLSADGAVNLAPYSFFNAVSGAPPMIAFSSEGMKDSASFALQTREFVWNMPTWDLREAMNTTSAPLRRGANEFDHAGLEMAPSRMVEPPRVAASPCALECKVTETLTLSDLDGNATDRHLVIGQVVGVHLDERFIRDDGILDVAAMRPIARCGYTSDYTVLERLFQMERPR

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
105 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
170 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
171 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
172 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
173 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
195 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
268 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
284 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
285 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
286 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
287 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
288 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
295 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
298 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
299 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
300 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
301 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
304 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
305 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
308 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
314 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
317 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
318 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
319 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
320 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
321 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
322 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
323 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
324 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
325 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
326 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
327 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
328 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
331 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
332 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
333 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
334 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.35
Nodule 0
Rhizoplane 12.74
Rhizosphere 75.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100136915 3300005338 Bacteria 2008
2 JGI24743J22301_10021675 3300001991 Bacteria 1229
3 JGI24744J21845_10003881 3300002077 Bacteria 3087
4 JGI24742J22300_10010385 3300002244 Bacteria 1541
5 JGI25153J46596_10003275 3300003215 Bacteria 9098
6 Ga0065715_10329150 3300005293 Bacteria 987
7 Ga0070658_10217843 3300005327 Bacteria 1614
8 Ga0070658_10244628 3300005327 Bacteria 1521
9 Ga0070683_100177915 3300005329 Bacteria 2019
10 Ga0070683_100466048 3300005329 Bacteria 1206
11 Ga0070683_100535016 3300005329 Bacteria 1120
12 Ga0070683_100573991 3300005329 Bacteria 1079
13 Ga0070690_100406615 3300005330 Bacteria 1001
14 Ga0070690_100474500 3300005330 Bacteria 931
15 Ga0068869_100016109 3300005334 Bacteria 5033
16 Ga0068869_100149880 3300005334 Bacteria 1808
17 Ga0070680_100010814 3300005336 Bacteria 7046
18 Ga0070680_100130587 3300005336 Bacteria 2101
19 Ga0070682_100025821 3300005337 Bacteria 3510
20 Ga0068868_100032541 3300005338 Bacteria 4012
21 Ga0070660_100032004 3300005339 Bacteria 3955
22 Ga0070660_100060064 3300005339 Bacteria 2950
23 Ga0070660_100312950 3300005339 Bacteria 1289
24 Ga0070689_100026742 3300005340 Bacteria 4345
25 Ga0070687_100026284 3300005343 Bacteria 2801
26 Ga0070687_100029604 3300005343 Bacteria 2668
27 Ga0070668_100268693 3300005347 Bacteria 1421
28 Ga0070669_100040545 3300005353 Bacteria 3385
29 Ga0070669_100069741 3300005353 Bacteria 2597
30 Ga0070669_100300953 3300005353 Bacteria 1290
31 Ga0070669_100701128 3300005353 Bacteria 855
32 Ga0070675_100030788 3300005354 Bacteria 4333
33 Ga0070675_100187652 3300005354 Bacteria 1790
34 Ga0070671_100081232 3300005355 Bacteria 2710
35 Ga0070674_100029667 3300005356 Bacteria 3607
36 Ga0070674_100074677 3300005356 Bacteria 2406
37 Ga0070674_100123810 3300005356 Bacteria 1917
38 Ga0070673_100313201 3300005364 Bacteria 1385
39 Ga0070673_100417070 3300005364 Bacteria 1203
40 Ga0070688_100011120 3300005365 Bacteria 4995
41 Ga0070688_100081470 3300005365 Bacteria 2096
42 Ga0070688_100298569 3300005365 Bacteria 1164
43 Ga0070667_100015781 3300005367 Bacteria 6248
44 Ga0070709_10137043 3300005434 Bacteria 1677
45 Ga0070714_100205700 3300005435 Bacteria 1802
46 Ga0070710_10055147 3300005437 Bacteria 2245
47 Ga0070701_10019411 3300005438 Bacteria 3210
48 Ga0070700_100027101 3300005441 Bacteria 3394
49 Ga0070694_100101473 3300005444 Bacteria 2036
50 Ga0070663_100653543 3300005455 Bacteria 889
51 Ga0070678_100713873 3300005456 Bacteria 904
52 Ga0070678_100729725 3300005456 Bacteria 895
53 Ga0070681_10103097 3300005458 Bacteria 2798
54 Ga0070681_10221451 3300005458 Bacteria 1807
55 Ga0070681_10605022 3300005458 Bacteria 1010
56 Ga0070681_10692595 3300005458 Bacteria 935
57 Ga0068867_100089320 3300005459 Bacteria 2336
58 Ga0068867_100198574 3300005459 Bacteria 1604
59 Ga0070685_10136498 3300005466 Bacteria 1539
60 Ga0070679_100037441 3300005530 Bacteria 4819
61 Ga0070679_100123623 3300005530 Bacteria 2571
62 Ga0070684_100062464 3300005535 Bacteria 3263
63 Ga0070684_100801016 3300005535 Bacteria 881
64 Ga0068853_100413030 3300005539 Bacteria 1265
65 Ga0070672_100183917 3300005543 Bacteria 1742
66 Ga0070686_100041004 3300005544 Bacteria 2890
67 Ga0070686_100110010 3300005544 Bacteria 1876
68 Ga0070665_100003403 3300005548 Bacteria 16997
69 Ga0070665_100251143 3300005548 Bacteria 1769
70 Ga0070704_100073836 3300005549 Bacteria 2486
71 Ga0068855_100088653 3300005563 Bacteria 3573
72 Ga0068857_100941587 3300005577 Bacteria 830
73 Ga0068854_100156201 3300005578 Bacteria 1763
74 Ga0068856_100062677 3300005614 Bacteria 3673
75 Ga0068856_100390312 3300005614 Bacteria 1412
76 Ga0070702_100013257 3300005615 Bacteria 4157
77 Ga0068852_100057832 3300005616 Bacteria 3356
78 Ga0068852_100515075 3300005616 Bacteria 1193
79 Ga0068859_100039822 3300005617 Bacteria 4716
80 Ga0068859_100056109 3300005617 Bacteria 3964
81 Ga0068864_100005352 3300005618 Bacteria 10515
82 Ga0068864_101269985 3300005618 Bacteria 736
83 Ga0068866_10054745 3300005718 Bacteria 2046
84 Ga0068866_10172595 3300005718 Bacteria 1270
85 Ga0068861_100020927 3300005719 Bacteria 4694
86 Ga0068870_10024128 3300005840 Bacteria 3008
87 Ga0068863_100258034 3300005841 Bacteria 1685
88 Ga0068858_100032013 3300005842 Bacteria 4885
89 Ga0068860_100022806 3300005843 Bacteria 6054
90 Ga0068860_100155340 3300005843 Bacteria 2205
91 Ga0068862_100073503 3300005844 Bacteria 2955
92 Ga0081455_10050969 3300005937 Bacteria 3554
93 Ga0081455_10426080 3300005937 Bacteria 913
94 Ga0081538_10175586 3300005981 Bacteria 926
95 Ga0081538_10186679 3300005981 Bacteria 877
96 Ga0081540_1000001 3300005983 Bacteria 293507
97 Ga0081540_1001493 3300005983 Bacteria 20169
98 Ga0081540_1042944 3300005983 Bacteria 2325
99 Ga0070717_10099657 3300006028 Bacteria 2465
100 Ga0075365_10015868 3300006038 Bacteria 4565
101 Ga0075365_10074134 3300006038 Bacteria 2295
102 Ga0075368_10012351 3300006042 Bacteria 3120
103 Ga0075368_10095201 3300006042 Bacteria 1220
104 Ga0075363_100055325 3300006048 Bacteria 2125
105 Ga0070715_10022896 3300006163 Bacteria 2441
106 Ga0070712_100011369 3300006175 Bacteria 5642
107 Ga0070712_100149877 3300006175 Bacteria 1790
108 Ga0070712_100823988 3300006175 Bacteria 797
109 Ga0075362_10085378 3300006177 Bacteria 1459
110 Ga0075367_10043980 3300006178 Bacteria 2616
111 Ga0075366_10007010 3300006195 Bacteria 6201
112 Ga0075366_10118667 3300006195 Bacteria 1594
113 Ga0097621_100172987 3300006237 Bacteria 1862
114 Ga0097621_100940032 3300006237 Bacteria 807
115 Ga0075370_10038399 3300006353 Bacteria 2694
116 Ga0075370_10281161 3300006353 Bacteria 988
117 Ga0075370_10369260 3300006353 Bacteria 859
118 Ga0068871_100169231 3300006358 Bacteria 1872
119 Ga0068871_100501979 3300006358 Bacteria 1093
120 Ga0075428_100033275 3300006844 Bacteria 5692
121 Ga0075428_100427854 3300006844 Bacteria 1418
122 Ga0075430_100008327 3300006846 Bacteria 8756
123 Ga0075430_100009673 3300006846 Bacteria 8144
124 Ga0075431_100011354 3300006847 Bacteria 8974
125 Ga0075431_100108123 3300006847 Bacteria 2870
126 Ga0075431_100163368 3300006847 Bacteria 2289
127 Ga0075429_100060863 3300006880 Bacteria 3288
128 Ga0068865_100087249 3300006881 Bacteria 2255
129 Ga0068865_100103813 3300006881 Bacteria 2085
130 Ga0097620_100039823 3300006931 Bacteria 4716
131 Ga0097620_100056107 3300006931 Bacteria 3964
132 Ga0105240_10044772 3300009093 Bacteria 5619
133 Ga0111539_10024210 3300009094 Bacteria 7455
134 Ga0111539_10191912 3300009094 Bacteria 2383
135 Ga0105245_10297641 3300009098 Bacteria 1582
136 Ga0105245_10350560 3300009098 Bacteria 1462
137 Ga0105245_10389197 3300009098 Bacteria 1390
138 Ga0105247_10533692 3300009101 Bacteria 860
139 Ga0105247_10677543 3300009101 Bacteria 773
140 Ga0114129_10006403 3300009147 Bacteria 16695
141 Ga0114129_10076235 3300009147 Bacteria 4669
142 Ga0105243_10074202 3300009148 Bacteria 2759
143 Ga0105243_10513633 3300009148 Bacteria 1138
144 Ga0105242_10313791 3300009176 Bacteria 1436
145 Ga0105248_10031113 3300009177 Bacteria 5964
146 Ga0105248_10037218 3300009177 Bacteria 5443
147 Ga0105238_10074850 3300009551 Bacteria 3379
148 Ga0105249_10083196 3300009553 Bacteria 2979
149 Ga0105249_10309602 3300009553 Bacteria 1587
150 Ga0105249_10603284 3300009553 Bacteria 1153
151 Ga0105249_11552001 3300009553 Bacteria 734
152 Ga0105239_10159617 3300010375 Bacteria 2518
153 Ga0105239_10368567 3300010375 Bacteria 1623
154 Ga0105239_10450299 3300010375 Bacteria 1460
155 Ga0105246_10063504 3300011119 Bacteria 2576
156 Ga0105246_11077591 3300011119 Bacteria 732
157 Ga0157373_10093289 3300013100 Bacteria 2120
158 Ga0157371_10060472 3300013102 Bacteria 2686
159 Ga0157371_10203708 3300013102 Bacteria 1419
160 Ga0157370_10146892 3300013104 Bacteria 2195
161 Ga0157370_10274014 3300013104 Bacteria 1559
162 Ga0157370_10738702 3300013104 Bacteria 897
163 Ga0157369_10222632 3300013105 Bacteria 1974
164 Ga0157369_10374603 3300013105 Bacteria 1478
165 Ga0157369_10761524 3300013105 Bacteria 996
166 Ga0157374_11160284 3300013296 Bacteria 793
167 Ga0157374_11330936 3300013296 Bacteria 740
168 Ga0157378_10169784 3300013297 Bacteria 2045
169 Ga0163162_10167351 3300013306 Bacteria 2322
170 Ga0163162_10549040 3300013306 Bacteria 1284
171 Ga0157372_10570817 3300013307 Bacteria 1318
172 Ga0157372_10776541 3300013307 Bacteria 1114
173 Ga0157372_11143002 3300013307 Bacteria 900
174 Ga0157375_11095843 3300013308 Bacteria 932
175 Ga0163163_10001312 3300014325 Bacteria 20992
176 Ga0163163_10012611 3300014325 Bacteria 7706
177 Ga0163163_10747996 3300014325 Bacteria 1041
178 Ga0163163_11138838 3300014325 Bacteria 843
179 Ga0157380_10374193 3300014326 Bacteria 1342
180 Ga0157377_10022449 3300014745 Bacteria 3332
181 Ga0157379_10065323 3300014968 Bacteria 3253
182 Ga0157379_10457295 3300014968 Bacteria 1179
183 Ga0163161_10088410 3300017792 Bacteria 2290
184 Ga0163161_10247164 3300017792 Bacteria 1389
185 Ga0213873_10042110 3300021358 Bacteria 1180
186 Ga0213874_10001718 3300021377 Bacteria 4599
187 Ga0213874_10073967 3300021377 Bacteria 1092
188 Ga0213876_10010842 3300021384 Bacteria 4882
189 Ga0213876_10109421 3300021384 Bacteria 1466
190 Ga0213876_10342220 3300021384 Bacteria 795
191 Ga0213875_10013016 3300021388 Bacteria 4095
192 Ga0213875_10097483 3300021388 Bacteria 1371
193 Ga0213875_10137582 3300021388 Bacteria 1142
194 Ga0209758_1001857 3300025297 Bacteria 23182
195 Ga0209758_1041884 3300025297 Bacteria 1705
196 Ga0207697_10041410 3300025315 Bacteria 1892
197 Ga0207697_10083212 3300025315 Bacteria 1350
198 Ga0207682_10088001 3300025893 Bacteria 1342
199 Ga0207642_10007358 3300025899 Bacteria 3714
200 Ga0207642_10032645 3300025899 Bacteria 2195
201 Ga0207688_10007032 3300025901 Bacteria 6119
202 Ga0207688_10038131 3300025901 Bacteria 2666
203 Ga0207680_10016823 3300025903 Bacteria 3850
204 Ga0207685_10085345 3300025905 Bacteria 1317
205 Ga0207645_10023157 3300025907 Bacteria 4037
206 Ga0207645_10047471 3300025907 Bacteria 2742
207 Ga0207643_10018873 3300025908 Bacteria 3777
208 Ga0207705_10237595 3300025909 Bacteria 1387
209 Ga0207705_10355312 3300025909 Bacteria 1129
210 Ga0207707_10038183 3300025912 Bacteria 4196
211 Ga0207707_10223898 3300025912 Bacteria 1637
212 Ga0207707_10444963 3300025912 Bacteria 1109
213 Ga0207695_10266894 3300025913 Bacteria 1608
214 Ga0207693_10009453 3300025915 Bacteria 7944
215 Ga0207693_10022494 3300025915 Bacteria 5009
216 Ga0207693_10207111 3300025915 Bacteria 1542
217 Ga0207662_10000948 3300025918 Bacteria 13473
218 Ga0207662_10041938 3300025918 Bacteria 2696
219 Ga0207657_10030633 3300025919 Bacteria 4882
220 Ga0207657_10031144 3300025919 Bacteria 4836
221 Ga0207657_10034776 3300025919 Bacteria 4526
222 Ga0207652_10094764 3300025921 Bacteria 2629
223 Ga0207652_10538897 3300025921 Bacteria 1049
224 Ga0207681_10019233 3300025923 Bacteria 4314
225 Ga0207681_10032142 3300025923 Bacteria 3434
226 Ga0207681_10610405 3300025923 Bacteria 902
227 Ga0207659_10159718 3300025926 Bacteria 1768
228 Ga0207664_10099885 3300025929 Bacteria 2395
229 Ga0207644_10015558 3300025931 Bacteria 5110
230 Ga0207644_10934336 3300025931 Bacteria 727
231 Ga0207706_10014745 3300025933 Bacteria 7077
232 Ga0207686_10256216 3300025934 Bacteria 1281
233 Ga0207686_10682154 3300025934 Bacteria 815
234 Ga0207709_10033738 3300025935 Bacteria 3009
235 Ga0207709_10227768 3300025935 Bacteria 1348
236 Ga0207669_10120620 3300025937 Bacteria 1779
237 Ga0207669_10230276 3300025937 Bacteria 1366
238 Ga0207704_10042333 3300025938 Bacteria 2680
239 Ga0207704_10056413 3300025938 Bacteria 2406
240 Ga0207704_10089069 3300025938 Bacteria 2021
241 Ga0207704_10474963 3300025938 Bacteria 1003
242 Ga0207665_10062621 3300025939 Bacteria 2524
243 Ga0207691_10020531 3300025940 Bacteria 6246
244 Ga0207711_10004447 3300025941 Bacteria 11946
245 Ga0207689_10080501 3300025942 Bacteria 2678
246 Ga0207661_10143136 3300025944 Bacteria 2060
247 Ga0207661_10163451 3300025944 Bacteria 1933
248 Ga0207679_10110059 3300025945 Bacteria 2172
249 Ga0207679_10985394 3300025945 Bacteria 772
250 Ga0207667_10217970 3300025949 Bacteria 1955
251 Ga0207651_10135463 3300025960 Bacteria 1893
252 Ga0207640_10254770 3300025981 Bacteria 1364
253 Ga0207658_10089849 3300025986 Bacteria 2379
254 Ga0207677_10085820 3300026023 Bacteria 2273
255 Ga0207677_10604583 3300026023 Bacteria 963
256 Ga0207703_10049194 3300026035 Bacteria 3407
257 Ga0207703_10999735 3300026035 Bacteria 802
258 Ga0207639_10271735 3300026041 Bacteria 1487
259 Ga0207639_10410764 3300026041 Bacteria 1222
260 Ga0207678_10019531 3300026067 Bacteria 5954
261 Ga0207678_10556754 3300026067 Bacteria 1003
262 Ga0207708_10005801 3300026075 Bacteria 9127
263 Ga0207702_10172149 3300026078 Bacteria 1986
264 Ga0207702_10823668 3300026078 Bacteria 918
265 Ga0207702_11014929 3300026078 Bacteria 823
266 Ga0207641_10251661 3300026088 Bacteria 1650
267 Ga0207641_10498887 3300026088 Bacteria 1182
268 Ga0207648_10026708 3300026089 Bacteria 5128
269 Ga0207648_10489090 3300026089 Bacteria 1125
270 Ga0207676_10050153 3300026095 Bacteria 3252
271 Ga0207676_11180506 3300026095 Bacteria 758
272 Ga0207674_10060593 3300026116 Bacteria 3826
273 Ga0207674_10275894 3300026116 Bacteria 1629
274 Ga0207674_11107927 3300026116 Bacteria 761
275 Ga0207675_100004191 3300026118 Bacteria 13954
276 Ga0207683_10152536 3300026121 Bacteria 2085
277 Ga0207698_10026408 3300026142 Bacteria 4108
278 Ga0207698_10154179 3300026142 Bacteria 1999
279 Ga0207698_10242030 3300026142 Bacteria 1645
280 Ga0209813_10014069 3300027866 Bacteria 2148
281 Ga0209813_10024873 3300027866 Bacteria 1717
282 Ga0209813_10101753 3300027866 Bacteria 978
283 Ga0207428_10037523 3300027907 Bacteria 3942
284 Ga0207428_10331957 3300027907 Bacteria 1121
285 Ga0268266_10029205 3300028379 Bacteria 4687
286 Ga0268264_10080021 3300028381 Bacteria 2789
287 Ga0265325_10011360 3300031241 Bacteria 5117
288 Ga0265325_10041323 3300031241 Bacteria 2417
289 Ga0265340_10031184 3300031247 Bacteria 2668
290 Ga0265340_10119982 3300031247 Bacteria 1211
291 Ga0265316_10308435 3300031344 Bacteria 1152
292 Ga0265313_10000041 3300031595 Bacteria 119119
293 Ga0265313_10034929 3300031595 Bacteria 2536
294 Ga0265313_10068172 3300031595 Bacteria 1644
295 Ga0307406_10232500 3300031901 Bacteria 1378
296 Ga0307416_100731087 3300032002 Bacteria 1081
297 Ga0307415_100794407 3300032126 Bacteria 863
298 Ga0373930_0004499 3300034816 Bacteria 2273
299 Ga0373948_0018535 3300034817 Bacteria 1308
300 Ga0373958_0036025 3300034819 Bacteria 993
301 Ga0373958_0111078 3300034819 Bacteria 653
302 Ga0373929_0029679 3300035085 Bacteria 1162
303 Ga0373940_0204495 3300035088 Bacteria 650
304 Ga0373949_0121599 3300035090 Bacteria 733
305 Ga0373952_0033261 3300035092 Bacteria 1156
306 Ga0373939_0002103 3300035114 Bacteria 4744
307 Ga0373941_0014407 3300035115 Bacteria 2111
308 Ga0373941_0076387 3300035115 Bacteria 1123
309 Ga0373945_0020755 3300035116 Bacteria 2252
310 Ga0373945_0184323 3300035116 Bacteria 861
311 Ga0373954_0121195 3300035118 Bacteria 1270
312 Ga0373943_0058544 3300035170 Bacteria 1918
313 Ga0373943_0287193 3300035170 Bacteria 931
314 Ga0373946_0101508 3300035171 Bacteria 1290
315 Ga0373946_0157410 3300035171 Bacteria 1064
316 Ga0373962_0023628 3300035242 Bacteria 1639
317 Ga0373931_0026949 3300035691 Bacteria 2929
318 Ga0373931_0059647 3300035691 Bacteria 2052
319 Ga0373935_0071616 3300035692 Bacteria 2237
320 Ga0373935_0160187 3300035692 Bacteria 1533
321 Ga0373935_0387948 3300035692 Bacteria 1001
322 Ga0373927_0019610 3300035695 Bacteria 4432
323 Ga0373927_0142333 3300035695 Bacteria 1569
324 Ga0373927_0310100 3300035695 Bacteria 1039
325 Ga0373933_0089773 3300035724 Bacteria 1895
326 Ga0373933_0282852 3300035724 Bacteria 1072
327 Ga0373947_0027880 3300035725 Bacteria 3308
328 Ga0373947_0174210 3300035725 Bacteria 1397
329 Ga0373937_0013346 3300036401 Bacteria 7239
330 Ga0373925_0097054 3300037068 Bacteria 2260
331 Ga0373925_0205543 3300037068 Bacteria 1567
332 Ga0373925_0341841 3300037068 Bacteria 1214
333 Ga0373925_0395562 3300037068 Bacteria 1126
334 Ga0436364_0345275 3300037853 Bacteria 3350
335 Ga0436364_0668940 3300037853 Bacteria 41832
336 Ga0436364_0882069 3300037853 Bacteria 2329
337 Ga0436364_0973612 3300037853 Bacteria 16616
338 Ga0436364_1080064 3300037853 Bacteria 3276
339 Ga0395901_0426839 3300038443 Bacteria 1358
340 Ga0395901_0452622 3300038443 Bacteria 1313
341 Ga0436365_0457869 3300039437 Bacteria 20822
342 Ga0436365_0919460 3300039437 Bacteria 4650
343 Ga0436365_1436444 3300039437 Bacteria 962
344 Ga0436365_1656578 3300039437 Bacteria 16411
345 Ga0436365_1823686 3300039437 Bacteria 6593
346 Ga0436361_0855819 3300039447 Bacteria 1699
347 Ga0436363_0358476 3300039450 Bacteria 1269
348 Ga0436363_0782061 3300039450 Bacteria 1881
349 Ga0436363_1080362 3300039450 Bacteria 1693
350 Ga0436363_1261424 3300039450 Bacteria 6710
351 Ga0436362_0232364 3300039453 Bacteria 2179
352 Ga0436362_0737872 3300039453 Bacteria 1100
353 Ga0451800_1622945 3300041459 Bacteria 1074
354 Ga0439441_007681 3300042001 Bacteria 1746
355 Ga0439434_0054839 3300042435 Bacteria 1240
356 Ga0466966_0172448 3300044684 Bacteria 1314
357 Ga0466966_0278203 3300044684 Bacteria 1007
358 Ga0466966_0413216 3300044684 Bacteria 811
359 Ga0466963_0001125 3300044694 Bacteria 13942
360 Ga0466963_0443091 3300044694 Bacteria 916
361 Ga0466963_0499581 3300044694 Bacteria 859
362 Ga0466957_0262740 3300044842 Bacteria 1151
363 Ga0466957_0269318 3300044842 Bacteria 1137
364 Ga0466959_0273147 3300045049 Bacteria 1161
365 Ga0466959_0296906 3300045049 Bacteria 1107
366 Ga0466958_0009446 3300045836 Bacteria 5435
367 Ga0466967_0051607 3300045976 Bacteria 3605
368 Ga0466967_0088458 3300045976 Bacteria 2811
369 Ga0466967_0341132 3300045976 Bacteria 1449
370 Ga0466967_0568961 3300045976 Bacteria 1116
371 Ga0495627_040163 3300046453 Bacteria 1442
372 Ga0495592_0308277 3300046454 Bacteria 1027
373 Ga0495603_0203160 3300046455 Bacteria 1145
374 Ga0495641_0078775 3300046461 Bacteria 1476
375 Ga0495641_0190588 3300046461 Bacteria 919
376 Ga0495650_0000104 3300046471 Bacteria 208976
377 Ga0495582_0066538 3300046473 Bacteria 1991
378 Ga0495605_0077611 3300046474 Bacteria 1558
379 Ga0495605_0119433 3300046474 Bacteria 1196
380 Ga0495639_0329339 3300046475 Bacteria 765
381 Ga0495662_0088727 3300046476 Bacteria 1507
382 Ga0495584_0045809 3300046491 Bacteria 2206
383 Ga0495584_0131426 3300046491 Bacteria 1270
384 Ga0495585_0054181 3300046492 Bacteria 2218
385 Ga0495585_0097964 3300046492 Bacteria 1572
386 Ga0495594_0053168 3300046499 Bacteria 2230
387 Ga0495596_0041899 3300046500 Bacteria 1805
388 Ga0495596_0140707 3300046500 Bacteria 937
389 Ga0495606_0313456 3300046507 Bacteria 846
390 Ga0495616_0083758 3300046513 Bacteria 1521
391 Ga0495618_0394998 3300046514 Bacteria 847
392 Ga0495628_0425454 3300046516 Bacteria 967
393 Ga0495630_0381710 3300046517 Bacteria 1079
394 Ga0495631_0034519 3300046518 Bacteria 2268
395 Ga0495637_0023872 3300046520 Bacteria 2770
396 Ga0495637_0049875 3300046520 Bacteria 1757
397 Ga0495644_0133264 3300046523 Bacteria 947
398 Ga0495644_0157141 3300046523 Bacteria 871
399 Ga0495644_0251082 3300046523 Bacteria 687
400 Ga0495663_0032084 3300046525 Bacteria 1563
401 Ga0495663_0128951 3300046525 Bacteria 852
402 Ga0495587_0090982 3300046536 Bacteria 1763
403 Ga0495598_0081230 3300046537 Bacteria 1040
404 Ga0495621_0097855 3300046539 Bacteria 1113
405 Ga0495645_0477363 3300046543 Bacteria 783
406 Ga0495656_0165498 3300046615 Bacteria 1077
407 Ga0495668_0188213 3300046616 Bacteria 1130
408 Ga0495668_0248177 3300046616 Bacteria 975
409 Ga0495634_0071061 3300046642 Bacteria 2293
410 Ga0495611_0175356 3300046648 Bacteria 1002
411 Ga0495635_0133296 3300046663 Bacteria 1694
412 Ga0495661_0241271 3300046665 Bacteria 927
413 Ga0495599_0198185 3300046678 Bacteria 1234
414 Ga0495647_0051737 3300046681 Bacteria 1597
415 Ga0495669_0317746 3300046684 Bacteria 751
416 Ga0495624_0107966 3300046690 Bacteria 1712
417 Ga0495670_0196527 3300046691 Bacteria 1067
418 Ga0495671_0029102 3300046692 Bacteria 2840
419 Ga0495671_0311266 3300046692 Bacteria 757
420 Ga0495649_0240235 3300046694 Bacteria 933
421 Ga0495581_0064637 3300047315 Bacteria 2114
422 Ga0495604_0073156 3300047317 Bacteria 2588
423 Ga0495676_0072421 3300047321 Bacteria 2646
424 Ga0495683_0200018 3300047323 Bacteria 902
425 Ga0495677_0042948 3300047445 Bacteria 1657
426 Ga0495684_0290133 3300047471 Bacteria 1178
427 Ga0495602_0103277 3300048088 Bacteria 2334
428 Ga0495602_0178969 3300048088 Bacteria 1638
429 Ga0495626_0110179 3300048091 Bacteria 1193
430 Ga0496100_0014305 3300048903 Bacteria 4604
431 Ga0496100_0019963 3300048903 Bacteria 4010
432 Ga0496100_0038048 3300048903 Bacteria 3046
433 Ga0496100_0068064 3300048903 Bacteria 2367
434 Ga0496100_0157654 3300048903 Bacteria 1625
435 Ga0496101_0009699 3300048904 Bacteria 6337
436 Ga0496101_0046121 3300048904 Bacteria 3124
437 Ga0496101_0083429 3300048904 Bacteria 2366
438 Ga0496102_0035323 3300048905 Bacteria 4499
439 Ga0496102_0062704 3300048905 Bacteria 3404
440 Ga0496102_0101946 3300048905 Bacteria 2667
441 Ga0496103_0014111 3300048906 Bacteria 4742
442 Ga0496103_0124394 3300048906 Bacteria 1644
443 Ga0496104_0000303 3300048907 Bacteria 43795
444 Ga0496104_0001304 3300048907 Bacteria 21509
445 Ga0496104_0003191 3300048907 Bacteria 14098
446 Ga0496104_0005338 3300048907 Bacteria 11241
447 Ga0496104_0191162 3300048907 Bacteria 1958
448 Ga0496104_0243326 3300048907 Bacteria 1711
449 Ga0496104_0698746 3300048907 Bacteria 922
450 Ga0496104_0712032 3300048907 Bacteria 911
451 Ga0496105_0000536 3300048908 Bacteria 25052
452 Ga0496105_0000693 3300048908 Bacteria 22693
453 Ga0496105_0003200 3300048908 Bacteria 12054
454 Ga0496105_0020159 3300048908 Bacteria 5385
455 Ga0496105_0029946 3300048908 Bacteria 4457
456 Ga0496105_0046006 3300048908 Bacteria 3602
457 Ga0496105_0156051 3300048908 Bacteria 1874
458 Ga0496105_0161837 3300048908 Bacteria 1837
459 Ga0496106_0009652 3300048909 Bacteria 7125
460 Ga0496106_0036104 3300048909 Bacteria 3697
461 Ga0496106_0173414 3300048909 Bacteria 1710
462 Ga0496106_0415610 3300048909 Bacteria 1081
463 Ga0496107_0000537 3300048910 Bacteria 21180
464 Ga0496107_0008281 3300048910 Bacteria 7193
465 Ga0496107_0070991 3300048910 Bacteria 2530
466 Ga0496107_0185686 3300048910 Bacteria 1544
467 Ga0496107_0212236 3300048910 Bacteria 1439
468 Ga0496108_0000387 3300048911 Bacteria 36592
469 Ga0496108_0016727 3300048911 Bacteria 5991
470 Ga0496108_0020538 3300048911 Bacteria 5428
471 Ga0496108_0096910 3300048911 Bacteria 2513
472 Ga0496108_0453090 3300048911 Bacteria 1121
473 Ga0496109_0000565 3300048912 Bacteria 30909
474 Ga0496109_0004128 3300048912 Bacteria 12132
475 Ga0496109_0011819 3300048912 Bacteria 7515
476 Ga0496109_0066520 3300048912 Bacteria 3300
477 Ga0496109_0448782 3300048912 Bacteria 1218
478 Ga0496109_0678963 3300048912 Bacteria 967
479 Ga0496110_0000737 3300048913 Bacteria 22617
480 Ga0496110_0011481 3300048913 Bacteria 7250
481 Ga0496110_0067561 3300048913 Bacteria 3163
482 Ga0496110_0256515 3300048913 Bacteria 1592
483 Ga0496110_0274642 3300048913 Bacteria 1534
484 Ga0496110_0653289 3300048913 Bacteria 952
485 Ga0496110_0796427 3300048913 Bacteria 849
486 Ga0496111_0006179 3300048914 Bacteria 7755
487 Ga0496111_0013552 3300048914 Bacteria 5552
488 Ga0496111_0043862 3300048914 Bacteria 3215
489 Ga0496111_0072762 3300048914 Bacteria 2502
490 Ga0496111_0074779 3300048914 Bacteria 2468
491 Ga0496112_0002340 3300048915 Bacteria 15218
492 Ga0496112_0055068 3300048915 Bacteria 3909
493 Ga0496112_0077367 3300048915 Bacteria 3290
494 Ga0496112_0831559 3300048915 Bacteria 847
495 Ga0496113_0004791 3300048916 Bacteria 8362
496 Ga0496113_0006957 3300048916 Bacteria 7228
497 Ga0496113_0017468 3300048916 Bacteria 4981
498 Ga0496113_0102343 3300048916 Bacteria 2221
499 Ga0496114_0029766 3300048917 Bacteria 4489
500 Ga0496114_0077968 3300048917 Bacteria 2795
501 Ga0496114_0091442 3300048917 Bacteria 2584
502 Ga0496114_0215900 3300048917 Bacteria 1683
503 Ga0496114_0237056 3300048917 Bacteria 1603
504 Ga0496114_0258211 3300048917 Bacteria 1534
505 Ga0496114_0560094 3300048917 Bacteria 1009
506 Ga0496114_0614731 3300048917 Bacteria 958
507 Ga0496114_0663422 3300048917 Bacteria 916
508 Ga0496115_0004259 3300048918 Bacteria 10349
509 Ga0496115_0185894 3300048918 Bacteria 1717
510 Ga0496115_0201838 3300048918 Bacteria 1642
511 Ga0496115_0259409 3300048918 Bacteria 1429
512 Ga0496115_0582430 3300048918 Bacteria 891
513 Ga0496115_0701961 3300048918 Bacteria 795
514 Ga0496119_0001222 3300048922 Bacteria 31999
515 Ga0496119_0009613 3300048922 Bacteria 8254
516 Ga0496122_0023630 3300048925 Bacteria 5407
517 Ga0496123_0001013 3300048926 Bacteria 42879
518 Ga0501031_0270151 3300049568 Bacteria 1104
519 Ga0501032_0014156 3300049569 Bacteria 5654
520 Ga0501032_0111343 3300049569 Bacteria 1811
521 Ga0501033_0025823 3300049570 Bacteria 4423
522 Ga0501033_0045654 3300049570 Bacteria 3259
523 Ga0501034_0032997 3300049571 Bacteria 5257
524 Ga0501034_0051226 3300049571 Bacteria 4163
525 Ga0501034_0094011 3300049571 Bacteria 2995
526 Ga0501034_0135218 3300049571 Bacteria 2446
527 Ga0501034_0427588 3300049571 Bacteria 1244
528 Ga0501034_0738368 3300049571 Bacteria 880
529 Ga0501036_0009640 3300049572 Bacteria 7944
530 Ga0501036_0041371 3300049572 Bacteria 3899
531 Ga0501036_0099889 3300049572 Bacteria 2454
532 Ga0501036_0539409 3300049572 Bacteria 970
533 Ga0501037_0051759 3300049573 Bacteria 3003
534 Ga0501037_0084721 3300049573 Bacteria 2295
535 Ga0501038_0006209 3300049574 Bacteria 11052
536 Ga0501038_0022145 3300049574 Bacteria 5695
537 Ga0501039_0012827 3300049575 Bacteria 6407
538 Ga0501040_0107494 3300049576 Bacteria 1950
539 Ga0501042_0079907 3300049578 Bacteria 2343
540 Ga0501042_0568750 3300049578 Bacteria 824
541 Ga0501042_0633247 3300049578 Bacteria 778
542 Ga0501043_0008173 3300049579 Bacteria 8254
543 Ga0501043_0074748 3300049579 Bacteria 2662
544 Ga0501046_0043033 3300049580 Bacteria 3597
545 Ga0501047_0016999 3300049581 Bacteria 6955
546 Ga0501047_0189258 3300049581 Bacteria 1922
547 Ga0501047_0383121 3300049581 Bacteria 1240
548 Ga0501048_0030936 3300049582 Bacteria 3874
549 Ga0501048_0066045 3300049582 Bacteria 2558
550 Ga0501048_0079529 3300049582 Bacteria 2314
551 Ga0501067_0063917 3300049583 Bacteria 2038
552 Ga0501068_0158322 3300049584 Bacteria 1426
553 Ga0501069_0029106 3300049585 Bacteria 3031
554 Ga0501069_0077398 3300049585 Bacteria 1870
555 Ga0501069_0133329 3300049585 Bacteria 1423
556 Ga0501069_0318066 3300049585 Bacteria 914
557 Ga0501070_0013139 3300049586 Bacteria 6978
558 Ga0501070_0038479 3300049586 Bacteria 3991
559 Ga0501070_0065170 3300049586 Bacteria 3016
560 Ga0501070_0120412 3300049586 Bacteria 2169
561 Ga0501070_0144401 3300049586 Bacteria 1964
562 Ga0501070_0209294 3300049586 Bacteria 1601
563 Ga0501071_0172009 3300049587 Bacteria 1621
564 Ga0501071_0215359 3300049587 Bacteria 1445
565 Ga0501072_0019165 3300049588 Bacteria 5285
566 Ga0501072_0042783 3300049588 Bacteria 3559
567 Ga0501072_0106354 3300049588 Bacteria 2232
568 Ga0501072_0186798 3300049588 Bacteria 1653
569 Ga0501072_0357571 3300049588 Bacteria 1159
570 Ga0501073_0008148 3300049589 Bacteria 7774
571 Ga0501073_0024216 3300049589 Bacteria 4358
572 Ga0501073_0164261 3300049589 Bacteria 1538
573 Ga0501074_0006044 3300049590 Bacteria 8736
574 Ga0501074_0561836 3300049590 Bacteria 808
575 Ga0501076_0606903 3300049592 Bacteria 903
576 Ga0501079_0004787 3300049741 Bacteria 10032
577 Ga0501079_0217724 3300049741 Bacteria 1492
578 Ga0501079_0320450 3300049741 Bacteria 1213
579 Ga0501080_0012502 3300049742 Bacteria 7785
580 Ga0501080_0033018 3300049742 Bacteria 4829
581 Ga0501080_0229637 3300049742 Bacteria 1696
582 Ga0501080_0262126 3300049742 Bacteria 1574
583 Ga0501083_0014854 3300049744 Bacteria 5446
584 Ga0501083_0040454 3300049744 Bacteria 3164
585 Ga0501083_0119979 3300049744 Bacteria 1725
586 Ga0501083_0126110 3300049744 Bacteria 1678
587 Ga0501083_0171774 3300049744 Bacteria 1417
588 Ga0501083_0279801 3300049744 Bacteria 1085
589 Ga0501083_0297881 3300049744 Bacteria 1049
590 Ga0501035_0001840 3300049822 Bacteria 21365
591 Ga0501035_0026015 3300049822 Bacteria 5360
592 Ga0501035_0028934 3300049822 Bacteria 5055
593 Ga0501035_0053932 3300049822 Bacteria 3593
594 Ga0501035_0112332 3300049822 Bacteria 2387
595 Ga0501044_0030712 3300049823 Bacteria 5660
596 Ga0501044_0120944 3300049823 Bacteria 2619
597 Ga0501044_0187309 3300049823 Bacteria 2033
598 Ga0501044_0624483 3300049823 Bacteria 969
599 Ga0501045_0223773 3300049824 Bacteria 1401
600 Ga0501045_0224618 3300049824 Bacteria 1398
601 nmdc:mga03683_203355_c1 3300050489 Bacteria 909
602 nmdc:mga03n38_131595_c1 3300050490 Bacteria 1240
603 nmdc:mga00v17_24434_c1 3300050491 Bacteria 3506
604 nmdc:mga00v17_365357_c1 3300050491 Bacteria 938
605 nmdc:mga0yw44_33068_c1 3300050492 Bacteria 3019
606 nmdc:mga0yw44_3657_c1 3300050492 Bacteria 6873
607 nmdc:mga0yw44_5695_c1 3300050492 Bacteria 5931
608 nmdc:mga0k408_33394_c1 3300050493 Bacteria 2943
609 nmdc:mga06z11_227244_c1 3300050494 Bacteria 1092
610 nmdc:mga06z11_31237_c1 3300050494 Bacteria 2586
611 nmdc:mga06z11_332583_c1 3300050494 Bacteria 907
612 nmdc:mga04h51_4406_c1 3300050495 Bacteria 3501
613 nmdc:mga04h51_94484_c1 3300050495 Bacteria 1081
614 nmdc:mga07m45_244201_c1 3300050496 Bacteria 1045
615 nmdc:mga05p37_236240_c1 3300050507 Bacteria 2200
616 nmdc:mga05p37_635_c1 3300050507 Bacteria 38849
617 nmdc:mga09592_539287_c1 3300050508 Bacteria 1002
618 nmdc:mga09592_60023_c1 3300050508 Bacteria 3215
619 nmdc:mga09592_64223_c1 3300050508 Bacteria 3108
620 nmdc:mga0qj67_112290_c1 3300050509 Bacteria 2200
621 nmdc:mga0qj67_138076_c1 3300050509 Bacteria 1976
622 nmdc:mga0qj67_180199_c1 3300050509 Bacteria 1716
623 nmdc:mga06r32_255801_c1 3300050510 Bacteria 1739
624 nmdc:mga06r32_566_c1 3300050510 Bacteria 32215
625 nmdc:mga06r32_92251_c1 3300050510 Bacteria 2961
626 nmdc:mga08y16_134_c1 3300050511 Bacteria 64270
627 nmdc:mga08y16_158712_c1 3300050511 Bacteria 2350
628 nmdc:mga08y16_389472_c1 3300050511 Bacteria 1428
629 nmdc:mga0sz30_129558_c1 3300050516 Bacteria 1111
630 nmdc:mga0sz30_214845_c1 3300050516 Bacteria 855
631 nmdc:mga0sz30_41528_c1 3300050516 Bacteria 1934
632 Ga0495601_0149564 3300053077 Bacteria 1524
633 Ga0495601_0155232 3300053077 Bacteria 1495
634 Ga0495601_0336993 3300053077 Bacteria 981
635 Ga0495612_0069790 3300053078 Bacteria 1464
636 Ga0495595_0269890 3300053084 Bacteria 853
637 Ga0495619_0073959 3300053085 Bacteria 2284
638 Ga0495619_0075877 3300053085 Bacteria 2256
639 Ga0495619_0082080 3300053085 Bacteria 2172
640 Ga0495619_0233416 3300053085 Bacteria 1275
641 Ga0495619_0329884 3300053085 Bacteria 1056
642 Ga0495619_0342202 3300053085 Bacteria 1035
643 Ga0500651_0002991 3300053093 Bacteria 9115
644 Ga0500641_0172429 3300053096 Bacteria 931
645 Ga0500650_0169325 3300053098 Bacteria 1005
646 Ga0500556_0000039 3300053104 Bacteria 138158
647 Ga0500562_027212 3300053108 Bacteria 1500
648 Ga0500595_135024 3300053119 Bacteria 693
649 Ga0500597_182010 3300053120 Bacteria 891
650 Ga0500642_0002438 3300053130 Bacteria 5459
651 Ga0500642_0012264 3300053130 Bacteria 3101
652 Ga0500568_0062660 3300053139 Bacteria 1436
653 Ga0500616_0002379 3300053153 Bacteria 15742
654 Ga0500616_0053720 3300053153 Bacteria 2113
655 Ga0500645_000479 3300053730 Bacteria 27370
656 Ga0500645_033555 3300053730 Bacteria 1535
657 Ga0501084_0214038 3300054114 Bacteria 1626
658 Ga0590071_112606 3300059421 Bacteria 691
659 Ga0501082_0091956 3300060353 Bacteria 2620
660 Ga0501082_0204506 3300060353 Bacteria 1718
661 Ga0501082_0286745 3300060353 Bacteria 1433
662 Ga0466962_0312137 3300061719 Bacteria 779
663 Ga0530510_0018378 3300061734 Bacteria 4957
664 Ga0530510_0240616 3300061734 Bacteria 1347
665 2837680471 2837678835 Bacteria 5252418
666 2919455907 2919450847 Bacteria 5631160
667 8001849488 8001845381 Bacteria 5804942
668 Ga0068868_100136915
669 JGI24743J22301_10021675
670 JGI24744J21845_10003881
671 JGI24742J22300_10010385
672 JGI25153J46596_10003275
673 Ga0065715_10329150
674 Ga0070658_10217843
675 Ga0070658_10244628
676 Ga0070683_100177915
677 Ga0070683_100466048
678 Ga0070683_100535016
679 Ga0070683_100573991
680 Ga0070690_100406615
681 Ga0070690_100474500
682 Ga0068869_100016109
683 Ga0068869_100149880
684 Ga0070680_100010814
685 Ga0070680_100130587
686 Ga0070682_100025821
687 Ga0068868_100032541
688 Ga0070660_100032004
689 Ga0070660_100060064
690 Ga0070660_100312950
691 Ga0070689_100026742
692 Ga0070687_100026284
693 Ga0070687_100029604
694 Ga0070668_100268693
695 Ga0070669_100040545
696 Ga0070669_100069741
697 Ga0070669_100300953
698 Ga0070669_100701128
699 Ga0070675_100030788
700 Ga0070675_100187652
701 Ga0070671_100081232
702 Ga0070674_100029667
703 Ga0070674_100074677
704 Ga0070674_100123810
705 Ga0070673_100313201
706 Ga0070673_100417070
707 Ga0070688_100011120
708 Ga0070688_100081470
709 Ga0070688_100298569
710 Ga0070667_100015781
711 Ga0070709_10137043
712 Ga0070714_100205700
713 Ga0070710_10055147
714 Ga0070701_10019411
715 Ga0070700_100027101
716 Ga0070694_100101473
717 Ga0070663_100653543
718 Ga0070678_100713873
719 Ga0070678_100729725
720 Ga0070681_10103097
721 Ga0070681_10221451
722 Ga0070681_10605022
723 Ga0070681_10692595
724 Ga0068867_100089320
725 Ga0068867_100198574
726 Ga0070685_10136498
727 Ga0070679_100037441
728 Ga0070679_100123623
729 Ga0070684_100062464
730 Ga0070684_100801016
731 Ga0068853_100413030
732 Ga0070672_100183917
733 Ga0070686_100041004
734 Ga0070686_100110010
735 Ga0070665_100003403
736 Ga0070665_100251143
737 Ga0070704_100073836
738 Ga0068855_100088653
739 Ga0068857_100941587
740 Ga0068854_100156201
741 Ga0068856_100062677
742 Ga0068856_100390312
743 Ga0070702_100013257
744 Ga0068852_100057832
745 Ga0068852_100515075
746 Ga0068859_100039822
747 Ga0068859_100056109
748 Ga0068864_100005352
749 Ga0068864_101269985
750 Ga0068866_10054745
751 Ga0068866_10172595
752 Ga0068861_100020927
753 Ga0068870_10024128
754 Ga0068863_100258034
755 Ga0068858_100032013
756 Ga0068860_100022806
757 Ga0068860_100155340
758 Ga0068862_100073503
759 Ga0081455_10050969
760 Ga0081455_10426080
761 Ga0081538_10175586
762 Ga0081538_10186679
763 Ga0081540_1000001
764 Ga0081540_1001493
765 Ga0081540_1042944
766 Ga0070717_10099657
767 Ga0075365_10015868
768 Ga0075365_10074134
769 Ga0075368_10012351
770 Ga0075368_10095201
771 Ga0075363_100055325
772 Ga0070715_10022896
773 Ga0070712_100011369
774 Ga0070712_100149877
775 Ga0070712_100823988
776 Ga0075362_10085378
777 Ga0075367_10043980
778 Ga0075366_10007010
779 Ga0075366_10118667
780 Ga0097621_100172987
781 Ga0097621_100940032
782 Ga0075370_10038399
783 Ga0075370_10281161
784 Ga0075370_10369260
785 Ga0068871_100169231
786 Ga0068871_100501979
787 Ga0075428_100033275
788 Ga0075428_100427854
789 Ga0075430_100008327
790 Ga0075430_100009673
791 Ga0075431_100011354
792 Ga0075431_100108123
793 Ga0075431_100163368
794 Ga0075429_100060863
795 Ga0068865_100087249
796 Ga0068865_100103813
797 Ga0097620_100039823
798 Ga0097620_100056107
799 Ga0105240_10044772
800 Ga0111539_10024210
801 Ga0111539_10191912
802 Ga0105245_10297641
803 Ga0105245_10350560
804 Ga0105245_10389197
805 Ga0105247_10533692
806 Ga0105247_10677543
807 Ga0114129_10006403
808 Ga0114129_10076235
809 Ga0105243_10074202
810 Ga0105243_10513633
811 Ga0105242_10313791
812 Ga0105248_10031113
813 Ga0105248_10037218
814 Ga0105238_10074850
815 Ga0105249_10083196
816 Ga0105249_10309602
817 Ga0105249_10603284
818 Ga0105249_11552001
819 Ga0105239_10159617
820 Ga0105239_10368567
821 Ga0105239_10450299
822 Ga0105246_10063504
823 Ga0105246_11077591
824 Ga0157373_10093289
825 Ga0157371_10060472
826 Ga0157371_10203708
827 Ga0157370_10146892
828 Ga0157370_10274014
829 Ga0157370_10738702
830 Ga0157369_10222632
831 Ga0157369_10374603
832 Ga0157369_10761524
833 Ga0157374_11160284
834 Ga0157374_11330936
835 Ga0157378_10169784
836 Ga0163162_10167351
837 Ga0163162_10549040
838 Ga0157372_10570817
839 Ga0157372_10776541
840 Ga0157372_11143002
841 Ga0157375_11095843
842 Ga0163163_10001312
843 Ga0163163_10012611
844 Ga0163163_10747996
845 Ga0163163_11138838
846 Ga0157380_10374193
847 Ga0157377_10022449
848 Ga0157379_10065323
849 Ga0157379_10457295
850 Ga0163161_10088410
851 Ga0163161_10247164
852 Ga0213873_10042110
853 Ga0213874_10001718
854 Ga0213874_10073967
855 Ga0213876_10010842
856 Ga0213876_10109421
857 Ga0213876_10342220
858 Ga0213875_10013016
859 Ga0213875_10097483
860 Ga0213875_10137582
861 Ga0209758_1001857
862 Ga0209758_1041884
863 Ga0207697_10041410
864 Ga0207697_10083212
865 Ga0207682_10088001
866 Ga0207642_10007358
867 Ga0207642_10032645
868 Ga0207688_10007032
869 Ga0207688_10038131
870 Ga0207680_10016823
871 Ga0207685_10085345
872 Ga0207645_10023157
873 Ga0207645_10047471
874 Ga0207643_10018873
875 Ga0207705_10237595
876 Ga0207705_10355312
877 Ga0207707_10038183
878 Ga0207707_10223898
879 Ga0207707_10444963
880 Ga0207695_10266894
881 Ga0207693_10009453
882 Ga0207693_10022494
883 Ga0207693_10207111
884 Ga0207662_10000948
885 Ga0207662_10041938
886 Ga0207657_10030633
887 Ga0207657_10031144
888 Ga0207657_10034776
889 Ga0207652_10094764
890 Ga0207652_10538897
891 Ga0207681_10019233
892 Ga0207681_10032142
893 Ga0207681_10610405
894 Ga0207659_10159718
895 Ga0207664_10099885
896 Ga0207644_10015558
897 Ga0207644_10934336
898 Ga0207706_10014745
899 Ga0207686_10256216
900 Ga0207686_10682154
901 Ga0207709_10033738
902 Ga0207709_10227768
903 Ga0207669_10120620
904 Ga0207669_10230276
905 Ga0207704_10042333
906 Ga0207704_10056413
907 Ga0207704_10089069
908 Ga0207704_10474963
909 Ga0207665_10062621
910 Ga0207691_10020531
911 Ga0207711_10004447
912 Ga0207689_10080501
913 Ga0207661_10143136
914 Ga0207661_10163451
915 Ga0207679_10110059
916 Ga0207679_10985394
917 Ga0207667_10217970
918 Ga0207651_10135463
919 Ga0207640_10254770
920 Ga0207658_10089849
921 Ga0207677_10085820
922 Ga0207677_10604583
923 Ga0207703_10049194
924 Ga0207703_10999735
925 Ga0207639_10271735
926 Ga0207639_10410764
927 Ga0207678_10019531
928 Ga0207678_10556754
929 Ga0207708_10005801
930 Ga0207702_10172149
931 Ga0207702_10823668
932 Ga0207702_11014929
933 Ga0207641_10251661
934 Ga0207641_10498887
935 Ga0207648_10026708
936 Ga0207648_10489090
937 Ga0207676_10050153
938 Ga0207676_11180506
939 Ga0207674_10060593
940 Ga0207674_10275894
941 Ga0207674_11107927
942 Ga0207675_100004191
943 Ga0207683_10152536
944 Ga0207698_10026408
945 Ga0207698_10154179
946 Ga0207698_10242030
947 Ga0209813_10014069
948 Ga0209813_10024873
949 Ga0209813_10101753
950 Ga0207428_10037523
951 Ga0207428_10331957
952 Ga0268266_10029205
953 Ga0268264_10080021
954 Ga0265325_10011360
955 Ga0265325_10041323
956 Ga0265340_10031184
957 Ga0265340_10119982
958 Ga0265316_10308435
959 Ga0265313_10000041
960 Ga0265313_10034929
961 Ga0265313_10068172
962 Ga0307406_10232500
963 Ga0307416_100731087
964 Ga0307415_100794407
965 Ga0373930_0004499
966 Ga0373948_0018535
967 Ga0373958_0036025
968 Ga0373958_0111078
969 Ga0373929_0029679
970 Ga0373940_0204495
971 Ga0373949_0121599
972 Ga0373952_0033261
973 Ga0373939_0002103
974 Ga0373941_0014407
975 Ga0373941_0076387
976 Ga0373945_0020755
977 Ga0373945_0184323
978 Ga0373954_0121195
979 Ga0373943_0058544
980 Ga0373943_0287193
981 Ga0373946_0101508
982 Ga0373946_0157410
983 Ga0373962_0023628
984 Ga0373931_0026949
985 Ga0373931_0059647
986 Ga0373935_0071616
987 Ga0373935_0160187
988 Ga0373935_0387948
989 Ga0373927_0019610
990 Ga0373927_0142333
991 Ga0373927_0310100
992 Ga0373933_0089773
993 Ga0373933_0282852
994 Ga0373947_0027880
995 Ga0373947_0174210
996 Ga0373937_0013346
997 Ga0373925_0097054
998 Ga0373925_0205543
999 Ga0373925_0341841
1000 Ga0373925_0395562
1001 Ga0436364_0345275
1002 Ga0436364_0668940
1003 Ga0436364_0882069
1004 Ga0436364_0973612
1005 Ga0436364_1080064
1006 Ga0395901_0426839
1007 Ga0395901_0452622
1008 Ga0436365_0457869
1009 Ga0436365_0919460
1010 Ga0436365_1436444
1011 Ga0436365_1656578
1012 Ga0436365_1823686
1013 Ga0436361_0855819
1014 Ga0436363_0358476
1015 Ga0436363_0782061
1016 Ga0436363_1080362
1017 Ga0436363_1261424
1018 Ga0436362_0232364
1019 Ga0436362_0737872
1020 Ga0451800_1622945
1021 Ga0439441_007681
1022 Ga0439434_0054839
1023 Ga0466966_0172448
1024 Ga0466966_0278203
1025 Ga0466966_0413216
1026 Ga0466963_0001125
1027 Ga0466963_0443091
1028 Ga0466963_0499581
1029 Ga0466957_0262740
1030 Ga0466957_0269318
1031 Ga0466959_0273147
1032 Ga0466959_0296906
1033 Ga0466958_0009446
1034 Ga0466967_0051607
1035 Ga0466967_0088458
1036 Ga0466967_0341132
1037 Ga0466967_0568961
1038 Ga0495627_040163
1039 Ga0495592_0308277
1040 Ga0495603_0203160
1041 Ga0495641_0078775
1042 Ga0495641_0190588
1043 Ga0495650_0000104
1044 Ga0495582_0066538
1045 Ga0495605_0077611
1046 Ga0495605_0119433
1047 Ga0495639_0329339
1048 Ga0495662_0088727
1049 Ga0495584_0045809
1050 Ga0495584_0131426
1051 Ga0495585_0054181
1052 Ga0495585_0097964
1053 Ga0495594_0053168
1054 Ga0495596_0041899
1055 Ga0495596_0140707
1056 Ga0495606_0313456
1057 Ga0495616_0083758
1058 Ga0495618_0394998
1059 Ga0495628_0425454
1060 Ga0495630_0381710
1061 Ga0495631_0034519
1062 Ga0495637_0023872
1063 Ga0495637_0049875
1064 Ga0495644_0133264
1065 Ga0495644_0157141
1066 Ga0495644_0251082
1067 Ga0495663_0032084
1068 Ga0495663_0128951
1069 Ga0495587_0090982
1070 Ga0495598_0081230
1071 Ga0495621_0097855
1072 Ga0495645_0477363
1073 Ga0495656_0165498
1074 Ga0495668_0188213
1075 Ga0495668_0248177
1076 Ga0495634_0071061
1077 Ga0495611_0175356
1078 Ga0495635_0133296
1079 Ga0495661_0241271
1080 Ga0495599_0198185
1081 Ga0495647_0051737
1082 Ga0495669_0317746
1083 Ga0495624_0107966
1084 Ga0495670_0196527
1085 Ga0495671_0029102
1086 Ga0495671_0311266
1087 Ga0495649_0240235
1088 Ga0495581_0064637
1089 Ga0495604_0073156
1090 Ga0495676_0072421
1091 Ga0495683_0200018
1092 Ga0495677_0042948
1093 Ga0495684_0290133
1094 Ga0495602_0103277
1095 Ga0495602_0178969
1096 Ga0495626_0110179
1097 Ga0496100_0014305
1098 Ga0496100_0019963
1099 Ga0496100_0038048
1100 Ga0496100_0068064
1101 Ga0496100_0157654
1102 Ga0496101_0009699
1103 Ga0496101_0046121
1104 Ga0496101_0083429
1105 Ga0496102_0035323
1106 Ga0496102_0062704
1107 Ga0496102_0101946
1108 Ga0496103_0014111
1109 Ga0496103_0124394
1110 Ga0496104_0000303
1111 Ga0496104_0001304
1112 Ga0496104_0003191
1113 Ga0496104_0005338
1114 Ga0496104_0191162
1115 Ga0496104_0243326
1116 Ga0496104_0698746
1117 Ga0496104_0712032
1118 Ga0496105_0000536
1119 Ga0496105_0000693
1120 Ga0496105_0003200
1121 Ga0496105_0020159
1122 Ga0496105_0029946
1123 Ga0496105_0046006
1124 Ga0496105_0156051
1125 Ga0496105_0161837
1126 Ga0496106_0009652
1127 Ga0496106_0036104
1128 Ga0496106_0173414
1129 Ga0496106_0415610
1130 Ga0496107_0000537
1131 Ga0496107_0008281
1132 Ga0496107_0070991
1133 Ga0496107_0185686
1134 Ga0496107_0212236
1135 Ga0496108_0000387
1136 Ga0496108_0016727
1137 Ga0496108_0020538
1138 Ga0496108_0096910
1139 Ga0496108_0453090
1140 Ga0496109_0000565
1141 Ga0496109_0004128
1142 Ga0496109_0011819
1143 Ga0496109_0066520
1144 Ga0496109_0448782
1145 Ga0496109_0678963
1146 Ga0496110_0000737
1147 Ga0496110_0011481
1148 Ga0496110_0067561
1149 Ga0496110_0256515
1150 Ga0496110_0274642
1151 Ga0496110_0653289
1152 Ga0496110_0796427
1153 Ga0496111_0006179
1154 Ga0496111_0013552
1155 Ga0496111_0043862
1156 Ga0496111_0072762
1157 Ga0496111_0074779
1158 Ga0496112_0002340
1159 Ga0496112_0055068
1160 Ga0496112_0077367
1161 Ga0496112_0831559
1162 Ga0496113_0004791
1163 Ga0496113_0006957
1164 Ga0496113_0017468
1165 Ga0496113_0102343
1166 Ga0496114_0029766
1167 Ga0496114_0077968
1168 Ga0496114_0091442
1169 Ga0496114_0215900
1170 Ga0496114_0237056
1171 Ga0496114_0258211
1172 Ga0496114_0560094
1173 Ga0496114_0614731
1174 Ga0496114_0663422
1175 Ga0496115_0004259
1176 Ga0496115_0185894
1177 Ga0496115_0201838
1178 Ga0496115_0259409
1179 Ga0496115_0582430
1180 Ga0496115_0701961
1181 Ga0496119_0001222
1182 Ga0496119_0009613
1183 Ga0496122_0023630
1184 Ga0496123_0001013
1185 Ga0501031_0270151
1186 Ga0501032_0014156
1187 Ga0501032_0111343
1188 Ga0501033_0025823
1189 Ga0501033_0045654
1190 Ga0501034_0032997
1191 Ga0501034_0051226
1192 Ga0501034_0094011
1193 Ga0501034_0135218
1194 Ga0501034_0427588
1195 Ga0501034_0738368
1196 Ga0501036_0009640
1197 Ga0501036_0041371
1198 Ga0501036_0099889
1199 Ga0501036_0539409
1200 Ga0501037_0051759
1201 Ga0501037_0084721
1202 Ga0501038_0006209
1203 Ga0501038_0022145
1204 Ga0501039_0012827
1205 Ga0501040_0107494
1206 Ga0501042_0079907
1207 Ga0501042_0568750
1208 Ga0501042_0633247
1209 Ga0501043_0008173
1210 Ga0501043_0074748
1211 Ga0501046_0043033
1212 Ga0501047_0016999
1213 Ga0501047_0189258
1214 Ga0501047_0383121
1215 Ga0501048_0030936
1216 Ga0501048_0066045
1217 Ga0501048_0079529
1218 Ga0501067_0063917
1219 Ga0501068_0158322
1220 Ga0501069_0029106
1221 Ga0501069_0077398
1222 Ga0501069_0133329
1223 Ga0501069_0318066
1224 Ga0501070_0013139
1225 Ga0501070_0038479
1226 Ga0501070_0065170
1227 Ga0501070_0120412
1228 Ga0501070_0144401
1229 Ga0501070_0209294
1230 Ga0501071_0172009
1231 Ga0501071_0215359
1232 Ga0501072_0019165
1233 Ga0501072_0042783
1234 Ga0501072_0106354
1235 Ga0501072_0186798
1236 Ga0501072_0357571
1237 Ga0501073_0008148
1238 Ga0501073_0024216
1239 Ga0501073_0164261
1240 Ga0501074_0006044
1241 Ga0501074_0561836
1242 Ga0501076_0606903
1243 Ga0501079_0004787
1244 Ga0501079_0217724
1245 Ga0501079_0320450
1246 Ga0501080_0012502
1247 Ga0501080_0033018
1248 Ga0501080_0229637
1249 Ga0501080_0262126
1250 Ga0501083_0014854
1251 Ga0501083_0040454
1252 Ga0501083_0119979
1253 Ga0501083_0126110
1254 Ga0501083_0171774
1255 Ga0501083_0279801
1256 Ga0501083_0297881
1257 Ga0501035_0001840
1258 Ga0501035_0026015
1259 Ga0501035_0028934
1260 Ga0501035_0053932
1261 Ga0501035_0112332
1262 Ga0501044_0030712
1263 Ga0501044_0120944
1264 Ga0501044_0187309
1265 Ga0501044_0624483
1266 Ga0501045_0223773
1267 Ga0501045_0224618
1268 nmdc:mga03683_203355_c1
1269 nmdc:mga03n38_131595_c1
1270 nmdc:mga00v17_24434_c1
1271 nmdc:mga00v17_365357_c1
1272 nmdc:mga0yw44_33068_c1
1273 nmdc:mga0yw44_3657_c1
1274 nmdc:mga0yw44_5695_c1
1275 nmdc:mga0k408_33394_c1
1276 nmdc:mga06z11_227244_c1
1277 nmdc:mga06z11_31237_c1
1278 nmdc:mga06z11_332583_c1
1279 nmdc:mga04h51_4406_c1
1280 nmdc:mga04h51_94484_c1
1281 nmdc:mga07m45_244201_c1
1282 nmdc:mga05p37_236240_c1
1283 nmdc:mga05p37_635_c1
1284 nmdc:mga09592_539287_c1
1285 nmdc:mga09592_60023_c1
1286 nmdc:mga09592_64223_c1
1287 nmdc:mga0qj67_112290_c1
1288 nmdc:mga0qj67_138076_c1
1289 nmdc:mga0qj67_180199_c1
1290 nmdc:mga06r32_255801_c1
1291 nmdc:mga06r32_566_c1
1292 nmdc:mga06r32_92251_c1
1293 nmdc:mga08y16_134_c1
1294 nmdc:mga08y16_158712_c1
1295 nmdc:mga08y16_389472_c1
1296 nmdc:mga0sz30_129558_c1
1297 nmdc:mga0sz30_214845_c1
1298 nmdc:mga0sz30_41528_c1
1299 Ga0495601_0149564
1300 Ga0495601_0155232
1301 Ga0495601_0336993
1302 Ga0495612_0069790
1303 Ga0495595_0269890
1304 Ga0495619_0073959
1305 Ga0495619_0075877
1306 Ga0495619_0082080
1307 Ga0495619_0233416
1308 Ga0495619_0329884
1309 Ga0495619_0342202
1310 Ga0500651_0002991
1311 Ga0500641_0172429
1312 Ga0500650_0169325
1313 Ga0500556_0000039
1314 Ga0500562_027212
1315 Ga0500595_135024
1316 Ga0500597_182010
1317 Ga0500642_0002438
1318 Ga0500642_0012264
1319 Ga0500568_0062660
1320 Ga0500616_0002379
1321 Ga0500616_0053720
1322 Ga0500645_000479
1323 Ga0500645_033555
1324 Ga0501084_0214038
1325 Ga0590071_112606
1326 Ga0501082_0091956
1327 Ga0501082_0204506
1328 Ga0501082_0286745
1329 Ga0466962_0312137
1330 Ga0530510_0018378
1331 Ga0530510_0240616
1332 2837680471
1333 2919455907
1334 8001849488

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

56

207

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bpk-assembly1.cif.gz_B crystal structure of nitrilotriacetate monooxygenase component b from bacillus cereus 0.9207 24 195
4r82-assembly1.cif.gz_B streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6 in complex with nad and fad fragments 0.9073 24 160
4l82-assembly1.cif.gz_B structure of a putative oxidoreductase from rickettsia felis 0.8937 24 178
4l82-assembly2.cif.gz_D structure of a putative oxidoreductase from rickettsia felis 0.8912 24 178
8ct0-assembly2.cif.gz_B crystal structure of fad reductase ctcq from kitasatospora aureofaciens in complex with fad and nad 0.8906 24 178
ID Description Score Start End Superfamily
3bpkA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9073 24 187 2.30.110.10
af_Q8I1S7_486_579_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9056 131 155 3.30.70.330
4l82C00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8952 24 178 2.30.110.10
4z85A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8905 21 200 2.30.110.10
af_A0A1D8PHY8_124_333_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8845 13 198 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A4R6VTU9-F1-model_v4 Flavin reductase (DIM6/NTAB) family NADH-FMN oxidoreductase RutF 0.9693 57 199 GO:0010181
GO:0016646
AF-A0A1M2YJ27-F1-model_v4 deleted 0.9657 28 198
AF-A0A844W947-F1-model_v4 deleted 0.9632 57 190
AF-A0A512BU97-F1-model_v4 Flavin reductase like domain-containing protein 0.962 57 198 GO:0010181
GO:0016646
AF-A0A520ZJN6-F1-model_v4 Flavin reductase family protein 0.9607 24 198 GO:0010181
GO:0016646

Map