F473812

General Info

Members Datasets Scaffolds Average Seq Length
666 479 1332 431

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2728368998|2728748508
Length 523
Sequence PTPKAVSKDTPKGAWTITFLLFLYMVVNFADKIVVGLAGVPIKTELGLTQEQFGDLGSSFFLLFSISAIVVGFIVNRASTRWVLLILAVIWSLAQFPMIGTVSFTTLLICRIILGAGEGPAFSVAAHAIYKWFPDEKRTLPTAILSQGSAFGVILAVPALNWVIVNHSWHHAFGALGIVGLLWAVAWFALGKEGPLVPTAAVAANEPRIPYWKLLTSRTFVGCVIATFGAYWALSLGLTWFTSFIIEGLGFSQQQAGFISILPWIFGATIVILTGWISQLMLSRGFTTRGARGVLGSVPLIIGGCILAVLPHVAPGGLMIALLVIGSGLCGSIYVVCPPMLGEFTPVSQRGAIIAIYGALYTISGILAPMVMGNVIQHSGAVLQGYMTGFTINAAIMAGAGVLGLLLLWPNTERAXXXXPASPARRSRPARSRARCRRRKAVRSAHLYLYLLARLCLSPCGRSRIACSKAECDPGEGLRSIEGWSSRRQTPHPDFPLTREIRPLPQGENPHLHMAPQRSTQIH

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
57 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
80 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
81 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
82 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
136 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
137 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
138 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
145 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
146 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
147 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
148 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
261 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
276 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
279 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
280 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
281 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
282 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
283 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
284 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
285 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
286 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
287 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
288 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
289 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
290 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
291 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
292 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
293 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
294 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
295 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
296 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
297 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
298 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
299 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
300 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
301 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
302 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
303 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
304 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
305 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
306 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
307 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
308 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
309 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
310 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
311 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
312 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
313 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
314 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
315 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
316 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
317 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
318 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
319 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
320 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
321 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
322 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
323 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
324 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
325 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
326 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
327 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
328 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
329 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
330 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
331 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
332 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
333 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
334 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
335 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
336 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
337 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
338 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
339 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
340 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
341 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
342 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
343 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
344 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
345 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
346 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
347 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
348 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
349 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
350 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
351 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
352 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
353 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
354 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
355 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
356 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
357 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
358 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
359 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
360 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
361 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
362 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
363 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
364 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
365 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
366 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
367 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
368 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
369 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
370 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
371 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
372 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
373 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
374 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
375 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
376 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
377 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
378 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
379 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
380 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
381 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
382 2904699407
383 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
384 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
385 2906610324
386 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
387 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
388 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
389 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
390 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
391 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
392 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
393 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
394 2922368715
395 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
396 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
397 2922425934
398 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
399 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
400 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
401 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
402 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
403 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
404 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
405 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
406 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
407 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
408 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
409 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
410 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
411 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
412 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
413 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
414 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
415 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
416 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
417 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
418 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
419 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
420 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
421 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
422 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
423 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
424 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
425 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
426 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
427 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
428 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
429 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
430 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
431 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
432 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
433 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
434 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
435 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
436 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
437 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
438 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
439 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
440 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
441 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
442 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
443 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
444 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
445 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
446 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
447 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
448 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
449 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
450 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
451 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
452 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
453 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
454 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
455 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
456 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
457 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
458 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
459 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
460 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
461 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
462 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
463 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
464 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
465 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
466 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
467 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
468 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
469 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
470 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
471 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
472 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
473 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
474 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
475 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
476 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
477 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
478 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
479 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.66
Metatranscriptomes 0.15
Isolates 27.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.76
Nodule 21.17
Rhizoplane 3.75
Rhizosphere 52.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10015288 3300001989 Bacteria 2787
2 JGI25406J46586_10000009 3300003203 Bacteria 109818
3 JGI25406J46586_10001070 3300003203 Bacteria 12840
4 JGI25160J50197_1002538 3300003354 Bacteria 8450
5 JGI25160J50197_1009004 3300003354 Bacteria 3745
6 JGI25404J52841_10001198 3300003659 Bacteria 4450
7 Ga0055531_10005473 3300003794 Bacteria 7432
8 Ga0065165_1001210 3300005262 Bacteria 29773
9 Ga0065707_10137830 3300005295 Bacteria 1814
10 Ga0070683_100053069 3300005329 Bacteria 3757
11 Ga0070670_100152250 3300005331 Bacteria 2002
12 Ga0068869_100034026 3300005334 Bacteria 3602
13 Ga0068869_100169558 3300005334 Bacteria 1704
14 Ga0070680_100048038 3300005336 Bacteria 3477
15 Ga0070680_100132181 3300005336 Bacteria 2089
16 Ga0070682_100170373 3300005337 Bacteria 1512
17 Ga0068868_100040285 3300005338 Bacteria 3635
18 Ga0068868_100142943 3300005338 Bacteria 1966
19 Ga0068868_100144882 3300005338 Bacteria 1952
20 Ga0070689_100046181 3300005340 Bacteria 3355
21 Ga0070668_100038985 3300005347 Bacteria 3634
22 Ga0070668_100060858 3300005347 Bacteria 2925
23 Ga0070674_100021497 3300005356 Bacteria 4144
24 Ga0070667_100074531 3300005367 Bacteria 2895
25 Ga0070714_100001031 3300005435 Bacteria 19841
26 Ga0070714_100013699 3300005435 Bacteria 6502
27 Ga0070714_100056936 3300005435 Bacteria 3345
28 Ga0070713_100004657 3300005436 Bacteria 9258
29 Ga0070713_100020929 3300005436 Bacteria 5022
30 Ga0070713_100250717 3300005436 Bacteria 1615
31 Ga0070710_10000834 3300005437 Bacteria 14840
32 Ga0070710_10001458 3300005437 Bacteria 11147
33 Ga0070711_100014662 3300005439 Bacteria 4941
34 Ga0070711_100043503 3300005439 Bacteria 3042
35 Ga0070711_100201250 3300005439 Bacteria 1537
36 Ga0070663_100015495 3300005455 Bacteria 4924
37 Ga0070663_100020156 3300005455 Bacteria 4411
38 Ga0070663_100062846 3300005455 Bacteria 2678
39 Ga0070678_100157001 3300005456 Bacteria 1839
40 Ga0070681_10013363 3300005458 Bacteria 8159
41 Ga0070681_10112328 3300005458 Bacteria 2664
42 Ga0070681_10178418 3300005458 Bacteria 2046
43 Ga0070679_100023653 3300005530 Bacteria 6017
44 Ga0070679_100028402 3300005530 Bacteria 5515
45 Ga0070679_100034223 3300005530 Bacteria 5034
46 Ga0070679_100067914 3300005530 Bacteria 3556
47 Ga0070684_100008002 3300005535 Bacteria 8253
48 Ga0070684_100021034 3300005535 Bacteria 5420
49 Ga0068853_100063847 3300005539 Bacteria 3191
50 Ga0070672_100184293 3300005543 Bacteria 1740
51 Ga0070686_100091669 3300005544 Bacteria 2034
52 Ga0070695_100107386 3300005545 Bacteria 1889
53 Ga0070704_100094487 3300005549 Bacteria 2237
54 Ga0068855_100012487 3300005563 Bacteria 10252
55 Ga0068855_100013741 3300005563 Bacteria 9760
56 Ga0068855_100029724 3300005563 Bacteria 6534
57 Ga0068855_100052549 3300005563 Bacteria 4796
58 Ga0068856_100066827 3300005614 Bacteria 3552
59 Ga0068856_100127792 3300005614 Bacteria 2545
60 Ga0068856_100144058 3300005614 Bacteria 2391
61 Ga0068852_100003441 3300005616 Bacteria 11061
62 Ga0068859_100110591 3300005617 Bacteria 2809
63 Ga0068861_100031166 3300005719 Bacteria 3914
64 Ga0068863_100080439 3300005841 Bacteria 3086
65 Ga0068858_100121940 3300005842 Bacteria 2438
66 Ga0068860_100273762 3300005843 Bacteria 1648
67 Ga0068862_100028869 3300005844 Bacteria 4673
68 Ga0081455_10010356 3300005937 Bacteria 9474
69 Ga0081455_10018973 3300005937 Bacteria 6521
70 Ga0081540_1002606 3300005983 Bacteria 14657
71 Ga0081540_1002760 3300005983 Bacteria 14251
72 Ga0081540_1006050 3300005983 Bacteria 8898
73 Ga0081540_1007518 3300005983 Bacteria 7758
74 Ga0081540_1045711 3300005983 Bacteria 2220
75 Ga0081540_1049113 3300005983 Bacteria 2108
76 Ga0081539_10000048 3300005985 Bacteria 272906
77 Ga0081539_10000530 3300005985 Bacteria 79454
78 Ga0081539_10089388 3300005985 Bacteria 1595
79 Ga0070717_10001838 3300006028 Bacteria 14824
80 Ga0070717_10004617 3300006028 Bacteria 9981
81 Ga0075365_10102689 3300006038 Bacteria 1959
82 Ga0075368_10002838 3300006042 Bacteria 5719
83 Ga0075368_10007471 3300006042 Bacteria 3854
84 Ga0075364_10056950 3300006051 Bacteria 2559
85 Ga0070715_10000830 3300006163 Bacteria 8479
86 Ga0070716_100141005 3300006173 Bacteria 1537
87 Ga0070712_100001393 3300006175 Bacteria 14686
88 Ga0070712_100008227 3300006175 Bacteria 6552
89 Ga0075367_10086547 3300006178 Bacteria 1902
90 Ga0075369_10036691 3300006186 Bacteria 2086
91 Ga0075366_10096413 3300006195 Bacteria 1773
92 Ga0075370_10024167 3300006353 Bacteria 3354
93 Ga0075370_10113201 3300006353 Bacteria 1576
94 Ga0097620_100110589 3300006931 Bacteria 2809
95 Ga0099824_1008841 3300006942 Bacteria 12675
96 Ga0099824_1015031 3300006942 Bacteria 7483
97 Ga0099822_1015114 3300006943 Bacteria 8734
98 Ga0099794_10035112 3300007265 Bacteria 2365
99 Ga0099795_10035819 3300007788 Bacteria 1738
100 Ga0105240_10009432 3300009093 Bacteria 13814
101 Ga0105240_10011824 3300009093 Bacteria 12121
102 Ga0105240_10018842 3300009093 Bacteria 9243
103 Ga0105240_10027328 3300009093 Bacteria 7471
104 Ga0105245_10023002 3300009098 Bacteria 5468
105 Ga0105245_10050732 3300009098 Bacteria 3719
106 Ga0105243_10061135 3300009148 Bacteria 3011
107 Ga0105241_10026860 3300009174 Bacteria 4284
108 Ga0105248_10008995 3300009177 Bacteria 10981
109 Ga0105248_10012317 3300009177 Bacteria 9433
110 Ga0105248_10059046 3300009177 Bacteria 4308
111 Ga0105237_10003797 3300009545 Bacteria 17750
112 Ga0105237_10012543 3300009545 Bacteria 8927
113 Ga0105237_10041548 3300009545 Bacteria 4637
114 Ga0105237_10064499 3300009545 Bacteria 3659
115 Ga0105238_10011156 3300009551 Bacteria 9037
116 Ga0105238_10119390 3300009551 Bacteria 2617
117 Ga0105239_10004474 3300010375 Bacteria 16696
118 Ga0105239_10014534 3300010375 Bacteria 8734
119 Ga0105239_10030295 3300010375 Bacteria 5948
120 Ga0105239_10041787 3300010375 Bacteria 5024
121 Ga0105239_10058209 3300010375 Bacteria 4240
122 Ga0105239_10060804 3300010375 Bacteria 4146
123 Ga0105239_10238561 3300010375 Bacteria 2041
124 Ga0105246_10054485 3300011119 Bacteria 2756
125 Ga0157370_10007832 3300013104 Bacteria 11577
126 Ga0157369_10007527 3300013105 Bacteria 12535
127 Ga0157369_10031113 3300013105 Bacteria 5880
128 Ga0157374_10029818 3300013296 Bacteria 4947
129 Ga0157374_10055719 3300013296 Bacteria 3690
130 Ga0157378_10211746 3300013297 Bacteria 1838
131 Ga0163162_10114827 3300013306 Bacteria 2792
132 Ga0163162_10292258 3300013306 Bacteria 1761
133 Ga0157372_10091053 3300013307 Bacteria 3469
134 Ga0163163_10014414 3300014325 Bacteria 7265
135 Ga0163163_10171134 3300014325 Bacteria 2219
136 Ga0163163_10178844 3300014325 Bacteria 2168
137 Ga0157380_10144831 3300014326 Bacteria 2046
138 Ga0157380_10159192 3300014326 Bacteria 1961
139 Ga0157379_10070151 3300014968 Bacteria 3135
140 Ga0157376_10017299 3300014969 Bacteria 5494
141 Ga0157376_10030357 3300014969 Bacteria 4316
142 Ga0157376_10095047 3300014969 Bacteria 2591
143 Ga0214544_1000087 3300021320 Bacteria 119600
144 Ga0214542_1000018 3300021321 Bacteria 202226
145 Ga0214545_1000009 3300021324 Bacteria 202915
146 Ga0214543_1000037 3300021327 Bacteria 182113
147 Ga0213874_10025006 3300021377 Bacteria 1680
148 Ga0224712_10047378 3300022467 Bacteria 1654
149 Ga0209563_101775 3300025230 Bacteria 5420
150 Ga0209677_100335 3300025253 Bacteria 30124
151 Ga0209148_1000568 3300025254 Bacteria 34536
152 Ga0209233_1001962 3300025261 Bacteria 7828
153 Ga0209233_1002050 3300025261 Bacteria 7637
154 Ga0209233_1005876 3300025261 Bacteria 4025
155 Ga0209455_1002928 3300025272 Bacteria 6295
156 Ga0209455_1005109 3300025272 Bacteria 4129
157 Ga0209564_1003394 3300025295 Bacteria 10967
158 Ga0209564_1007659 3300025295 Bacteria 5516
159 Ga0209758_1000015 3300025297 Bacteria 851943
160 Ga0209758_1000224 3300025297 Bacteria 121530
161 Ga0209758_1000972 3300025297 Bacteria 38579
162 Ga0209758_1031759 3300025297 Bacteria 2159
163 Ga0207426_1000201 3300025302 Bacteria 143975
164 Ga0207426_1000617 3300025302 Bacteria 45527
165 Ga0207426_1010243 3300025302 Bacteria 3649
166 Ga0209257_1000440 3300025304 Bacteria 79182
167 Ga0207653_10020686 3300025885 Bacteria 2084
168 Ga0207692_10000538 3300025898 Bacteria 13413
169 Ga0207710_10009375 3300025900 Bacteria 4121
170 Ga0207688_10051569 3300025901 Bacteria 2304
171 Ga0207647_10003185 3300025904 Bacteria 12307
172 Ga0207685_10006326 3300025905 Bacteria 3215
173 Ga0207699_10001601 3300025906 Bacteria 10746
174 Ga0207699_10083625 3300025906 Bacteria 1986
175 Ga0207645_10182939 3300025907 Bacteria 1375
176 Ga0207705_10026076 3300025909 Bacteria 4171
177 Ga0207654_10012270 3300025911 Bacteria 4387
178 Ga0207654_10041568 3300025911 Bacteria 2596
179 Ga0207707_10014215 3300025912 Bacteria 6934
180 Ga0207707_10016113 3300025912 Bacteria 6517
181 Ga0207707_10159316 3300025912 Bacteria 1973
182 Ga0207695_10000065 3300025913 Bacteria 336949
183 Ga0207695_10020475 3300025913 Bacteria 7574
184 Ga0207671_10001858 3300025914 Bacteria 23570
185 Ga0207671_10034492 3300025914 Bacteria 3759
186 Ga0207671_10046748 3300025914 Bacteria 3203
187 Ga0207671_10097843 3300025914 Bacteria 2219
188 Ga0207693_10000633 3300025915 Bacteria 31452
189 Ga0207693_10001776 3300025915 Bacteria 18911
190 Ga0207693_10007348 3300025915 Bacteria 9061
191 Ga0207693_10180595 3300025915 Bacteria 1660
192 Ga0207660_10053049 3300025917 Bacteria 2889
193 Ga0207657_10008146 3300025919 Bacteria 10685
194 Ga0207652_10024973 3300025921 Bacteria 4963
195 Ga0207694_10015674 3300025924 Bacteria 5717
196 Ga0207694_10127762 3300025924 Bacteria 2035
197 Ga0207687_10129242 3300025927 Bacteria 1901
198 Ga0207700_10069205 3300025928 Bacteria 2708
199 Ga0207700_10213764 3300025928 Bacteria 1632
200 Ga0207664_10006879 3300025929 Bacteria 7862
201 Ga0207664_10026778 3300025929 Bacteria 4362
202 Ga0207664_10050188 3300025929 Bacteria 3289
203 Ga0207664_10146374 3300025929 Bacteria 2003
204 Ga0207644_10080507 3300025931 Bacteria 2406
205 Ga0207706_10108099 3300025933 Bacteria 2448
206 Ga0207709_10056016 3300025935 Bacteria 2438
207 Ga0207669_10005920 3300025937 Bacteria 5536
208 Ga0207665_10003827 3300025939 Bacteria 10058
209 Ga0207665_10164534 3300025939 Bacteria 1598
210 Ga0207711_10019093 3300025941 Bacteria 5704
211 Ga0207689_10026612 3300025942 Bacteria 4846
212 Ga0207689_10065856 3300025942 Bacteria 2980
213 Ga0207689_10111762 3300025942 Bacteria 2246
214 Ga0207661_10012674 3300025944 Bacteria 6137
215 Ga0207667_10011217 3300025949 Bacteria 10427
216 Ga0207667_10043643 3300025949 Bacteria 4757
217 Ga0207651_10115390 3300025960 Bacteria 2025
218 Ga0207712_10169572 3300025961 Bacteria 1705
219 Ga0207703_10149822 3300026035 Bacteria 2033
220 Ga0207639_10098210 3300026041 Bacteria 2360
221 Ga0207678_10004673 3300026067 Bacteria 12297
222 Ga0207678_10026497 3300026067 Bacteria 5056
223 Ga0207678_10070207 3300026067 Bacteria 3003
224 Ga0207678_10084415 3300026067 Bacteria 2716
225 Ga0207708_10023977 3300026075 Bacteria 4614
226 Ga0207702_10000056 3300026078 Bacteria 131186
227 Ga0207702_10168562 3300026078 Bacteria 2006
228 Ga0207702_10202389 3300026078 Bacteria 1841
229 Ga0207674_10018427 3300026116 Bacteria 7587
230 Ga0207675_100122588 3300026118 Bacteria 2461
231 Ga0207675_100153161 3300026118 Bacteria 2196
232 Ga0207675_100182958 3300026118 Bacteria 2007
233 Ga0207683_10005111 3300026121 Bacteria 11262
234 Ga0207683_10084162 3300026121 Bacteria 2827
235 Ga0207698_10191821 3300026142 Bacteria 1821
236 Ga0209389_1000029 3300027296 Bacteria 140337
237 Ga0209389_1000076 3300027296 Bacteria 92447
238 Ga0209589_1000012 3300027357 Bacteria 229451
239 Ga0209589_1000013 3300027357 Bacteria 229273
240 Ga0209589_1000017 3300027357 Bacteria 215546
241 Ga0209489_100013 3300027361 Bacteria 229831
242 Ga0209489_100018 3300027361 Bacteria 215546
243 Ga0209489_100416 3300027361 Bacteria 77981
244 Ga0209700_100014 3300027363 Bacteria 299349
245 Ga0209700_100028 3300027363 Bacteria 215546
246 Ga0209588_1017089 3300027671 Bacteria 2246
247 Ga0209813_10001321 3300027866 Bacteria 5545
248 Ga0268266_10007480 3300028379 Bacteria 9845
249 Ga0268266_10136132 3300028379 Bacteria 2200
250 Ga0268265_10013210 3300028380 Bacteria 5610
251 Ga0268265_10023293 3300028380 Bacteria 4364
252 Ga0268264_10152983 3300028381 Bacteria 2070
253 Ga0265337_1006176 3300028556 Bacteria 4655
254 Ga0265326_10002792 3300028558 Bacteria 5848
255 Ga0265319_1009715 3300028563 Bacteria 4070
256 Ga0265334_10003782 3300028573 Bacteria 6840
257 Ga0265336_10000430 3300028666 Bacteria 25854
258 Ga0307517_10002211 3300028786 Bacteria 31433
259 Ga0307515_10059503 3300028794 Bacteria 5472
260 Ga0265338_10000024 3300028800 Bacteria 297778
261 Ga0307513_10260541 3300031456 Bacteria 1524
262 Ga0307509_10150050 3300031507 Bacteria 2249
263 Ga0307413_10082617 3300031824 Bacteria 2064
264 Ga0307409_100208171 3300031995 Bacteria 1755
265 Ga0307510_10020522 3300033180 Bacteria 7720
266 Ga0315911_1000018 3300033442 Bacteria 152089
267 Ga0373934_0006395 3300035086 Bacteria 4370
268 Ga0373923_0013875 3300035111 Bacteria 3013
269 Ga0373953_0032368 3300035117 Bacteria 2039
270 Ga0373954_0005748 3300035118 Bacteria 5382
271 Ga0373956_0003734 3300035119 Bacteria 6134
272 Ga0373957_0001574 3300035120 Bacteria 6227
273 Ga0373955_0003197 3300035172 Bacteria 7172
274 Ga0373924_0002150 3300035410 Bacteria 6599
275 Ga0373927_0035793 3300035695 Bacteria 3229
276 Ga0373933_0000114 3300035724 Bacteria 52016
277 Ga0373933_0001425 3300035724 Bacteria 14028
278 Ga0373933_0038701 3300035724 Bacteria 2803
279 Ga0373947_0001708 3300035725 Bacteria 13470
280 Ga0373937_0025351 3300036401 Bacteria 5353
281 Ga0373925_0025137 3300037068 Bacteria 4349
282 Ga0395900_0003234 3300037418 Bacteria 17637
283 Ga0395900_0005520 3300037418 Bacteria 13242
284 Ga0395900_0046530 3300037418 Bacteria 4468
285 Ga0395900_0057685 3300037418 Bacteria 3997
286 Ga0395900_0131044 3300037418 Bacteria 2570
287 Ga0395898_0003112 3300037466 Bacteria 18739
288 Ga0395898_0007427 3300037466 Bacteria 11634
289 Ga0395898_0016827 3300037466 Bacteria 7470
290 Ga0395905_0059181 3300037471 Bacteria 3582
291 Ga0395901_0002551 3300038443 Bacteria 18453
292 Ga0395901_0061158 3300038443 Bacteria 3919
293 Ga0436365_0046402 3300039437 Bacteria 2045
294 Ga0436365_1398633 3300039437 Bacteria 3485
295 Ga0436365_1444460 3300039437 Bacteria 3787
296 Ga0436365_1771573 3300039437 Bacteria 5105
297 Ga0436360_0296386 3300039438 Bacteria 1796
298 Ga0436363_1084220 3300039450 Bacteria 6620
299 Ga0439458_0023058 3300042157 Bacteria 1450
300 Ga0466969_0051865 3300044656 Bacteria 2017
301 Ga0466972_0000103 3300044658 Bacteria 75095
302 Ga0466965_0066852 3300044683 Bacteria 1803
303 Ga0466966_0000378 3300044684 Bacteria 29054
304 Ga0466966_0067717 3300044684 Bacteria 2242
305 Ga0466961_0000129 3300044693 Bacteria 50353
306 Ga0466964_0021963 3300044706 Bacteria 2472
307 Ga0466964_0026013 3300044706 Bacteria 2288
308 Ga0466968_0064036 3300044735 Bacteria 1590
309 Ga0466959_0002230 3300045049 Bacteria 12347
310 Ga0466959_0005547 3300045049 Bacteria 8659
311 Ga0466958_0111668 3300045836 Bacteria 1707
312 Ga0466967_0092454 3300045976 Bacteria 2751
313 Ga0495592_0019851 3300046454 Bacteria 5110
314 Ga0495592_0035153 3300046454 Bacteria 3775
315 Ga0495603_0004736 3300046455 Bacteria 8123
316 Ga0495603_0023990 3300046455 Bacteria 3690
317 Ga0495603_0069128 3300046455 Bacteria 2078
318 Ga0495590_0044751 3300046457 Bacteria 1543
319 Ga0495629_0002236 3300046459 Bacteria 14921
320 Ga0495629_0020919 3300046459 Bacteria 4669
321 Ga0495638_0002281 3300046460 Bacteria 15850
322 Ga0495638_0061027 3300046460 Bacteria 2331
323 Ga0495638_0092651 3300046460 Bacteria 1818
324 Ga0495651_0013486 3300046462 Bacteria 6321
325 Ga0495651_0033024 3300046462 Bacteria 4037
326 Ga0495651_0041220 3300046462 Bacteria 3587
327 Ga0495653_0021802 3300046463 Bacteria 5185
328 Ga0495653_0075213 3300046463 Bacteria 2514
329 Ga0495664_0011375 3300046477 Bacteria 5016
330 Ga0495664_0027628 3300046477 Bacteria 3309
331 Ga0495585_0051396 3300046492 Bacteria 2284
332 Ga0495606_0000265 3300046507 Bacteria 92526
333 Ga0495606_0067938 3300046507 Bacteria 2256
334 Ga0495608_0048212 3300046511 Bacteria 2831
335 Ga0495608_0113842 3300046511 Bacteria 1737
336 Ga0495628_0018214 3300046516 Bacteria 5822
337 Ga0495631_0037252 3300046518 Bacteria 2168
338 Ga0495643_0007059 3300046522 Bacteria 7293
339 Ga0495648_0009380 3300046524 Bacteria 7594
340 Ga0495652_0023860 3300046529 Bacteria 5418
341 Ga0495652_0024834 3300046529 Bacteria 5303
342 Ga0495652_0084156 3300046529 Bacteria 2616
343 Ga0495640_0004314 3300046533 Bacteria 11359
344 Ga0495587_0013075 3300046536 Bacteria 5220
345 Ga0495587_0077851 3300046536 Bacteria 1924
346 Ga0495609_0014031 3300046538 Bacteria 3773
347 Ga0495597_0037367 3300046542 Bacteria 2181
348 Ga0495645_0004845 3300046543 Bacteria 9197
349 Ga0495645_0046270 3300046543 Bacteria 3171
350 Ga0495622_0013276 3300046557 Bacteria 3822
351 Ga0495667_0020935 3300046559 Bacteria 4412
352 Ga0495667_0034548 3300046559 Bacteria 3381
353 Ga0495656_0021628 3300046615 Bacteria 2506
354 Ga0495656_0052136 3300046615 Bacteria 1753
355 Ga0495668_0034272 3300046616 Bacteria 2849
356 Ga0495668_0040883 3300046616 Bacteria 2585
357 Ga0495634_0148553 3300046642 Bacteria 1483
358 Ga0495634_0151159 3300046642 Bacteria 1468
359 Ga0495611_0072525 3300046648 Bacteria 1576
360 Ga0495635_0005971 3300046663 Bacteria 8496
361 Ga0495635_0014497 3300046663 Bacteria 5515
362 Ga0495635_0018394 3300046663 Bacteria 4876
363 Ga0495588_0013281 3300046674 Bacteria 3921
364 Ga0495657_0009210 3300046675 Bacteria 7492
365 Ga0495657_0011243 3300046675 Bacteria 6705
366 Ga0495657_0022914 3300046675 Bacteria 4469
367 Ga0495599_0007860 3300046678 Bacteria 6471
368 Ga0495599_0016810 3300046678 Bacteria 4545
369 Ga0495623_0006918 3300046679 Bacteria 7372
370 Ga0495623_0088147 3300046679 Bacteria 1910
371 Ga0495646_0004493 3300046680 Bacteria 8787
372 Ga0495669_0010508 3300046684 Bacteria 3912
373 Ga0495613_0030602 3300046689 Bacteria 3998
374 Ga0495624_0009621 3300046690 Bacteria 6691
375 Ga0495589_0030536 3300046794 Bacteria 2714
376 Ga0495600_0011471 3300046809 Bacteria 5523
377 Ga0495600_0096457 3300046809 Bacteria 1927
378 Ga0495604_0002997 3300047317 Bacteria 13512
379 Ga0495604_0117654 3300047317 Bacteria 1927
380 Ga0495674_0041857 3300047319 Bacteria 4089
381 Ga0495672_0008522 3300047320 Bacteria 7550
382 Ga0495680_0031781 3300047322 Bacteria 4292
383 Ga0495683_0084889 3300047323 Bacteria 1540
384 Ga0495687_009324 3300047443 Bacteria 5499
385 Ga0495675_0100696 3300047444 Bacteria 1808
386 Ga0495677_0044525 3300047445 Bacteria 1627
387 Ga0495684_0013146 3300047471 Bacteria 6387
388 Ga0495684_0218368 3300047471 Bacteria 1399
389 Ga0495686_0103257 3300047472 Bacteria 1717
390 Ga0495593_0000594 3300047673 Bacteria 20595
391 Ga0495602_0017685 3300048088 Bacteria 7139
392 Ga0495602_0072963 3300048088 Bacteria 2923
393 Ga0496100_0046229 3300048903 Bacteria 2798
394 Ga0496101_0005146 3300048904 Bacteria 8321
395 Ga0496102_0011419 3300048905 Bacteria 7657
396 Ga0496102_0027952 3300048905 Bacteria 5039
397 Ga0496102_0240976 3300048905 Bacteria 1705
398 Ga0496103_0038586 3300048906 Bacteria 2931
399 Ga0496104_0010370 3300048907 Bacteria 8323
400 Ga0496104_0061130 3300048907 Bacteria 3570
401 Ga0496105_0028888 3300048908 Bacteria 4537
402 Ga0496105_0035284 3300048908 Bacteria 4116
403 Ga0496105_0113267 3300048908 Bacteria 2238
404 Ga0496106_0019638 3300048909 Bacteria 5013
405 Ga0496107_0002869 3300048910 Bacteria 11390
406 Ga0496107_0066872 3300048910 Bacteria 2606
407 Ga0496109_0040504 3300048912 Bacteria 4220
408 Ga0496109_0053263 3300048912 Bacteria 3690
409 Ga0496109_0054520 3300048912 Bacteria 3647
410 Ga0496110_0036926 3300048913 Bacteria 4245
411 Ga0496112_0000019 3300048915 Bacteria 185531
412 Ga0496112_0189961 3300048915 Bacteria 2016
413 Ga0496114_0003910 3300048917 Bacteria 11491
414 Ga0496115_0001711 3300048918 Bacteria 15732
415 Ga0496115_0017903 3300048918 Bacteria 5428
416 Ga0496115_0026064 3300048918 Bacteria 4559
417 Ga0496117_0037409 3300048920 Bacteria 3615
418 Ga0496117_0094132 3300048920 Bacteria 1919
419 Ga0496118_0016791 3300048921 Bacteria 6693
420 Ga0496118_0023505 3300048921 Bacteria 5351
421 Ga0496118_0035533 3300048921 Bacteria 4044
422 Ga0496118_0052010 3300048921 Bacteria 3129
423 Ga0496119_0017281 3300048922 Bacteria 5433
424 Ga0496120_0016403 3300048923 Bacteria 4841
425 Ga0496120_0018940 3300048923 Bacteria 4421
426 Ga0496121_0196311 3300048924 Bacteria 1442
427 Ga0496122_0040423 3300048925 Bacteria 3706
428 Ga0496125_0020027 3300048928 Bacteria 6289
429 Ga0496126_0006097 3300048929 Bacteria 13518
430 Ga0496126_0013805 3300048929 Bacteria 8191
431 Ga0496126_0021180 3300048929 Bacteria 6357
432 Ga0496126_0026854 3300048929 Bacteria 5512
433 Ga0496126_0108106 3300048929 Bacteria 2425
434 Ga0495678_048591 3300049459 Bacteria 1654
435 Ga0495682_0002432 3300049460 Bacteria 8812
436 Ga0501043_0028838 3300049579 Bacteria 4357
437 Ga0501047_0100267 3300049581 Bacteria 2775
438 Ga0501047_0192123 3300049581 Bacteria 1904
439 Ga0501067_0105193 3300049583 Bacteria 1568
440 Ga0501070_0080176 3300049586 Bacteria 2701
441 Ga0501071_0210633 3300049587 Bacteria 1461
442 Ga0501073_0158403 3300049589 Bacteria 1569
443 Ga0501044_0028580 3300049823 Bacteria 5885
444 nmdc:mga0yw44_64261_c1 3300050492 Bacteria 2258
445 nmdc:mga0k408_135568_c1 3300050493 Bacteria 1463
446 nmdc:mga0k408_53128_c1 3300050493 Bacteria 2348
447 nmdc:mga07m45_139093_c1 3300050496 Bacteria 1406
448 nmdc:mga05p37_113442_c1 3300050507 Bacteria 3332
449 nmdc:mga0sz30_26279_c1 3300050516 Bacteria 2386
450 Ga0495601_0034250 3300053077 Bacteria 3167
451 Ga0500635_0001063 3300053080 Bacteria 6566
452 Ga0500635_0001671 3300053080 Bacteria 5362
453 Ga0495595_0000449 3300053084 Bacteria 15558
454 Ga0495619_0020998 3300053085 Bacteria 4165
455 Ga0495619_0023495 3300053085 Bacteria 3953
456 Ga0495619_0055079 3300053085 Bacteria 2634
457 Ga0500643_000062 3300053087 Bacteria 122407
458 Ga0500647_0038494 3300053091 Bacteria 2290
459 Ga0500566_0000065 3300053094 Bacteria 50325
460 Ga0500566_0007439 3300053094 Bacteria 6490
461 Ga0500640_022047 3300053095 Bacteria 2750
462 Ga0500641_0005167 3300053096 Bacteria 4626
463 Ga0500554_000253 3300053102 Bacteria 11538
464 Ga0500569_004894 3300053109 Bacteria 2846
465 Ga0500572_001831 3300053111 Bacteria 5410
466 Ga0500594_0023449 3300053118 Bacteria 1564
467 Ga0500595_000253 3300053119 Bacteria 35306
468 Ga0500595_002443 3300053119 Bacteria 9214
469 Ga0500595_007200 3300053119 Bacteria 4635
470 Ga0500614_009115 3300053123 Bacteria 2114
471 Ga0500559_0000211 3300053136 Bacteria 46800
472 Ga0500559_0010697 3300053136 Bacteria 3932
473 Ga0500559_0012818 3300053136 Bacteria 3557
474 Ga0500603_000158 3300053150 Bacteria 16730
475 Ga0500603_007611 3300053150 Bacteria 2383
476 Ga0500636_0000075 3300053177 Bacteria 48415
477 Ga0500637_0000157 3300053178 Bacteria 24963
478 Ga0500637_0022471 3300053178 Bacteria 3437
479 Ga0500637_0143551 3300053178 Bacteria 1381
480 Ga0500645_014422 3300053730 Bacteria 2518
481 Ga0500596_002342 3300053735 Bacteria 3748
482 Ga0500661_000942 3300055283 Bacteria 5444
483 2728748508 2728368998 Bacteria 8720350
484 2508695137 2508501042 Bacteria 8719808
485 2509149806 2508501128 Bacteria 8613869
486 2511395464 2511231028 Bacteria 8046582
487 2513628882 2513237092 Bacteria 8341956
488 2513639561 2513237094 Bacteria 8789602
489 2513647954 2513237095 Bacteria 8976980
490 2513658216 2513237096 Bacteria 8722461
491 2513677507 2513237098 Bacteria 9902361
492 2513694944 2513237101 Bacteria 7952346
493 2513703360 2513237102 Bacteria 7703324
494 2513862954 2513237137 Bacteria 9558895
495 2513873905 2513237139 Bacteria 8737671
496 2513920292 2513237145 Bacteria 8979722
497 2514012876 2513237161 Bacteria 8871253
498 2517102378 2517093001 Bacteria 9002274
499 2517889288 2517572143 Bacteria 9484767
500 2524435752 2524023205 Bacteria 8918781
501 2524470333 2524023210 Bacteria 9029266
502 2524536445 2524023228 Bacteria 10118060
503 2617351710 2617270735 Bacteria 9163226
504 2617377255 2617270741 Bacteria 8201522
505 2671121433 2667528175 Bacteria 7532676
506 2723842009 2721755755 Bacteria 8322773
507 2745079048 2744054633 Bacteria 8678936
508 2793063110 2791355196 Bacteria 7323613
509 2793070945 2791355197 Bacteria 8420563
510 2805915988 2802429603 Bacteria 8777136
511 2818237288 2816332527 Bacteria 8933356
512 2824602583 2824600985 Bacteria 8488197
513 2824612637 2824609381 Bacteria 8672835
514 2824621099 2824617872 Bacteria 8814715
515 2824630106 2824626560 Bacteria 8813858
516 2824640739 2824635225 Bacteria 8785348
517 2824649814 2824644064 Bacteria 8743947
518 2824654452 2824653114 Bacteria 8493680
519 2824664737 2824661429 Bacteria 9877870
520 2824674249 2824671348 Bacteria 8369588
521 2824683550 2824679649 Bacteria 8248951
522 2824690838 2824687955 Bacteria 8360029
523 2824697643 2824696289 Bacteria 8335049
524 2824709671 2824704595 Bacteria 9667483
525 2824719819 2824714736 Bacteria 8717648
526 2824727923 2824723954 Bacteria 8758240
527 2824736256 2824732956 Bacteria 7810675
528 2824750292 2824746037 Bacteria 7911610
529 2824757105 2824753945 Bacteria 9787441
530 2824768441 2824763712 Bacteria 9792355
531 2824774933 2824773399 Bacteria 8360218
532 2838124123 2838122688 Bacteria 8803140
533 2841944470 2841941048 Bacteria 8688029
534 2841951610 2841949485 Bacteria 8680857
535 2841964605 2841957949 Bacteria 8652217
536 2841969246 2841966195 Bacteria 8673214
537 2841983007 2841974524 Bacteria 8931498
538 2841985607 2841983080 Bacteria 8395090
539 2842043875 2842038055 Bacteria 8002051
540 2842052135 2842045827 Bacteria 8006841
541 2844321831 2844315083 Bacteria 8138177
542 2847931461 2847930680 Bacteria 9342022
543 2847941761 2847939898 Bacteria 8606328
544 2849082683 2849076700 Bacteria 7039503
545 2857511576 2857509624 Bacteria 7472071
546 2874610380 2874604998 Bacteria 7834745
547 2874617751 2874612657 Bacteria 8252029
548 2874624429 2874620515 Bacteria 8290088
549 2874636716 2874628541 Bacteria 8630250
550 2876812859 2876808645 Bacteria 8824342
551 2879087502 2879083081 Bacteria 8587928
552 2879107233 2879099564 Bacteria 10442239
553 2879111699 2879110137 Bacteria 8907982
554 2881370994 2881364244 Bacteria 7710352
555 2881665704 2881665667 Bacteria 8175609
556 2885371392 2885366525 Bacteria 8326213
557 2885377929 2885374607 Bacteria 8927485
558 2885392419 2885383462 Bacteria 9473874
559 2885411727 2885409591 Bacteria 9235467
560 2888379955 2888378607 Bacteria 9652610
561 2888391034 2888388044 Bacteria 7304136
562 2888420764 2888419890 Bacteria 7857137
563 2889035092 2889033259 Bacteria 9099371
564 2903727619 2903727486 Bacteria 8281579
565 2903750241 2903748898 Bacteria 9972761
566 2903773115 2903768456 Bacteria 9749579
567 2904672232 2904666416 Bacteria 8226587
568 2904692519 2904690495 Bacteria 9412302
569 2904709156
570 2904716192 2904711408 Bacteria 9771557
571 2906602891 2906602504 Bacteria 8295279
572 2906613237
573 2906633517 2906626472 Bacteria 8826946
574 2906635472 2906635258 Bacteria 8601019
575 2906647599 2906643746 Bacteria 8722424
576 2906668603 2906660503 Bacteria 8595048
577 2908747886 2908739725 Bacteria 8628932
578 2908756787 2908756301 Bacteria 8864324
579 2908775771 2908775508 Bacteria 8092255
580 2922363352 2922361189 Bacteria 7436256
581 2922378341
582 2922388629 2922386360 Bacteria 7017218
583 2922400790 2922393267 Bacteria 8285685
584 2922433734
585 2929622558 2929615660 Bacteria 9193770
586 2929631224 2929624759 Bacteria 9339455
587 2932786354 2932784394 Bacteria 9704911
588 2932805510 2932801729 Bacteria 7987968
589 2932812571 2932809354 Bacteria 9135765
590 2932822933 2932818245 Bacteria 9955613
591 2932829592 2932828146 Bacteria 9745859
592 2933584363 2933577622 Bacteria 9116884
593 2935618110 2935616580 Bacteria 9032984
594 2935634777 2935630451 Bacteria 8169952
595 2935641492 2935638405 Bacteria 10015038
596 2935652978 2935648319 Bacteria 8801166
597 2935661561 2935656913 Bacteria 8965014
598 2935669450 2935665750 Bacteria 9571747
599 2935677952 2935675223 Bacteria 9928132
600 2935689597 2935684952 Bacteria 9590419
601 2935701810 2935694250 Bacteria 9291695
602 2935707275 2935703347 Bacteria 10242284
603 2935717116 2935713505 Bacteria 9608509
604 2935730050 2935722832 Bacteria 9608746
605 2935738531 2935732158 Bacteria 9706831
606 2935749221 2935741537 Bacteria 9707219
607 2935756950 2935750917 Bacteria 9590372
608 2935764436 2935760218 Bacteria 9817913
609 2935772763 2935769743 Bacteria 7878163
610 2935778100 2935777560 Bacteria 8077691
611 2935787328 2935785616 Bacteria 7962367
612 2935795884 2935793552 Bacteria 8012592
613 2935804346 2935801545 Bacteria 9301974
614 2935817204 2935810662 Bacteria 9401221
615 2935831223 2935827899 Bacteria 10038562
616 2935841832 2935837841 Bacteria 9454360
617 2935856391 2935855204 Bacteria 9035059
618 2935871086 2935864058 Bacteria 9784707
619 2935874583 2935873716 Bacteria 9632195
620 2935962287 2935959822 Bacteria 7869783
621 2935984797 2935984226 Bacteria 8302647
622 2935994044 2935992306 Bacteria 9802711
623 2936004945 2936002035 Bacteria 9362176
624 2936015710 2936011229 Bacteria 8801034
625 2936024344 2936019824 Bacteria 8804134
626 2936031769 2936028420 Bacteria 8965941
627 2936044000 2936037263 Bacteria 9446081
628 2936051591 2936046547 Bacteria 8903709
629 2936055968 2936055302 Bacteria 8785755
630 2940562864 2940556831 Bacteria 9590747
631 2941511893 2941507105 Bacteria 8166816
632 2941519595 2941515067 Bacteria 8166720
633 2941527713 2941523033 Bacteria 8169134
634 2941532362 2941531003 Bacteria 7653939
635 2941543905 2941538514 Bacteria 9402094
636 3005475524 3005474847 Bacteria 9259049
637 3005486411 3005483717 Bacteria 7877331
638 3005589028 3005587118 Bacteria 7794411
639 3005602179 3005594810 Bacteria 8716512
640 3005717935 3005710791 Bacteria 7622528
641 3005724969 3005718088 Bacteria 8283608
642 8006931366 8006926726 Bacteria 6749210
643 8006935772 8006933436 Bacteria 10410654
644 8006968295 8006964411 Bacteria 8966052
645 8006975691 8006973647 Bacteria 10679141
646 8006985970 8006984368 Bacteria 9651211
647 8007000225 8006994254 Bacteria 8309700
648 8016518618 8016511872 Bacteria 9921665
649 8016526588 8016522445 Bacteria 8156687
650 8016557206 8016548790 Bacteria 8155074
651 8016565557 8016557553 Bacteria 8154380
652 8016582522 8016575299 Bacteria 8154085
653 8016586803 8016583857 Bacteria 10421953
654 8016603174 8016595262 Bacteria 8149947
655 8017058052 8017057580 Bacteria 10023680
656 8019531495 8019530166 Bacteria 8155624
657 8019540036 8019538911 Bacteria 7872763
658 8019563022 8019555841 Bacteria 9642137
659 8019573100 8019565922 Bacteria 9639779
660 8019577682 8019576017 Bacteria 10049540
661 8019595781 8019586578 Bacteria 10212056
662 8019612553 8019608314 Bacteria 10042931
663 8055751009 8055742211 Bacteria 9226248
664 8056676201 8056673599 Bacteria 7871253
665 8056685161 8056681323 Bacteria 8472857
666 8056694127 8056689827 Bacteria 6712655
667 JGI24739J22299_10015288
668 JGI25406J46586_10000009
669 JGI25406J46586_10001070
670 JGI25160J50197_1002538
671 JGI25160J50197_1009004
672 JGI25404J52841_10001198
673 Ga0055531_10005473
674 Ga0065165_1001210
675 Ga0065707_10137830
676 Ga0070683_100053069
677 Ga0070670_100152250
678 Ga0068869_100034026
679 Ga0068869_100169558
680 Ga0070680_100048038
681 Ga0070680_100132181
682 Ga0070682_100170373
683 Ga0068868_100040285
684 Ga0068868_100142943
685 Ga0068868_100144882
686 Ga0070689_100046181
687 Ga0070668_100038985
688 Ga0070668_100060858
689 Ga0070674_100021497
690 Ga0070667_100074531
691 Ga0070714_100001031
692 Ga0070714_100013699
693 Ga0070714_100056936
694 Ga0070713_100004657
695 Ga0070713_100020929
696 Ga0070713_100250717
697 Ga0070710_10000834
698 Ga0070710_10001458
699 Ga0070711_100014662
700 Ga0070711_100043503
701 Ga0070711_100201250
702 Ga0070663_100015495
703 Ga0070663_100020156
704 Ga0070663_100062846
705 Ga0070678_100157001
706 Ga0070681_10013363
707 Ga0070681_10112328
708 Ga0070681_10178418
709 Ga0070679_100023653
710 Ga0070679_100028402
711 Ga0070679_100034223
712 Ga0070679_100067914
713 Ga0070684_100008002
714 Ga0070684_100021034
715 Ga0068853_100063847
716 Ga0070672_100184293
717 Ga0070686_100091669
718 Ga0070695_100107386
719 Ga0070704_100094487
720 Ga0068855_100012487
721 Ga0068855_100013741
722 Ga0068855_100029724
723 Ga0068855_100052549
724 Ga0068856_100066827
725 Ga0068856_100127792
726 Ga0068856_100144058
727 Ga0068852_100003441
728 Ga0068859_100110591
729 Ga0068861_100031166
730 Ga0068863_100080439
731 Ga0068858_100121940
732 Ga0068860_100273762
733 Ga0068862_100028869
734 Ga0081455_10010356
735 Ga0081455_10018973
736 Ga0081540_1002606
737 Ga0081540_1002760
738 Ga0081540_1006050
739 Ga0081540_1007518
740 Ga0081540_1045711
741 Ga0081540_1049113
742 Ga0081539_10000048
743 Ga0081539_10000530
744 Ga0081539_10089388
745 Ga0070717_10001838
746 Ga0070717_10004617
747 Ga0075365_10102689
748 Ga0075368_10002838
749 Ga0075368_10007471
750 Ga0075364_10056950
751 Ga0070715_10000830
752 Ga0070716_100141005
753 Ga0070712_100001393
754 Ga0070712_100008227
755 Ga0075367_10086547
756 Ga0075369_10036691
757 Ga0075366_10096413
758 Ga0075370_10024167
759 Ga0075370_10113201
760 Ga0097620_100110589
761 Ga0099824_1008841
762 Ga0099824_1015031
763 Ga0099822_1015114
764 Ga0099794_10035112
765 Ga0099795_10035819
766 Ga0105240_10009432
767 Ga0105240_10011824
768 Ga0105240_10018842
769 Ga0105240_10027328
770 Ga0105245_10023002
771 Ga0105245_10050732
772 Ga0105243_10061135
773 Ga0105241_10026860
774 Ga0105248_10008995
775 Ga0105248_10012317
776 Ga0105248_10059046
777 Ga0105237_10003797
778 Ga0105237_10012543
779 Ga0105237_10041548
780 Ga0105237_10064499
781 Ga0105238_10011156
782 Ga0105238_10119390
783 Ga0105239_10004474
784 Ga0105239_10014534
785 Ga0105239_10030295
786 Ga0105239_10041787
787 Ga0105239_10058209
788 Ga0105239_10060804
789 Ga0105239_10238561
790 Ga0105246_10054485
791 Ga0157370_10007832
792 Ga0157369_10007527
793 Ga0157369_10031113
794 Ga0157374_10029818
795 Ga0157374_10055719
796 Ga0157378_10211746
797 Ga0163162_10114827
798 Ga0163162_10292258
799 Ga0157372_10091053
800 Ga0163163_10014414
801 Ga0163163_10171134
802 Ga0163163_10178844
803 Ga0157380_10144831
804 Ga0157380_10159192
805 Ga0157379_10070151
806 Ga0157376_10017299
807 Ga0157376_10030357
808 Ga0157376_10095047
809 Ga0214544_1000087
810 Ga0214542_1000018
811 Ga0214545_1000009
812 Ga0214543_1000037
813 Ga0213874_10025006
814 Ga0224712_10047378
815 Ga0209563_101775
816 Ga0209677_100335
817 Ga0209148_1000568
818 Ga0209233_1001962
819 Ga0209233_1002050
820 Ga0209233_1005876
821 Ga0209455_1002928
822 Ga0209455_1005109
823 Ga0209564_1003394
824 Ga0209564_1007659
825 Ga0209758_1000015
826 Ga0209758_1000224
827 Ga0209758_1000972
828 Ga0209758_1031759
829 Ga0207426_1000201
830 Ga0207426_1000617
831 Ga0207426_1010243
832 Ga0209257_1000440
833 Ga0207653_10020686
834 Ga0207692_10000538
835 Ga0207710_10009375
836 Ga0207688_10051569
837 Ga0207647_10003185
838 Ga0207685_10006326
839 Ga0207699_10001601
840 Ga0207699_10083625
841 Ga0207645_10182939
842 Ga0207705_10026076
843 Ga0207654_10012270
844 Ga0207654_10041568
845 Ga0207707_10014215
846 Ga0207707_10016113
847 Ga0207707_10159316
848 Ga0207695_10000065
849 Ga0207695_10020475
850 Ga0207671_10001858
851 Ga0207671_10034492
852 Ga0207671_10046748
853 Ga0207671_10097843
854 Ga0207693_10000633
855 Ga0207693_10001776
856 Ga0207693_10007348
857 Ga0207693_10180595
858 Ga0207660_10053049
859 Ga0207657_10008146
860 Ga0207652_10024973
861 Ga0207694_10015674
862 Ga0207694_10127762
863 Ga0207687_10129242
864 Ga0207700_10069205
865 Ga0207700_10213764
866 Ga0207664_10006879
867 Ga0207664_10026778
868 Ga0207664_10050188
869 Ga0207664_10146374
870 Ga0207644_10080507
871 Ga0207706_10108099
872 Ga0207709_10056016
873 Ga0207669_10005920
874 Ga0207665_10003827
875 Ga0207665_10164534
876 Ga0207711_10019093
877 Ga0207689_10026612
878 Ga0207689_10065856
879 Ga0207689_10111762
880 Ga0207661_10012674
881 Ga0207667_10011217
882 Ga0207667_10043643
883 Ga0207651_10115390
884 Ga0207712_10169572
885 Ga0207703_10149822
886 Ga0207639_10098210
887 Ga0207678_10004673
888 Ga0207678_10026497
889 Ga0207678_10070207
890 Ga0207678_10084415
891 Ga0207708_10023977
892 Ga0207702_10000056
893 Ga0207702_10168562
894 Ga0207702_10202389
895 Ga0207674_10018427
896 Ga0207675_100122588
897 Ga0207675_100153161
898 Ga0207675_100182958
899 Ga0207683_10005111
900 Ga0207683_10084162
901 Ga0207698_10191821
902 Ga0209389_1000029
903 Ga0209389_1000076
904 Ga0209589_1000012
905 Ga0209589_1000013
906 Ga0209589_1000017
907 Ga0209489_100013
908 Ga0209489_100018
909 Ga0209489_100416
910 Ga0209700_100014
911 Ga0209700_100028
912 Ga0209588_1017089
913 Ga0209813_10001321
914 Ga0268266_10007480
915 Ga0268266_10136132
916 Ga0268265_10013210
917 Ga0268265_10023293
918 Ga0268264_10152983
919 Ga0265337_1006176
920 Ga0265326_10002792
921 Ga0265319_1009715
922 Ga0265334_10003782
923 Ga0265336_10000430
924 Ga0307517_10002211
925 Ga0307515_10059503
926 Ga0265338_10000024
927 Ga0307513_10260541
928 Ga0307509_10150050
929 Ga0307413_10082617
930 Ga0307409_100208171
931 Ga0307510_10020522
932 Ga0315911_1000018
933 Ga0373934_0006395
934 Ga0373923_0013875
935 Ga0373953_0032368
936 Ga0373954_0005748
937 Ga0373956_0003734
938 Ga0373957_0001574
939 Ga0373955_0003197
940 Ga0373924_0002150
941 Ga0373927_0035793
942 Ga0373933_0000114
943 Ga0373933_0001425
944 Ga0373933_0038701
945 Ga0373947_0001708
946 Ga0373937_0025351
947 Ga0373925_0025137
948 Ga0395900_0003234
949 Ga0395900_0005520
950 Ga0395900_0046530
951 Ga0395900_0057685
952 Ga0395900_0131044
953 Ga0395898_0003112
954 Ga0395898_0007427
955 Ga0395898_0016827
956 Ga0395905_0059181
957 Ga0395901_0002551
958 Ga0395901_0061158
959 Ga0436365_0046402
960 Ga0436365_1398633
961 Ga0436365_1444460
962 Ga0436365_1771573
963 Ga0436360_0296386
964 Ga0436363_1084220
965 Ga0439458_0023058
966 Ga0466969_0051865
967 Ga0466972_0000103
968 Ga0466965_0066852
969 Ga0466966_0000378
970 Ga0466966_0067717
971 Ga0466961_0000129
972 Ga0466964_0021963
973 Ga0466964_0026013
974 Ga0466968_0064036
975 Ga0466959_0002230
976 Ga0466959_0005547
977 Ga0466958_0111668
978 Ga0466967_0092454
979 Ga0495592_0019851
980 Ga0495592_0035153
981 Ga0495603_0004736
982 Ga0495603_0023990
983 Ga0495603_0069128
984 Ga0495590_0044751
985 Ga0495629_0002236
986 Ga0495629_0020919
987 Ga0495638_0002281
988 Ga0495638_0061027
989 Ga0495638_0092651
990 Ga0495651_0013486
991 Ga0495651_0033024
992 Ga0495651_0041220
993 Ga0495653_0021802
994 Ga0495653_0075213
995 Ga0495664_0011375
996 Ga0495664_0027628
997 Ga0495585_0051396
998 Ga0495606_0000265
999 Ga0495606_0067938
1000 Ga0495608_0048212
1001 Ga0495608_0113842
1002 Ga0495628_0018214
1003 Ga0495631_0037252
1004 Ga0495643_0007059
1005 Ga0495648_0009380
1006 Ga0495652_0023860
1007 Ga0495652_0024834
1008 Ga0495652_0084156
1009 Ga0495640_0004314
1010 Ga0495587_0013075
1011 Ga0495587_0077851
1012 Ga0495609_0014031
1013 Ga0495597_0037367
1014 Ga0495645_0004845
1015 Ga0495645_0046270
1016 Ga0495622_0013276
1017 Ga0495667_0020935
1018 Ga0495667_0034548
1019 Ga0495656_0021628
1020 Ga0495656_0052136
1021 Ga0495668_0034272
1022 Ga0495668_0040883
1023 Ga0495634_0148553
1024 Ga0495634_0151159
1025 Ga0495611_0072525
1026 Ga0495635_0005971
1027 Ga0495635_0014497
1028 Ga0495635_0018394
1029 Ga0495588_0013281
1030 Ga0495657_0009210
1031 Ga0495657_0011243
1032 Ga0495657_0022914
1033 Ga0495599_0007860
1034 Ga0495599_0016810
1035 Ga0495623_0006918
1036 Ga0495623_0088147
1037 Ga0495646_0004493
1038 Ga0495669_0010508
1039 Ga0495613_0030602
1040 Ga0495624_0009621
1041 Ga0495589_0030536
1042 Ga0495600_0011471
1043 Ga0495600_0096457
1044 Ga0495604_0002997
1045 Ga0495604_0117654
1046 Ga0495674_0041857
1047 Ga0495672_0008522
1048 Ga0495680_0031781
1049 Ga0495683_0084889
1050 Ga0495687_009324
1051 Ga0495675_0100696
1052 Ga0495677_0044525
1053 Ga0495684_0013146
1054 Ga0495684_0218368
1055 Ga0495686_0103257
1056 Ga0495593_0000594
1057 Ga0495602_0017685
1058 Ga0495602_0072963
1059 Ga0496100_0046229
1060 Ga0496101_0005146
1061 Ga0496102_0011419
1062 Ga0496102_0027952
1063 Ga0496102_0240976
1064 Ga0496103_0038586
1065 Ga0496104_0010370
1066 Ga0496104_0061130
1067 Ga0496105_0028888
1068 Ga0496105_0035284
1069 Ga0496105_0113267
1070 Ga0496106_0019638
1071 Ga0496107_0002869
1072 Ga0496107_0066872
1073 Ga0496109_0040504
1074 Ga0496109_0053263
1075 Ga0496109_0054520
1076 Ga0496110_0036926
1077 Ga0496112_0000019
1078 Ga0496112_0189961
1079 Ga0496114_0003910
1080 Ga0496115_0001711
1081 Ga0496115_0017903
1082 Ga0496115_0026064
1083 Ga0496117_0037409
1084 Ga0496117_0094132
1085 Ga0496118_0016791
1086 Ga0496118_0023505
1087 Ga0496118_0035533
1088 Ga0496118_0052010
1089 Ga0496119_0017281
1090 Ga0496120_0016403
1091 Ga0496120_0018940
1092 Ga0496121_0196311
1093 Ga0496122_0040423
1094 Ga0496125_0020027
1095 Ga0496126_0006097
1096 Ga0496126_0013805
1097 Ga0496126_0021180
1098 Ga0496126_0026854
1099 Ga0496126_0108106
1100 Ga0495678_048591
1101 Ga0495682_0002432
1102 Ga0501043_0028838
1103 Ga0501047_0100267
1104 Ga0501047_0192123
1105 Ga0501067_0105193
1106 Ga0501070_0080176
1107 Ga0501071_0210633
1108 Ga0501073_0158403
1109 Ga0501044_0028580
1110 nmdc:mga0yw44_64261_c1
1111 nmdc:mga0k408_135568_c1
1112 nmdc:mga0k408_53128_c1
1113 nmdc:mga07m45_139093_c1
1114 nmdc:mga05p37_113442_c1
1115 nmdc:mga0sz30_26279_c1
1116 Ga0495601_0034250
1117 Ga0500635_0001063
1118 Ga0500635_0001671
1119 Ga0495595_0000449
1120 Ga0495619_0020998
1121 Ga0495619_0023495
1122 Ga0495619_0055079
1123 Ga0500643_000062
1124 Ga0500647_0038494
1125 Ga0500566_0000065
1126 Ga0500566_0007439
1127 Ga0500640_022047
1128 Ga0500641_0005167
1129 Ga0500554_000253
1130 Ga0500569_004894
1131 Ga0500572_001831
1132 Ga0500594_0023449
1133 Ga0500595_000253
1134 Ga0500595_002443
1135 Ga0500595_007200
1136 Ga0500614_009115
1137 Ga0500559_0000211
1138 Ga0500559_0010697
1139 Ga0500559_0012818
1140 Ga0500603_000158
1141 Ga0500603_007611
1142 Ga0500636_0000075
1143 Ga0500637_0000157
1144 Ga0500637_0022471
1145 Ga0500637_0143551
1146 Ga0500645_014422
1147 Ga0500596_002342
1148 Ga0500661_000942
1149 2728748508
1150 2508695137
1151 2509149806
1152 2511395464
1153 2513628882
1154 2513639561
1155 2513647954
1156 2513658216
1157 2513677507
1158 2513694944
1159 2513703360
1160 2513862954
1161 2513873905
1162 2513920292
1163 2514012876
1164 2517102378
1165 2517889288
1166 2524435752
1167 2524470333
1168 2524536445
1169 2617351710
1170 2617377255
1171 2671121433
1172 2723842009
1173 2745079048
1174 2793063110
1175 2793070945
1176 2805915988
1177 2818237288
1178 2824602583
1179 2824612637
1180 2824621099
1181 2824630106
1182 2824640739
1183 2824649814
1184 2824654452
1185 2824664737
1186 2824674249
1187 2824683550
1188 2824690838
1189 2824697643
1190 2824709671
1191 2824719819
1192 2824727923
1193 2824736256
1194 2824750292
1195 2824757105
1196 2824768441
1197 2824774933
1198 2838124123
1199 2841944470
1200 2841951610
1201 2841964605
1202 2841969246
1203 2841983007
1204 2841985607
1205 2842043875
1206 2842052135
1207 2844321831
1208 2847931461
1209 2847941761
1210 2849082683
1211 2857511576
1212 2874610380
1213 2874617751
1214 2874624429
1215 2874636716
1216 2876812859
1217 2879087502
1218 2879107233
1219 2879111699
1220 2881370994
1221 2881665704
1222 2885371392
1223 2885377929
1224 2885392419
1225 2885411727
1226 2888379955
1227 2888391034
1228 2888420764
1229 2889035092
1230 2903727619
1231 2903750241
1232 2903773115
1233 2904672232
1234 2904692519
1235 2904709156
1236 2904716192
1237 2906602891
1238 2906613237
1239 2906633517
1240 2906635472
1241 2906647599
1242 2906668603
1243 2908747886
1244 2908756787
1245 2908775771
1246 2922363352
1247 2922378341
1248 2922388629
1249 2922400790
1250 2922433734
1251 2929622558
1252 2929631224
1253 2932786354
1254 2932805510
1255 2932812571
1256 2932822933
1257 2932829592
1258 2933584363
1259 2935618110
1260 2935634777
1261 2935641492
1262 2935652978
1263 2935661561
1264 2935669450
1265 2935677952
1266 2935689597
1267 2935701810
1268 2935707275
1269 2935717116
1270 2935730050
1271 2935738531
1272 2935749221
1273 2935756950
1274 2935764436
1275 2935772763
1276 2935778100
1277 2935787328
1278 2935795884
1279 2935804346
1280 2935817204
1281 2935831223
1282 2935841832
1283 2935856391
1284 2935871086
1285 2935874583
1286 2935962287
1287 2935984797
1288 2935994044
1289 2936004945
1290 2936015710
1291 2936024344
1292 2936031769
1293 2936044000
1294 2936051591
1295 2936055968
1296 2940562864
1297 2941511893
1298 2941519595
1299 2941527713
1300 2941532362
1301 2941543905
1302 3005475524
1303 3005486411
1304 3005589028
1305 3005602179
1306 3005717935
1307 3005724969
1308 8006931366
1309 8006935772
1310 8006968295
1311 8006975691
1312 8006985970
1313 8007000225
1314 8016518618
1315 8016526588
1316 8016557206
1317 8016565557
1318 8016582522
1319 8016586803
1320 8016603174
1321 8017058052
1322 8019531495
1323 8019540036
1324 8019563022
1325 8019573100
1326 8019577682
1327 8019595781
1328 8019612553
1329 8055751009
1330 8056676201
1331 8056685161
1332 8056694127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

20

331

0.9

PF00083

Sugar_tr

Sugar (and other) transporter

26

195

0.85

PF07690

MFS_1

Major Facilitator Superfamily

293

462

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dwi-assembly1.cif.gz_A molecular mechanism of sialic acid transport mediated by sialin 0.8181 23 389
8ex4-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1) 0.7813 21 400
8ex6-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1*) 0.7792 21 400
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.7718 23 384
7t3n-assembly1.cif.gz_A r184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2) 0.7479 23 387
ID Description Score Start End Superfamily
af_P0AA76_9_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9434 18 196 1.20.1250.20
af_P0AA80_9_209_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.942 23 199 1.20.1250.20
af_Q66GI9_106_299_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9378 23 204 1.20.1250.20
af_P39398_32_230_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9345 23 199 1.20.1250.20
af_P0AA78_1_199_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9308 23 202 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7Y8L4N8-F1-model_v4 MFS transporter 0.9073 23 161 GO:0012505
GO:0016020
GO:0035435
GO:0061513
AF-A0A425I806-F1-model_v4 Transporter, major facilitator family protein 0.9038 23 197 GO:0016020
GO:0022857
AF-A0A1B6DU92-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8954 21 177 GO:0016020
GO:0022857
AF-A0A2V7WUS4-F1-model_v4 MFS transporter 0.8946 6 192 GO:0016020
GO:0022857
AF-A0A6G3VUH5-F1-model_v4 deleted 0.8924 26 198

Map