F473615
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 664 | 354 | 662 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10750842|Ga0105240_107508421 |
| Length | 131 |
| Sequence | MHCVHALESGRRLKSQALKFPHRAMSISLTESAAQRVKTFLTARGRGLGLRLGVRKTGCSGFAYVINYADDANPDDLVFEDRGVKVFVDPASLSLIDGTIVDFVKQGLNEAFRFKNPNVKGECGCGESFSV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 114 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 120 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 193 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 200 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 201 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 202 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 203 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 204 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 222 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 225 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 227 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 232 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 235 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 236 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 237 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 238 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 239 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 240 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 243 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 244 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 245 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 246 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 247 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 248 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 249 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 250 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 251 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 252 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 253 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 254 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 255 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 256 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 257 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 287 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 288 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 300 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 301 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 302 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 303 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 304 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 305 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 306 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 307 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 336 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 337 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 338 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 339 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 340 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 341 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 342 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 343 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 344 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 345 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 346 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 347 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 348 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 352 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 353 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 354 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.18 |
| Metatranscriptomes | 4.52 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.86 |
| Nodule | 0 |
| Rhizoplane | 4.07 |
| Rhizosphere | 87.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058863_11957120 | 3300004799 | Bacteria | 929 |
| 2 | Ga0058861_11958246 | 3300004800 | Unclassified | 669 |
| 3 | Ga0058862_12257844 | 3300004803 | Unclassified | 596 |
| 4 | Ga0065704_10465469 | 3300005289 | Bacteria | 693 |
| 5 | Ga0065715_10247026 | 3300005293 | Bacteria | 1180 |
| 6 | Ga0065715_10808713 | 3300005293 | Bacteria | 607 |
| 7 | Ga0065707_10081981 | 3300005295 | Bacteria | 26321 |
| 8 | Ga0070658_10461614 | 3300005327 | Unclassified | 1095 |
| 9 | Ga0070676_11008436 | 3300005328 | Bacteria | 625 |
| 10 | Ga0070683_100145553 | 3300005329 | Bacteria | 2245 |
| 11 | Ga0070690_100002121 | 3300005330 | Bacteria | 10594 |
| 12 | Ga0070690_100086925 | 3300005330 | Bacteria | 2053 |
| 13 | Ga0070670_100001924 | 3300005331 | Bacteria | 17002 |
| 14 | Ga0070670_100099387 | 3300005331 | Bacteria | 2503 |
| 15 | Ga0070670_100933581 | 3300005331 | Unclassified | 787 |
| 16 | Ga0068869_100035837 | 3300005334 | Bacteria | 3519 |
| 17 | Ga0068869_100481751 | 3300005334 | Bacteria | 1033 |
| 18 | Ga0070666_10011147 | 3300005335 | Bacteria | 5633 |
| 19 | Ga0070666_11355469 | 3300005335 | Unclassified | 531 |
| 20 | Ga0070680_100147093 | 3300005336 | Bacteria | 1977 |
| 21 | Ga0070680_100151322 | 3300005336 | Bacteria | 1948 |
| 22 | Ga0070680_100242182 | 3300005336 | Bacteria | 1524 |
| 23 | Ga0070682_100894863 | 3300005337 | Bacteria | 729 |
| 24 | Ga0068868_100001397 | 3300005338 | Bacteria | 16654 |
| 25 | Ga0068868_100023979 | 3300005338 | Bacteria | 4624 |
| 26 | Ga0070660_100809383 | 3300005339 | Bacteria | 788 |
| 27 | Ga0070689_100001863 | 3300005340 | Bacteria | 13592 |
| 28 | Ga0070689_100024663 | 3300005340 | Bacteria | 4511 |
| 29 | Ga0070687_100344915 | 3300005343 | Bacteria | 959 |
| 30 | Ga0070661_100166812 | 3300005344 | Bacteria | 1671 |
| 31 | Ga0070661_100212839 | 3300005344 | Bacteria | 1480 |
| 32 | Ga0070661_100444680 | 3300005344 | Bacteria | 1031 |
| 33 | Ga0070661_100631639 | 3300005344 | Bacteria | 868 |
| 34 | Ga0070668_102218060 | 3300005347 | Unclassified | 507 |
| 35 | Ga0070669_100330030 | 3300005353 | Bacteria | 1234 |
| 36 | Ga0070675_100432322 | 3300005354 | Bacteria | 1178 |
| 37 | Ga0070671_100010034 | 3300005355 | Bacteria | 7606 |
| 38 | Ga0070671_100042592 | 3300005355 | Bacteria | 3774 |
| 39 | Ga0070671_100312097 | 3300005355 | Bacteria | 1339 |
| 40 | Ga0070671_101345848 | 3300005355 | Bacteria | 630 |
| 41 | Ga0070674_100647812 | 3300005356 | Bacteria | 898 |
| 42 | Ga0070673_100070874 | 3300005364 | Bacteria | 2799 |
| 43 | Ga0070673_100077826 | 3300005364 | Bacteria | 2681 |
| 44 | Ga0070673_100109305 | 3300005364 | Bacteria | 2290 |
| 45 | Ga0070673_100846816 | 3300005364 | Bacteria | 846 |
| 46 | Ga0070667_100015817 | 3300005367 | Bacteria | 6242 |
| 47 | Ga0070667_100135150 | 3300005367 | Bacteria | 2156 |
| 48 | Ga0070667_100203437 | 3300005367 | Bacteria | 1757 |
| 49 | Ga0070667_101889047 | 3300005367 | Bacteria | 562 |
| 50 | Ga0070703_10193838 | 3300005406 | Unclassified | 793 |
| 51 | Ga0070703_10458897 | 3300005406 | Bacteria | 566 |
| 52 | Ga0070709_10010626 | 3300005434 | Bacteria | 5104 |
| 53 | Ga0070709_10291274 | 3300005434 | Bacteria | 1190 |
| 54 | Ga0070709_11078165 | 3300005434 | Bacteria | 642 |
| 55 | Ga0070714_100639068 | 3300005435 | Bacteria | 1024 |
| 56 | Ga0070713_101217907 | 3300005436 | Unclassified | 729 |
| 57 | Ga0070713_101745695 | 3300005436 | Bacteria | 604 |
| 58 | Ga0070701_10060226 | 3300005438 | Bacteria | 1998 |
| 59 | Ga0070711_100103312 | 3300005439 | Bacteria | 2077 |
| 60 | Ga0070711_100432853 | 3300005439 | Unclassified | 1074 |
| 61 | Ga0070705_100007578 | 3300005440 | Bacteria | 5347 |
| 62 | Ga0070700_100048866 | 3300005441 | Bacteria | 2623 |
| 63 | Ga0070694_100392628 | 3300005444 | Unclassified | 1084 |
| 64 | Ga0070678_100795147 | 3300005456 | Bacteria | 858 |
| 65 | Ga0070662_100637218 | 3300005457 | Unclassified | 898 |
| 66 | Ga0070681_10001620 | 3300005458 | Bacteria | 20049 |
| 67 | Ga0070681_10002862 | 3300005458 | Bacteria | 15945 |
| 68 | Ga0070681_10006571 | 3300005458 | Bacteria | 11322 |
| 69 | Ga0070681_10041707 | 3300005458 | Bacteria | 4600 |
| 70 | Ga0070681_10053934 | 3300005458 | Bacteria | 4006 |
| 71 | Ga0070681_10132051 | 3300005458 | Bacteria | 2429 |
| 72 | Ga0068867_100008135 | 3300005459 | Bacteria | 7411 |
| 73 | Ga0070685_10232602 | 3300005466 | Bacteria | 1213 |
| 74 | Ga0070685_10407011 | 3300005466 | Bacteria | 943 |
| 75 | Ga0070707_100124009 | 3300005468 | Bacteria | 2509 |
| 76 | Ga0070707_101596557 | 3300005468 | Bacteria | 619 |
| 77 | Ga0070698_100509024 | 3300005471 | Bacteria | 1142 |
| 78 | Ga0070699_100042960 | 3300005518 | Bacteria | 3913 |
| 79 | Ga0070679_100005320 | 3300005530 | Bacteria | 11910 |
| 80 | Ga0070679_100017074 | 3300005530 | Bacteria | 7016 |
| 81 | Ga0070679_100118799 | 3300005530 | Bacteria | 2628 |
| 82 | Ga0070679_100458135 | 3300005530 | Bacteria | 1220 |
| 83 | Ga0070684_100040924 | 3300005535 | Bacteria | 3993 |
| 84 | Ga0070684_100177126 | 3300005535 | Bacteria | 1938 |
| 85 | Ga0068853_100165848 | 3300005539 | Bacteria | 1996 |
| 86 | Ga0068853_100173829 | 3300005539 | Bacteria | 1950 |
| 87 | Ga0070672_100082670 | 3300005543 | Bacteria | 2576 |
| 88 | Ga0070686_100001796 | 3300005544 | Bacteria | 11966 |
| 89 | Ga0070686_100011605 | 3300005544 | Bacteria | 5003 |
| 90 | Ga0070695_100015703 | 3300005545 | Bacteria | 4574 |
| 91 | Ga0070695_100241668 | 3300005545 | Bacteria | 1310 |
| 92 | Ga0070695_100709838 | 3300005545 | Bacteria | 799 |
| 93 | Ga0070696_101304529 | 3300005546 | Bacteria | 616 |
| 94 | Ga0070693_100014873 | 3300005547 | Bacteria | 3998 |
| 95 | Ga0070665_100008574 | 3300005548 | Bacteria | 10347 |
| 96 | Ga0070665_100057769 | 3300005548 | Bacteria | 3890 |
| 97 | Ga0070665_100107778 | 3300005548 | Unclassified | 2788 |
| 98 | Ga0070665_100364384 | 3300005548 | Bacteria | 1452 |
| 99 | Ga0070665_100592222 | 3300005548 | Unclassified | 1122 |
| 100 | Ga0070704_100223321 | 3300005549 | Bacteria | 1533 |
| 101 | Ga0068855_100007775 | 3300005563 | Bacteria | 12949 |
| 102 | Ga0068855_100060642 | 3300005563 | Bacteria | 4423 |
| 103 | Ga0068855_100362959 | 3300005563 | Bacteria | 1593 |
| 104 | Ga0068855_100483742 | 3300005563 | Bacteria | 1347 |
| 105 | Ga0070664_100007434 | 3300005564 | Bacteria | 8841 |
| 106 | Ga0070664_100061436 | 3300005564 | Bacteria | 3202 |
| 107 | Ga0070664_100495069 | 3300005564 | Bacteria | 1126 |
| 108 | Ga0068857_100149355 | 3300005577 | Bacteria | 2116 |
| 109 | Ga0068857_100512187 | 3300005577 | Bacteria | 1127 |
| 110 | Ga0068854_100286195 | 3300005578 | Bacteria | 1329 |
| 111 | Ga0068856_100097244 | 3300005614 | Bacteria | 2933 |
| 112 | Ga0068856_100252331 | 3300005614 | Bacteria | 1779 |
| 113 | Ga0068856_100647874 | 3300005614 | Bacteria | 1077 |
| 114 | Ga0068856_100924190 | 3300005614 | Bacteria | 891 |
| 115 | Ga0070702_100002720 | 3300005615 | Bacteria | 7730 |
| 116 | Ga0070702_100003056 | 3300005615 | Bacteria | 7405 |
| 117 | Ga0068852_100130815 | 3300005616 | Bacteria | 2311 |
| 118 | Ga0068852_101176186 | 3300005616 | Bacteria | 788 |
| 119 | Ga0068852_101322112 | 3300005616 | Bacteria | 743 |
| 120 | Ga0068859_100012440 | 3300005617 | Bacteria | 8563 |
| 121 | Ga0068859_100027419 | 3300005617 | Bacteria | 5713 |
| 122 | Ga0068859_100049529 | 3300005617 | Bacteria | 4218 |
| 123 | Ga0068859_102966282 | 3300005617 | Bacteria | 519 |
| 124 | Ga0068864_100006569 | 3300005618 | Bacteria | 9522 |
| 125 | Ga0068864_100017803 | 3300005618 | Bacteria | 5927 |
| 126 | Ga0068861_100125587 | 3300005719 | Bacteria | 2075 |
| 127 | Ga0068861_100191922 | 3300005719 | Bacteria | 1708 |
| 128 | Ga0068851_10546132 | 3300005834 | Bacteria | 700 |
| 129 | Ga0068870_10009276 | 3300005840 | Bacteria | 4467 |
| 130 | Ga0068863_100002915 | 3300005841 | Bacteria | 16961 |
| 131 | Ga0068863_100021655 | 3300005841 | Bacteria | 6131 |
| 132 | Ga0068858_100001624 | 3300005842 | Bacteria | 22933 |
| 133 | Ga0068858_100003897 | 3300005842 | Bacteria | 14743 |
| 134 | Ga0068858_100008115 | 3300005842 | Bacteria | 10102 |
| 135 | Ga0068858_100008369 | 3300005842 | Bacteria | 9950 |
| 136 | Ga0068860_100001031 | 3300005843 | Bacteria | 30723 |
| 137 | Ga0068860_100003582 | 3300005843 | Bacteria | 15965 |
| 138 | Ga0068860_100577980 | 3300005843 | Bacteria | 1127 |
| 139 | Ga0068862_100002789 | 3300005844 | Bacteria | 15310 |
| 140 | Ga0068862_100033230 | 3300005844 | Bacteria | 4359 |
| 141 | Ga0068862_100420118 | 3300005844 | Bacteria | 1255 |
| 142 | Ga0068862_101037158 | 3300005844 | Bacteria | 812 |
| 143 | Ga0068862_102252761 | 3300005844 | Bacteria | 556 |
| 144 | Ga0081455_10325722 | 3300005937 | Bacteria | 1092 |
| 145 | Ga0070715_10223626 | 3300006163 | Bacteria | 969 |
| 146 | Ga0070716_100033769 | 3300006173 | Bacteria | 2801 |
| 147 | Ga0070712_100039915 | 3300006175 | Bacteria | 3214 |
| 148 | Ga0075366_10332343 | 3300006195 | Bacteria | 932 |
| 149 | Ga0097621_100154132 | 3300006237 | Bacteria | 1971 |
| 150 | Ga0097621_100197877 | 3300006237 | Unclassified | 1743 |
| 151 | Ga0097621_100233878 | 3300006237 | Bacteria | 1605 |
| 152 | Ga0097621_100501680 | 3300006237 | Bacteria | 1099 |
| 153 | Ga0097621_101478377 | 3300006237 | Bacteria | 644 |
| 154 | Ga0068871_100012828 | 3300006358 | Bacteria | 6202 |
| 155 | Ga0068871_100017723 | 3300006358 | Bacteria | 5396 |
| 156 | Ga0068871_100787681 | 3300006358 | Bacteria | 876 |
| 157 | Ga0068871_100885703 | 3300006358 | Bacteria | 827 |
| 158 | Ga0068871_101868540 | 3300006358 | Bacteria | 571 |
| 159 | Ga0075428_100277023 | 3300006844 | Bacteria | 1805 |
| 160 | Ga0097620_100012440 | 3300006931 | Bacteria | 8563 |
| 161 | Ga0097620_100027419 | 3300006931 | Bacteria | 5713 |
| 162 | Ga0097620_100049529 | 3300006931 | Bacteria | 4218 |
| 163 | Ga0097620_102966061 | 3300006931 | Bacteria | 519 |
| 164 | Ga0075435_101127205 | 3300007076 | Bacteria | 686 |
| 165 | Ga0099794_10040579 | 3300007265 | Bacteria | 2214 |
| 166 | Ga0099795_10028868 | 3300007788 | Bacteria | 1891 |
| 167 | Ga0105250_10414141 | 3300009092 | Archaea | 600 |
| 168 | Ga0105240_10004508 | 3300009093 | Bacteria | 21175 |
| 169 | Ga0105240_10006950 | 3300009093 | Bacteria | 16531 |
| 170 | Ga0105240_10034801 | 3300009093 | Bacteria | 6495 |
| 171 | Ga0105240_10123818 | 3300009093 | Bacteria | 3110 |
| 172 | Ga0105240_10137039 | 3300009093 | Bacteria | 2931 |
| 173 | Ga0105240_10164797 | 3300009093 | Bacteria | 2629 |
| 174 | Ga0105240_10315115 | 3300009093 | Bacteria | 1785 |
| 175 | Ga0105240_10371832 | 3300009093 | Bacteria | 1616 |
| 176 | Ga0105240_10750842 | 3300009093 | Unclassified | 1061 |
| 177 | Ga0111539_10522401 | 3300009094 | Bacteria | 1383 |
| 178 | Ga0111539_13274792 | 3300009094 | Bacteria | 522 |
| 179 | Ga0105245_10004600 | 3300009098 | Bacteria | 12183 |
| 180 | Ga0105245_10212834 | 3300009098 | Bacteria | 1861 |
| 181 | Ga0105245_12807405 | 3300009098 | Unclassified | 540 |
| 182 | Ga0105247_10002076 | 3300009101 | Bacteria | 13871 |
| 183 | Ga0105247_10049060 | 3300009101 | Bacteria | 2595 |
| 184 | Ga0105243_10911271 | 3300009148 | Bacteria | 875 |
| 185 | Ga0105241_10313424 | 3300009174 | Bacteria | 1350 |
| 186 | Ga0105241_10523634 | 3300009174 | Bacteria | 1061 |
| 187 | Ga0105241_11179072 | 3300009174 | Unclassified | 724 |
| 188 | Ga0105242_10210880 | 3300009176 | Bacteria | 1731 |
| 189 | Ga0105242_10399385 | 3300009176 | Bacteria | 1282 |
| 190 | Ga0105242_10944122 | 3300009176 | Bacteria | 866 |
| 191 | Ga0105248_10001365 | 3300009177 | Bacteria | 27260 |
| 192 | Ga0105248_10009098 | 3300009177 | Bacteria | 10925 |
| 193 | Ga0105248_10776586 | 3300009177 | Bacteria | 1081 |
| 194 | Ga0105248_11748534 | 3300009177 | Bacteria | 705 |
| 195 | Ga0105237_10098268 | 3300009545 | Bacteria | 2918 |
| 196 | Ga0105237_10106357 | 3300009545 | Bacteria | 2798 |
| 197 | Ga0105237_10272325 | 3300009545 | Bacteria | 1696 |
| 198 | Ga0105237_10646707 | 3300009545 | Bacteria | 1064 |
| 199 | Ga0105237_10744102 | 3300009545 | Bacteria | 987 |
| 200 | Ga0105237_10747573 | 3300009545 | Unclassified | 984 |
| 201 | Ga0105238_10009671 | 3300009551 | Bacteria | 9650 |
| 202 | Ga0105238_10011065 | 3300009551 | Bacteria | 9066 |
| 203 | Ga0105238_10043932 | 3300009551 | Bacteria | 4520 |
| 204 | Ga0105238_10093709 | 3300009551 | Bacteria | 2991 |
| 205 | Ga0105238_10111451 | 3300009551 | Bacteria | 2716 |
| 206 | Ga0105238_10182990 | 3300009551 | Bacteria | 2072 |
| 207 | Ga0105238_10265344 | 3300009551 | Bacteria | 1697 |
| 208 | Ga0105238_10280903 | 3300009551 | Bacteria | 1646 |
| 209 | Ga0105238_11778471 | 3300009551 | Bacteria | 648 |
| 210 | Ga0105249_10041100 | 3300009553 | Bacteria | 4203 |
| 211 | Ga0105249_10609021 | 3300009553 | Unclassified | 1147 |
| 212 | Ga0105249_13308021 | 3300009553 | Bacteria | 519 |
| 213 | Ga0105239_10223877 | 3300010375 | Bacteria | 2110 |
| 214 | Ga0105239_10469108 | 3300010375 | Bacteria | 1429 |
| 215 | Ga0105239_10673697 | 3300010375 | Bacteria | 1182 |
| 216 | Ga0105239_11650432 | 3300010375 | Bacteria | 742 |
| 217 | Ga0105246_10000629 | 3300011119 | Bacteria | 19668 |
| 218 | Ga0105246_10246888 | 3300011119 | Bacteria | 1414 |
| 219 | Ga0157370_10000459 | 3300013104 | Bacteria | 51005 |
| 220 | Ga0157370_10180632 | 3300013104 | Bacteria | 1961 |
| 221 | Ga0157369_10003155 | 3300013105 | Bacteria | 19674 |
| 222 | Ga0157369_10069500 | 3300013105 | Bacteria | 3783 |
| 223 | Ga0157374_10003246 | 3300013296 | Bacteria | 13663 |
| 224 | Ga0157374_10337957 | 3300013296 | Bacteria | 1494 |
| 225 | Ga0157378_10093732 | 3300013297 | Bacteria | 2734 |
| 226 | Ga0157378_10096849 | 3300013297 | Bacteria | 2689 |
| 227 | Ga0157378_10198275 | 3300013297 | Bacteria | 1897 |
| 228 | Ga0163162_10033820 | 3300013306 | Bacteria | 5082 |
| 229 | Ga0163162_10133442 | 3300013306 | Bacteria | 2593 |
| 230 | Ga0163162_10286820 | 3300013306 | Bacteria | 1778 |
| 231 | Ga0157372_10339449 | 3300013307 | Bacteria | 1750 |
| 232 | Ga0157372_10497216 | 3300013307 | Bacteria | 1422 |
| 233 | Ga0157372_12327055 | 3300013307 | Unclassified | 615 |
| 234 | Ga0157375_10007739 | 3300013308 | Bacteria | 9406 |
| 235 | Ga0157375_10100255 | 3300013308 | Bacteria | 2976 |
| 236 | Ga0157375_10233645 | 3300013308 | Bacteria | 1998 |
| 237 | Ga0163163_10000692 | 3300014325 | Bacteria | 28661 |
| 238 | Ga0163163_10001624 | 3300014325 | Bacteria | 18915 |
| 239 | Ga0163163_10164064 | 3300014325 | Bacteria | 2267 |
| 240 | Ga0163163_10732000 | 3300014325 | Unclassified | 1053 |
| 241 | Ga0163163_11914495 | 3300014325 | Bacteria | 653 |
| 242 | Ga0157380_10000885 | 3300014326 | Bacteria | 18825 |
| 243 | Ga0157380_10574845 | 3300014326 | Bacteria | 1110 |
| 244 | Ga0157380_11372047 | 3300014326 | Bacteria | 756 |
| 245 | Ga0157377_10012579 | 3300014745 | Bacteria | 4259 |
| 246 | Ga0157377_10013226 | 3300014745 | Bacteria | 4173 |
| 247 | Ga0157377_10342744 | 3300014745 | Bacteria | 1000 |
| 248 | Ga0157377_10404734 | 3300014745 | Bacteria | 930 |
| 249 | Ga0157379_10016486 | 3300014968 | Bacteria | 6499 |
| 250 | Ga0157379_10185619 | 3300014968 | Bacteria | 1879 |
| 251 | Ga0157379_10297752 | 3300014968 | Bacteria | 1470 |
| 252 | Ga0157379_12028710 | 3300014968 | Bacteria | 569 |
| 253 | Ga0157376_10176658 | 3300014969 | Bacteria | 1948 |
| 254 | Ga0157376_10300082 | 3300014969 | Bacteria | 1520 |
| 255 | Ga0157376_10314122 | 3300014969 | Bacteria | 1487 |
| 256 | Ga0157376_10805707 | 3300014969 | Bacteria | 952 |
| 257 | Ga0183363_1004 | 3300015690 | Bacteria | 416766 |
| 258 | Ga0163161_10154881 | 3300017792 | Bacteria | 1744 |
| 259 | Ga0163161_11316457 | 3300017792 | Unclassified | 628 |
| 260 | Ga0197907_11203698 | 3300020069 | Bacteria | 545 |
| 261 | Ga0197907_11224261 | 3300020069 | Unclassified | 700 |
| 262 | Ga0206356_10358157 | 3300020070 | Unclassified | 582 |
| 263 | Ga0206356_10412598 | 3300020070 | Bacteria | 888 |
| 264 | Ga0206356_11614036 | 3300020070 | Unclassified | 538 |
| 265 | Ga0206355_1043388 | 3300020076 | Unclassified | 719 |
| 266 | Ga0206355_1367740 | 3300020076 | Bacteria | 563 |
| 267 | Ga0206355_1452525 | 3300020076 | Bacteria | 670 |
| 268 | Ga0206355_1480611 | 3300020076 | Bacteria | 777 |
| 269 | Ga0206352_10596986 | 3300020078 | Bacteria | 594 |
| 270 | Ga0206350_10546148 | 3300020080 | Bacteria | 577 |
| 271 | Ga0206354_10626539 | 3300020081 | Bacteria | 735 |
| 272 | Ga0206354_10890305 | 3300020081 | Bacteria | 505 |
| 273 | Ga0206353_11188132 | 3300020082 | Bacteria | 595 |
| 274 | Ga0206353_11414259 | 3300020082 | Bacteria | 725 |
| 275 | Ga0154015_1316723 | 3300020610 | Unclassified | 656 |
| 276 | Ga0154015_1381318 | 3300020610 | Unclassified | 554 |
| 277 | Ga0213872_10107353 | 3300021361 | Bacteria | 1242 |
| 278 | Ga0213872_10429367 | 3300021361 | Unclassified | 533 |
| 279 | Ga0213874_10198054 | 3300021377 | Bacteria | 721 |
| 280 | Ga0213874_10306114 | 3300021377 | Bacteria | 599 |
| 281 | Ga0213876_10057606 | 3300021384 | Bacteria | 2052 |
| 282 | Ga0213871_10017881 | 3300021441 | Bacteria | 1728 |
| 283 | Ga0224712_10160465 | 3300022467 | Bacteria | 1002 |
| 284 | Ga0224712_10287776 | 3300022467 | Bacteria | 766 |
| 285 | Ga0224712_10447532 | 3300022467 | Bacteria | 620 |
| 286 | Ga0224712_10567068 | 3300022467 | Bacteria | 553 |
| 287 | Ga0209233_1006030 | 3300025261 | Bacteria | 3949 |
| 288 | Ga0207656_10269322 | 3300025321 | Bacteria | 838 |
| 289 | Ga0207653_10172882 | 3300025885 | Unclassified | 805 |
| 290 | Ga0207692_10306053 | 3300025898 | Unclassified | 969 |
| 291 | Ga0207642_10070818 | 3300025899 | Bacteria | 1659 |
| 292 | Ga0207710_10049145 | 3300025900 | Bacteria | 1889 |
| 293 | Ga0207710_10198153 | 3300025900 | Bacteria | 991 |
| 294 | Ga0207688_10087695 | 3300025901 | Bacteria | 1784 |
| 295 | Ga0207680_10019137 | 3300025903 | Bacteria | 3657 |
| 296 | Ga0207680_10061568 | 3300025903 | Bacteria | 2289 |
| 297 | Ga0207680_10332567 | 3300025903 | Bacteria | 1064 |
| 298 | Ga0207685_10664454 | 3300025905 | Bacteria | 564 |
| 299 | Ga0207699_10003329 | 3300025906 | Bacteria | 7663 |
| 300 | Ga0207699_10389950 | 3300025906 | Bacteria | 990 |
| 301 | Ga0207699_11480015 | 3300025906 | Unclassified | 502 |
| 302 | Ga0207645_10189260 | 3300025907 | Unclassified | 1352 |
| 303 | Ga0207645_10805441 | 3300025907 | Bacteria | 639 |
| 304 | Ga0207643_10024492 | 3300025908 | Bacteria | 3331 |
| 305 | Ga0207705_10681243 | 3300025909 | Unclassified | 799 |
| 306 | Ga0207654_11151168 | 3300025911 | Bacteria | 565 |
| 307 | Ga0207707_10000751 | 3300025912 | Bacteria | 31949 |
| 308 | Ga0207707_10005824 | 3300025912 | Bacteria | 10768 |
| 309 | Ga0207707_10031131 | 3300025912 | Bacteria | 4668 |
| 310 | Ga0207707_10032336 | 3300025912 | Bacteria | 4578 |
| 311 | Ga0207707_10065695 | 3300025912 | Bacteria | 3160 |
| 312 | Ga0207707_10112551 | 3300025912 | Bacteria | 2380 |
| 313 | Ga0207707_10200681 | 3300025912 | Unclassified | 1739 |
| 314 | Ga0207695_10003874 | 3300025913 | Bacteria | 20704 |
| 315 | Ga0207695_10015725 | 3300025913 | Bacteria | 8896 |
| 316 | Ga0207695_10058238 | 3300025913 | Bacteria | 4011 |
| 317 | Ga0207695_10273733 | 3300025913 | Bacteria | 1583 |
| 318 | Ga0207695_10419846 | 3300025913 | Bacteria | 1222 |
| 319 | Ga0207695_11260628 | 3300025913 | Bacteria | 619 |
| 320 | Ga0207671_10047000 | 3300025914 | Bacteria | 3194 |
| 321 | Ga0207671_10091470 | 3300025914 | Bacteria | 2293 |
| 322 | Ga0207671_10179431 | 3300025914 | Bacteria | 1647 |
| 323 | Ga0207671_10563022 | 3300025914 | Bacteria | 909 |
| 324 | Ga0207671_10903191 | 3300025914 | Unclassified | 698 |
| 325 | Ga0207693_10046533 | 3300025915 | Bacteria | 3408 |
| 326 | Ga0207663_10040738 | 3300025916 | Bacteria | 2826 |
| 327 | Ga0207660_10420089 | 3300025917 | Unclassified | 1078 |
| 328 | Ga0207662_10002408 | 3300025918 | Bacteria | 9382 |
| 329 | Ga0207662_10500817 | 3300025918 | Bacteria | 836 |
| 330 | Ga0207657_11433754 | 3300025919 | Bacteria | 518 |
| 331 | Ga0207649_10005712 | 3300025920 | Bacteria | 6734 |
| 332 | Ga0207649_10018291 | 3300025920 | Bacteria | 3982 |
| 333 | Ga0207649_11142174 | 3300025920 | Bacteria | 615 |
| 334 | Ga0207652_10000818 | 3300025921 | Bacteria | 29680 |
| 335 | Ga0207652_10023502 | 3300025921 | Bacteria | 5108 |
| 336 | Ga0207681_10264177 | 3300025923 | Bacteria | 1349 |
| 337 | Ga0207694_10034992 | 3300025924 | Bacteria | 3852 |
| 338 | Ga0207694_10051744 | 3300025924 | Bacteria | 3183 |
| 339 | Ga0207694_10089148 | 3300025924 | Bacteria | 2432 |
| 340 | Ga0207694_10094312 | 3300025924 | Bacteria | 2365 |
| 341 | Ga0207694_10095989 | 3300025924 | Bacteria | 2345 |
| 342 | Ga0207694_10170232 | 3300025924 | Bacteria | 1763 |
| 343 | Ga0207694_10226114 | 3300025924 | Bacteria | 1527 |
| 344 | Ga0207694_10346735 | 3300025924 | Unclassified | 1229 |
| 345 | Ga0207694_10400451 | 3300025924 | Bacteria | 1141 |
| 346 | Ga0207694_10450757 | 3300025924 | Bacteria | 1074 |
| 347 | Ga0207650_10020453 | 3300025925 | Bacteria | 4668 |
| 348 | Ga0207650_10963172 | 3300025925 | Bacteria | 725 |
| 349 | Ga0207659_10020775 | 3300025926 | Bacteria | 4347 |
| 350 | Ga0207687_10000724 | 3300025927 | Bacteria | 22410 |
| 351 | Ga0207687_10265114 | 3300025927 | Bacteria | 1371 |
| 352 | Ga0207687_10626670 | 3300025927 | Unclassified | 908 |
| 353 | Ga0207700_11132560 | 3300025928 | Bacteria | 699 |
| 354 | Ga0207700_11294512 | 3300025928 | Bacteria | 649 |
| 355 | Ga0207664_11310299 | 3300025929 | Bacteria | 644 |
| 356 | Ga0207644_10030294 | 3300025931 | Bacteria | 3762 |
| 357 | Ga0207644_10094713 | 3300025931 | Bacteria | 2231 |
| 358 | Ga0207644_11611922 | 3300025931 | Bacteria | 544 |
| 359 | Ga0207690_10011017 | 3300025932 | Bacteria | 5390 |
| 360 | Ga0207690_10125790 | 3300025932 | Bacteria | 1869 |
| 361 | Ga0207690_10160083 | 3300025932 | Bacteria | 1677 |
| 362 | Ga0207706_10036803 | 3300025933 | Bacteria | 4347 |
| 363 | Ga0207706_10134800 | 3300025933 | Bacteria | 2172 |
| 364 | Ga0207706_11212466 | 3300025933 | Bacteria | 627 |
| 365 | Ga0207686_11399006 | 3300025934 | Unclassified | 576 |
| 366 | Ga0207670_10080162 | 3300025936 | Bacteria | 2281 |
| 367 | Ga0207669_10373404 | 3300025937 | Bacteria | 1109 |
| 368 | Ga0207704_10102410 | 3300025938 | Bacteria | 1912 |
| 369 | Ga0207665_10005803 | 3300025939 | Bacteria | 8213 |
| 370 | Ga0207691_10030667 | 3300025940 | Bacteria | 5022 |
| 371 | Ga0207711_10062170 | 3300025941 | Bacteria | 3221 |
| 372 | Ga0207711_10280180 | 3300025941 | Bacteria | 1535 |
| 373 | Ga0207711_11039025 | 3300025941 | Bacteria | 759 |
| 374 | Ga0207689_10047690 | 3300025942 | Bacteria | 3535 |
| 375 | Ga0207689_10581099 | 3300025942 | Bacteria | 942 |
| 376 | Ga0207689_11033401 | 3300025942 | Bacteria | 693 |
| 377 | Ga0207661_10159156 | 3300025944 | Bacteria | 1958 |
| 378 | Ga0207679_10033000 | 3300025945 | Bacteria | 3640 |
| 379 | Ga0207679_10034477 | 3300025945 | Bacteria | 3571 |
| 380 | Ga0207679_10208304 | 3300025945 | Bacteria | 1638 |
| 381 | Ga0207667_10002711 | 3300025949 | Bacteria | 21894 |
| 382 | Ga0207667_10020513 | 3300025949 | Bacteria | 7346 |
| 383 | Ga0207667_10046088 | 3300025949 | Bacteria | 4616 |
| 384 | Ga0207667_10210483 | 3300025949 | Bacteria | 1993 |
| 385 | Ga0207667_10240844 | 3300025949 | Bacteria | 1851 |
| 386 | Ga0207667_10250755 | 3300025949 | Bacteria | 1811 |
| 387 | Ga0207651_11496591 | 3300025960 | Bacteria | 608 |
| 388 | Ga0207712_10030573 | 3300025961 | Bacteria | 3622 |
| 389 | Ga0207712_10063884 | 3300025961 | Bacteria | 2622 |
| 390 | Ga0207640_10104095 | 3300025981 | Bacteria | 1997 |
| 391 | Ga0207640_10481768 | 3300025981 | Bacteria | 1029 |
| 392 | Ga0207658_10028709 | 3300025986 | Bacteria | 3921 |
| 393 | Ga0207658_10243804 | 3300025986 | Bacteria | 1524 |
| 394 | Ga0207658_11716862 | 3300025986 | Bacteria | 573 |
| 395 | Ga0207677_10724913 | 3300026023 | Bacteria | 884 |
| 396 | Ga0207703_10000767 | 3300026035 | Bacteria | 31611 |
| 397 | Ga0207703_10003598 | 3300026035 | Bacteria | 12943 |
| 398 | Ga0207703_10026715 | 3300026035 | Bacteria | 4546 |
| 399 | Ga0207703_10030091 | 3300026035 | Bacteria | 4289 |
| 400 | Ga0207639_10016461 | 3300026041 | Bacteria | 5233 |
| 401 | Ga0207639_10032606 | 3300026041 | Bacteria | 3836 |
| 402 | Ga0207639_10399889 | 3300026041 | Bacteria | 1237 |
| 403 | Ga0207639_10617069 | 3300026041 | Unclassified | 1001 |
| 404 | Ga0207639_12034650 | 3300026041 | Unclassified | 535 |
| 405 | Ga0207678_10031955 | 3300026067 | Bacteria | 4589 |
| 406 | Ga0207678_10083126 | 3300026067 | Bacteria | 2739 |
| 407 | Ga0207678_11885341 | 3300026067 | Bacteria | 522 |
| 408 | Ga0207708_10956465 | 3300026075 | Bacteria | 743 |
| 409 | Ga0207708_11541508 | 3300026075 | Unclassified | 584 |
| 410 | Ga0207702_10128822 | 3300026078 | Bacteria | 2275 |
| 411 | Ga0207702_10617612 | 3300026078 | Bacteria | 1064 |
| 412 | Ga0207702_10794213 | 3300026078 | Bacteria | 935 |
| 413 | Ga0207702_10901889 | 3300026078 | Bacteria | 876 |
| 414 | Ga0207641_10001749 | 3300026088 | Bacteria | 20947 |
| 415 | Ga0207641_10016369 | 3300026088 | Bacteria | 6070 |
| 416 | Ga0207641_10101341 | 3300026088 | Bacteria | 2537 |
| 417 | Ga0207648_10015173 | 3300026089 | Bacteria | 7091 |
| 418 | Ga0207648_10786084 | 3300026089 | Bacteria | 885 |
| 419 | Ga0207676_10031009 | 3300026095 | Bacteria | 4017 |
| 420 | Ga0207676_10113276 | 3300026095 | Bacteria | 2273 |
| 421 | Ga0207674_10016484 | 3300026116 | Bacteria | 8087 |
| 422 | Ga0207674_10248142 | 3300026116 | Bacteria | 1727 |
| 423 | Ga0207674_10284419 | 3300026116 | Bacteria | 1602 |
| 424 | Ga0207674_10729685 | 3300026116 | Bacteria | 956 |
| 425 | Ga0207675_100139626 | 3300026118 | Bacteria | 2301 |
| 426 | Ga0207675_100253070 | 3300026118 | Bacteria | 1705 |
| 427 | Ga0207675_100573859 | 3300026118 | Bacteria | 1129 |
| 428 | Ga0207683_10031261 | 3300026121 | Bacteria | 4620 |
| 429 | Ga0207683_10205304 | 3300026121 | Bacteria | 1792 |
| 430 | Ga0207698_11430596 | 3300026142 | Archaea | 706 |
| 431 | Ga0209999_1083690 | 3300027543 | Bacteria | 616 |
| 432 | Ga0209588_1108203 | 3300027671 | Bacteria | 893 |
| 433 | Ga0209998_10013597 | 3300027717 | Bacteria | 1695 |
| 434 | Ga0268266_10024612 | 3300028379 | Bacteria | 5121 |
| 435 | Ga0268266_10041234 | 3300028379 | Bacteria | 3938 |
| 436 | Ga0268266_10494293 | 3300028379 | Unclassified | 1167 |
| 437 | Ga0268265_10015612 | 3300028380 | Bacteria | 5200 |
| 438 | Ga0268265_10046107 | 3300028380 | Bacteria | 3256 |
| 439 | Ga0268265_10561553 | 3300028380 | Bacteria | 1085 |
| 440 | Ga0268265_10708477 | 3300028380 | Bacteria | 973 |
| 441 | Ga0268265_10751207 | 3300028380 | Bacteria | 947 |
| 442 | Ga0268264_10000034 | 3300028381 | Bacteria | 401894 |
| 443 | Ga0268264_10069363 | 3300028381 | Bacteria | 2981 |
| 444 | Ga0268264_10099360 | 3300028381 | Bacteria | 2525 |
| 445 | Ga0307511_10245353 | 3300030521 | Bacteria | 868 |
| 446 | Ga0265762_1120925 | 3300030760 | Unclassified | 599 |
| 447 | Ga0265766_1018627 | 3300030863 | Bacteria | 558 |
| 448 | Ga0265773_1004122 | 3300031018 | Bacteria | 991 |
| 449 | Ga0265332_10073069 | 3300031238 | Bacteria | 1460 |
| 450 | Ga0307513_10215622 | 3300031456 | Bacteria | 1746 |
| 451 | Ga0307408_100390661 | 3300031548 | Bacteria | 1192 |
| 452 | Ga0316575_10052474 | 3300031665 | Bacteria | 1624 |
| 453 | Ga0316575_10319790 | 3300031665 | Bacteria | 658 |
| 454 | Ga0316576_10266909 | 3300031727 | Bacteria | 1283 |
| 455 | Ga0316578_10374832 | 3300031728 | Bacteria | 845 |
| 456 | Ga0307516_10619235 | 3300031730 | Bacteria | 737 |
| 457 | Ga0316577_10161714 | 3300031733 | Bacteria | 1263 |
| 458 | Ga0316577_10635844 | 3300031733 | Bacteria | 607 |
| 459 | Ga0307518_10501202 | 3300031838 | Unclassified | 625 |
| 460 | Ga0307410_10235849 | 3300031852 | Bacteria | 1415 |
| 461 | Ga0307406_10240725 | 3300031901 | Bacteria | 1357 |
| 462 | Ga0307407_10601137 | 3300031903 | Bacteria | 819 |
| 463 | Ga0307412_10729932 | 3300031911 | Bacteria | 853 |
| 464 | Ga0307416_100537147 | 3300032002 | Bacteria | 1240 |
| 465 | Ga0307416_101569799 | 3300032002 | Unclassified | 764 |
| 466 | Ga0307415_100220596 | 3300032126 | Bacteria | 1520 |
| 467 | Ga0316583_10133012 | 3300032133 | Bacteria | 867 |
| 468 | Ga0307510_10000005 | 3300033180 | Bacteria | 633068 |
| 469 | Ga0307510_10015965 | 3300033180 | Bacteria | 8872 |
| 470 | Ga0373948_0097737 | 3300034817 | Bacteria | 688 |
| 471 | Ga0373948_0212322 | 3300034817 | Bacteria | 509 |
| 472 | Ga0373928_0030234 | 3300035084 | Bacteria | 1196 |
| 473 | Ga0373940_0159061 | 3300035088 | Bacteria | 724 |
| 474 | Ga0373923_0063128 | 3300035111 | Bacteria | 1577 |
| 475 | Ga0373936_0393256 | 3300035113 | Bacteria | 636 |
| 476 | Ga0373945_0140389 | 3300035116 | Bacteria | 974 |
| 477 | Ga0373953_0133914 | 3300035117 | Bacteria | 1058 |
| 478 | Ga0373956_0019200 | 3300035119 | Bacteria | 2899 |
| 479 | Ga0373956_0267874 | 3300035119 | Bacteria | 813 |
| 480 | Ga0373957_0051890 | 3300035120 | Bacteria | 1570 |
| 481 | Ga0373946_0111505 | 3300035171 | Bacteria | 1239 |
| 482 | Ga0373955_0114480 | 3300035172 | Bacteria | 1562 |
| 483 | Ga0316574_0042517 | 3300035398 | Bacteria | 2804 |
| 484 | Ga0316574_0271069 | 3300035398 | Bacteria | 1082 |
| 485 | Ga0373935_0172339 | 3300035692 | Bacteria | 1481 |
| 486 | Ga0373935_0357917 | 3300035692 | Bacteria | 1042 |
| 487 | Ga0373927_1112631 | 3300035695 | Bacteria | 521 |
| 488 | Ga0373933_0024168 | 3300035724 | Bacteria | 3479 |
| 489 | Ga0373933_0101972 | 3300035724 | Bacteria | 1781 |
| 490 | Ga0373937_0003400 | 3300036401 | Bacteria | 13356 |
| 491 | Ga0373937_0046970 | 3300036401 | Bacteria | 3949 |
| 492 | Ga0373937_0102977 | 3300036401 | Bacteria | 2651 |
| 493 | Ga0373937_0172819 | 3300036401 | Bacteria | 2027 |
| 494 | Ga0316584_0054911 | 3300036712 | Bacteria | 2983 |
| 495 | Ga0373925_0896864 | 3300037068 | Bacteria | 731 |
| 496 | Ga0395900_0638682 | 3300037418 | Bacteria | 1002 |
| 497 | Ga0395898_0021247 | 3300037466 | Bacteria | 6583 |
| 498 | Ga0395898_0144176 | 3300037466 | Bacteria | 2280 |
| 499 | Ga0395901_0260698 | 3300038443 | Bacteria | 1804 |
| 500 | Ga0395901_0773183 | 3300038443 | Bacteria | 951 |
| 501 | Ga0436365_0204524 | 3300039437 | Bacteria | 6125 |
| 502 | Ga0436365_1728503 | 3300039437 | Bacteria | 1616 |
| 503 | Ga0436360_0503581 | 3300039438 | Bacteria | 2372 |
| 504 | Ga0436360_0561777 | 3300039438 | Bacteria | 766 |
| 505 | Ga0436360_0884838 | 3300039438 | Bacteria | 11741 |
| 506 | Ga0436360_1049957 | 3300039438 | Unclassified | 586 |
| 507 | Ga0436360_1264219 | 3300039438 | Bacteria | 2925 |
| 508 | Ga0436361_0958437 | 3300039447 | Bacteria | 2391 |
| 509 | Ga0436363_0402446 | 3300039450 | Bacteria | 5372 |
| 510 | Ga0436363_0598179 | 3300039450 | Bacteria | 646 |
| 511 | Ga0436363_0854110 | 3300039450 | Bacteria | 851 |
| 512 | Ga0436363_1146804 | 3300039450 | Bacteria | 2704 |
| 513 | Ga0436362_0372061 | 3300039453 | Unclassified | 604 |
| 514 | Ga0436362_0442781 | 3300039453 | Bacteria | 655 |
| 515 | Ga0436362_0465396 | 3300039453 | Bacteria | 996 |
| 516 | Ga0436362_1247594 | 3300039453 | Bacteria | 1082 |
| 517 | Ga0439453_0159040 | 3300041408 | Unclassified | 540 |
| 518 | Ga0451797_0325197 | 3300041453 | Bacteria | 637 |
| 519 | Ga0451795_1363391 | 3300041456 | Unclassified | 693 |
| 520 | Ga0451833_1258513 | 3300041491 | Bacteria | 597 |
| 521 | Ga0450923_092392 | 3300042125 | Bacteria | 691 |
| 522 | Ga0439446_0005312 | 3300042156 | Bacteria | 3310 |
| 523 | Ga0439435_0085902 | 3300042436 | Bacteria | 950 |
| 524 | Ga0450916_018264 | 3300042530 | Bacteria | 943 |
| 525 | Ga0451577_0015656 | 3300042876 | Bacteria | 7047 |
| 526 | Ga0453683_0089708 | 3300044673 | Bacteria | 1927 |
| 527 | Ga0466965_0121701 | 3300044683 | Bacteria | 1348 |
| 528 | Ga0466961_0004699 | 3300044693 | Bacteria | 8586 |
| 529 | Ga0466964_0005787 | 3300044706 | Bacteria | 4602 |
| 530 | Ga0453684_0031657 | 3300044712 | Bacteria | 7426 |
| 531 | Ga0453684_1788286 | 3300044712 | Bacteria | 625 |
| 532 | Ga0466970_0039657 | 3300044765 | Bacteria | 2499 |
| 533 | Ga0466959_0040191 | 3300045049 | Bacteria | 3455 |
| 534 | Ga0451576_0015133 | 3300045051 | Bacteria | 8563 |
| 535 | Ga0451576_0142483 | 3300045051 | Bacteria | 2499 |
| 536 | Ga0451576_1069270 | 3300045051 | Bacteria | 845 |
| 537 | Ga0466958_0222295 | 3300045836 | Bacteria | 1205 |
| 538 | Ga0495603_0068798 | 3300046455 | Bacteria | 2083 |
| 539 | Ga0495629_0214492 | 3300046459 | Bacteria | 1329 |
| 540 | Ga0495580_0112577 | 3300046472 | Bacteria | 1890 |
| 541 | Ga0495639_0166458 | 3300046475 | Bacteria | 1069 |
| 542 | Ga0495639_0640326 | 3300046475 | Bacteria | 548 |
| 543 | Ga0495594_0435893 | 3300046499 | Bacteria | 745 |
| 544 | Ga0495583_0051955 | 3300046506 | Bacteria | 1866 |
| 545 | Ga0495606_0579278 | 3300046507 | Bacteria | 554 |
| 546 | Ga0495630_0418605 | 3300046517 | Bacteria | 1026 |
| 547 | Ga0495587_0079876 | 3300046536 | Bacteria | 1896 |
| 548 | Ga0495645_0868831 | 3300046543 | Bacteria | 537 |
| 549 | Ga0495611_0124587 | 3300046648 | Bacteria | 1202 |
| 550 | Ga0495625_0388136 | 3300046660 | Bacteria | 875 |
| 551 | Ga0495659_0049173 | 3300046664 | Bacteria | 1530 |
| 552 | Ga0495657_0066464 | 3300046675 | Bacteria | 2369 |
| 553 | Ga0495657_0493905 | 3300046675 | Viruses | 714 |
| 554 | Ga0495623_0024171 | 3300046679 | Bacteria | 3919 |
| 555 | Ga0495647_0034424 | 3300046681 | Bacteria | 1897 |
| 556 | Ga0495658_0114093 | 3300046683 | Bacteria | 1628 |
| 557 | Ga0495671_0060069 | 3300046692 | Bacteria | 1877 |
| 558 | Ga0495649_0180687 | 3300046694 | Bacteria | 1101 |
| 559 | Ga0495672_0346698 | 3300047320 | Bacteria | 691 |
| 560 | Ga0495680_0324393 | 3300047322 | Unclassified | 1077 |
| 561 | Ga0495687_097004 | 3300047443 | Bacteria | 1115 |
| 562 | Ga0495675_0085211 | 3300047444 | Bacteria | 1987 |
| 563 | Ga0495679_047525 | 3300047446 | Bacteria | 1302 |
| 564 | Ga0495686_0005836 | 3300047472 | Bacteria | 9601 |
| 565 | Ga0495686_0015719 | 3300047472 | Bacteria | 5157 |
| 566 | Ga0495602_0146507 | 3300048088 | Bacteria | 1862 |
| 567 | Ga0496100_0659174 | 3300048903 | Bacteria | 815 |
| 568 | Ga0496100_0868601 | 3300048903 | Bacteria | 708 |
| 569 | Ga0496101_0965309 | 3300048904 | Bacteria | 670 |
| 570 | Ga0496102_0022244 | 3300048905 | Bacteria | 5617 |
| 571 | Ga0496102_0635779 | 3300048905 | Bacteria | 990 |
| 572 | Ga0496103_0342663 | 3300048906 | Bacteria | 961 |
| 573 | Ga0496103_0986511 | 3300048906 | Bacteria | 525 |
| 574 | Ga0496104_0059235 | 3300048907 | Bacteria | 3625 |
| 575 | Ga0496105_0189689 | 3300048908 | Bacteria | 1681 |
| 576 | Ga0496106_0101714 | 3300048909 | Bacteria | 2229 |
| 577 | Ga0496107_1042491 | 3300048910 | Unclassified | 592 |
| 578 | Ga0496108_0180231 | 3300048911 | Bacteria | 1829 |
| 579 | Ga0496108_0252174 | 3300048911 | Bacteria | 1535 |
| 580 | Ga0496108_1554965 | 3300048911 | Unclassified | 549 |
| 581 | Ga0496109_0011333 | 3300048912 | Bacteria | 7660 |
| 582 | Ga0496109_0248585 | 3300048912 | Bacteria | 1674 |
| 583 | Ga0496110_0131653 | 3300048913 | Bacteria | 2259 |
| 584 | Ga0496110_0280917 | 3300048913 | Bacteria | 1516 |
| 585 | Ga0496111_0197173 | 3300048914 | Bacteria | 1497 |
| 586 | Ga0496112_0002877 | 3300048915 | Bacteria | 14002 |
| 587 | Ga0496112_0216241 | 3300048915 | Bacteria | 1873 |
| 588 | Ga0496112_1553466 | 3300048915 | Bacteria | 575 |
| 589 | Ga0496113_1389917 | 3300048916 | Bacteria | 544 |
| 590 | Ga0496114_0000553 | 3300048917 | Bacteria | 27690 |
| 591 | Ga0496115_0435304 | 3300048918 | Unclassified | 1061 |
| 592 | Ga0496116_0002539 | 3300048919 | Bacteria | 19102 |
| 593 | Ga0496117_0000012 | 3300048920 | Bacteria | 608530 |
| 594 | Ga0496117_0330297 | 3300048920 | Bacteria | 795 |
| 595 | Ga0496118_0000051 | 3300048921 | Bacteria | 241198 |
| 596 | Ga0496119_0001899 | 3300048922 | Bacteria | 23977 |
| 597 | Ga0496119_0015454 | 3300048922 | Bacteria | 5875 |
| 598 | Ga0496119_0391285 | 3300048922 | Bacteria | 665 |
| 599 | Ga0496120_0000191 | 3300048923 | Bacteria | 105146 |
| 600 | Ga0496120_0379879 | 3300048923 | Unclassified | 628 |
| 601 | Ga0496121_0047554 | 3300048924 | Bacteria | 3659 |
| 602 | Ga0496124_0055897 | 3300048927 | Bacteria | 3332 |
| 603 | Ga0496124_0158964 | 3300048927 | Bacteria | 1764 |
| 604 | Ga0496125_0002488 | 3300048928 | Bacteria | 23850 |
| 605 | Ga0496125_0057972 | 3300048928 | Bacteria | 3131 |
| 606 | Ga0496125_0389330 | 3300048928 | Unclassified | 819 |
| 607 | Ga0496126_0014282 | 3300048929 | Bacteria | 8035 |
| 608 | Ga0496126_0054680 | 3300048929 | Bacteria | 3614 |
| 609 | Ga0496126_0060199 | 3300048929 | Bacteria | 3416 |
| 610 | Ga0496126_1214645 | 3300048929 | Unclassified | 554 |
| 611 | Ga0501034_1418009 | 3300049571 | Bacteria | 569 |
| 612 | Ga0501036_0370075 | 3300049572 | Bacteria | 1196 |
| 613 | Ga0501039_0030860 | 3300049575 | Bacteria | 4133 |
| 614 | Ga0501040_0686352 | 3300049576 | Bacteria | 740 |
| 615 | Ga0501041_0114551 | 3300049577 | Bacteria | 1674 |
| 616 | Ga0501041_0745426 | 3300049577 | Bacteria | 627 |
| 617 | Ga0501042_0097698 | 3300049578 | Bacteria | 2111 |
| 618 | Ga0501043_0397993 | 3300049579 | Bacteria | 1041 |
| 619 | Ga0501046_0670398 | 3300049580 | Bacteria | 732 |
| 620 | Ga0501048_0700513 | 3300049582 | Bacteria | 727 |
| 621 | Ga0501070_0016490 | 3300049586 | Bacteria | 6207 |
| 622 | Ga0501071_0564991 | 3300049587 | Bacteria | 874 |
| 623 | Ga0501074_0719773 | 3300049590 | Bacteria | 704 |
| 624 | Ga0501076_0041080 | 3300049592 | Bacteria | 3637 |
| 625 | Ga0501077_0678264 | 3300049593 | Bacteria | 662 |
| 626 | Ga0501079_0130160 | 3300049741 | Bacteria | 1958 |
| 627 | Ga0501081_0011175 | 3300049743 | Bacteria | 5872 |
| 628 | Ga0501081_0324473 | 3300049743 | Bacteria | 1132 |
| 629 | Ga0501035_0385471 | 3300049822 | Bacteria | 1168 |
| 630 | Ga0501044_0269936 | 3300049823 | Bacteria | 1637 |
| 631 | Ga0501045_1019955 | 3300049824 | Bacteria | 606 |
| 632 | nmdc:mga0k408_372635_c1 | 3300050493 | Bacteria | 851 |
| 633 | nmdc:mga08y16_447238_c1 | 3300050511 | Bacteria | 1318 |
| 634 | nmdc:mga0n895_480458_c1 | 3300050512 | Bacteria | 1253 |
| 635 | nmdc:mga0rr50_488937_c1 | 3300050513 | Bacteria | 1045 |
| 636 | Ga0495601_0052031 | 3300053077 | Bacteria | 2585 |
| 637 | Ga0495601_0084901 | 3300053077 | Bacteria | 2034 |
| 638 | Ga0495612_0379373 | 3300053078 | Bacteria | 641 |
| 639 | Ga0495595_0242483 | 3300053084 | Bacteria | 902 |
| 640 | Ga0495619_0754353 | 3300053085 | Bacteria | 660 |
| 641 | Ga0500646_0077941 | 3300053090 | Unclassified | 1006 |
| 642 | Ga0500646_0107789 | 3300053090 | Bacteria | 882 |
| 643 | Ga0500583_0048764 | 3300053092 | Bacteria | 1956 |
| 644 | Ga0500651_0088466 | 3300053093 | Bacteria | 1910 |
| 645 | Ga0500651_0675469 | 3300053093 | Bacteria | 554 |
| 646 | Ga0500641_0012762 | 3300053096 | Bacteria | 3075 |
| 647 | Ga0500650_0189283 | 3300053098 | Bacteria | 940 |
| 648 | Ga0500572_034127 | 3300053111 | Bacteria | 1440 |
| 649 | Ga0500655_062447 | 3300053133 | Unclassified | 752 |
| 650 | Ga0500559_0091769 | 3300053136 | Bacteria | 1391 |
| 651 | Ga0500559_0400499 | 3300053136 | Bacteria | 638 |
| 652 | Ga0500568_0092059 | 3300053139 | Bacteria | 1143 |
| 653 | Ga0500590_098499 | 3300053148 | Bacteria | 1408 |
| 654 | Ga0500616_0000018 | 3300053153 | Bacteria | 610976 |
| 655 | Ga0500622_0007139 | 3300053156 | Bacteria | 6373 |
| 656 | Ga0500656_058277 | 3300053732 | Bacteria | 574 |
| 657 | Ga0587076_165251 | 3300059645 | Unclassified | 547 |
| 658 | Ga0587076_178932 | 3300059645 | Unclassified | 533 |
| 659 | Ga0587114_141677 | 3300059655 | Unclassified | 503 |
| 660 | Ga0501082_0411674 | 3300060353 | Bacteria | 1180 |
| 661 | Ga0466962_0007877 | 3300061719 | Bacteria | 5109 |
| 662 | Ga0530510_0685578 | 3300061734 | Bacteria | 781 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300004799 | Ga0058863_11957120 | Ga0058863_119571202 | 107 |
| 2 | 3300004800 | Ga0058861_11958246 | Ga0058861_119582462 | 107 |
| 3 | 3300004803 | Ga0058862_12257844 | Ga0058862_122578441 | 107 |
| 4 | 3300005289 | Ga0065704_10465469 | Ga0065704_104654691 | 107 |
| 5 | 3300005293 | Ga0065715_10247026 | Ga0065715_102470263 | 107 |
| 6 | 3300005293 | Ga0065715_10808713 | Ga0065715_108087131 | 107 |
| 7 | 3300005295 | Ga0065707_10081981 | Ga0065707_100819815 | 107 |
| 8 | 3300005327 | Ga0070658_10461614 | Ga0070658_104616141 | 107 |
| 9 | 3300005328 | Ga0070676_11008436 | Ga0070676_110084362 | 107 |
| 10 | 3300005329 | Ga0070683_100145553 | Ga0070683_1001455533 | 107 |
| 11 | 3300005330 | Ga0070690_100002121 | Ga0070690_1000021219 | 107 |
| 12 | 3300005330 | Ga0070690_100086925 | Ga0070690_1000869253 | 107 |
| 13 | 3300005331 | Ga0070670_100001924 | Ga0070670_10000192411 | 107 |
| 14 | 3300005331 | Ga0070670_100099387 | Ga0070670_1000993873 | 107 |
| 15 | 3300005331 | Ga0070670_100933581 | Ga0070670_1009335811 | 107 |
| 16 | 3300005334 | Ga0068869_100035837 | Ga0068869_1000358371 | 107 |
| 17 | 3300005334 | Ga0068869_100481751 | Ga0068869_1004817512 | 107 |
| 18 | 3300005335 | Ga0070666_10011147 | Ga0070666_100111476 | 107 |
| 19 | 3300005335 | Ga0070666_11355469 | Ga0070666_113554691 | 107 |
| 20 | 3300005336 | Ga0070680_100147093 | Ga0070680_1001470932 | 107 |
| 21 | 3300005336 | Ga0070680_100151322 | Ga0070680_1001513222 | 107 |
| 22 | 3300005336 | Ga0070680_100242182 | Ga0070680_1002421822 | 107 |
| 23 | 3300005337 | Ga0070682_100894863 | Ga0070682_1008948631 | 107 |
| 24 | 3300005338 | Ga0068868_100001397 | Ga0068868_10000139716 | 107 |
| 25 | 3300005338 | Ga0068868_100023979 | Ga0068868_1000239796 | 107 |
| 26 | 3300005339 | Ga0070660_100809383 | Ga0070660_1008093831 | 107 |
| 27 | 3300005340 | Ga0070689_100001863 | Ga0070689_1000018639 | 107 |
| 28 | 3300005340 | Ga0070689_100024663 | Ga0070689_1000246635 | 107 |
| 29 | 3300005343 | Ga0070687_100344915 | Ga0070687_1003449151 | 107 |
| 30 | 3300005344 | Ga0070661_100166812 | Ga0070661_1001668123 | 107 |
| 31 | 3300005344 | Ga0070661_100212839 | Ga0070661_1002128392 | 107 |
| 32 | 3300005344 | Ga0070661_100444680 | Ga0070661_1004446802 | 107 |
| 33 | 3300005344 | Ga0070661_100631639 | Ga0070661_1006316391 | 107 |
| 34 | 3300005347 | Ga0070668_102218060 | Ga0070668_1022180601 | 107 |
| 35 | 3300005353 | Ga0070669_100330030 | Ga0070669_1003300302 | 107 |
| 36 | 3300005354 | Ga0070675_100432322 | Ga0070675_1004323223 | 107 |
| 37 | 3300005355 | Ga0070671_100010034 | Ga0070671_1000100347 | 107 |
| 38 | 3300005355 | Ga0070671_100042592 | Ga0070671_1000425924 | 107 |
| 39 | 3300005355 | Ga0070671_100312097 | Ga0070671_1003120972 | 107 |
| 40 | 3300005355 | Ga0070671_101345848 | Ga0070671_1013458482 | 107 |
| 41 | 3300005356 | Ga0070674_100647812 | Ga0070674_1006478121 | 107 |
| 42 | 3300005364 | Ga0070673_100070874 | Ga0070673_1000708743 | 107 |
| 43 | 3300005364 | Ga0070673_100077826 | Ga0070673_1000778263 | 107 |
| 44 | 3300005364 | Ga0070673_100109305 | Ga0070673_1001093053 | 107 |
| 45 | 3300005364 | Ga0070673_100846816 | Ga0070673_1008468161 | 107 |
| 46 | 3300005367 | Ga0070667_100015817 | Ga0070667_1000158177 | 107 |
| 47 | 3300005367 | Ga0070667_100135150 | Ga0070667_1001351501 | 107 |
| 48 | 3300005367 | Ga0070667_100203437 | Ga0070667_1002034372 | 107 |
| 49 | 3300005367 | Ga0070667_101889047 | Ga0070667_1018890472 | 107 |
| 50 | 3300005406 | Ga0070703_10193838 | Ga0070703_101938381 | 107 |
| 51 | 3300005406 | Ga0070703_10458897 | Ga0070703_104588971 | 107 |
| 52 | 3300005434 | Ga0070709_10010626 | Ga0070709_100106266 | 107 |
| 53 | 3300005434 | Ga0070709_10291274 | Ga0070709_102912742 | 107 |
| 54 | 3300005434 | Ga0070709_11078165 | Ga0070709_110781651 | 107 |
| 55 | 3300005435 | Ga0070714_100639068 | Ga0070714_1006390681 | 107 |
| 56 | 3300005436 | Ga0070713_101217907 | Ga0070713_1012179072 | 107 |
| 57 | 3300005436 | Ga0070713_101745695 | Ga0070713_1017456951 | 107 |
| 58 | 3300005438 | Ga0070701_10060226 | Ga0070701_100602263 | 107 |
| 59 | 3300005439 | Ga0070711_100103312 | Ga0070711_1001033123 | 107 |
| 60 | 3300005439 | Ga0070711_100432853 | Ga0070711_1004328531 | 107 |
| 61 | 3300005440 | Ga0070705_100007578 | Ga0070705_1000075786 | 107 |
| 62 | 3300005441 | Ga0070700_100048866 | Ga0070700_1000488662 | 107 |
| 63 | 3300005444 | Ga0070694_100392628 | Ga0070694_1003926283 | 107 |
| 64 | 3300005456 | Ga0070678_100795147 | Ga0070678_1007951472 | 107 |
| 65 | 3300005457 | Ga0070662_100637218 | Ga0070662_1006372181 | 107 |
| 66 | 3300005458 | Ga0070681_10001620 | Ga0070681_1000162016 | 107 |
| 67 | 3300005458 | Ga0070681_10002862 | Ga0070681_1000286216 | 107 |
| 68 | 3300005458 | Ga0070681_10006571 | Ga0070681_100065713 | 107 |
| 69 | 3300005458 | Ga0070681_10041707 | Ga0070681_100417073 | 107 |
| 70 | 3300005458 | Ga0070681_10053934 | Ga0070681_100539342 | 107 |
| 71 | 3300005458 | Ga0070681_10132051 | Ga0070681_101320513 | 107 |
| 72 | 3300005459 | Ga0068867_100008135 | Ga0068867_1000081358 | 107 |
| 73 | 3300005466 | Ga0070685_10232602 | Ga0070685_102326022 | 107 |
| 74 | 3300005466 | Ga0070685_10407011 | Ga0070685_104070112 | 107 |
| 75 | 3300005468 | Ga0070707_100124009 | Ga0070707_1001240093 | 107 |
| 76 | 3300005468 | Ga0070707_101596557 | Ga0070707_1015965571 | 107 |
| 77 | 3300005471 | Ga0070698_100509024 | Ga0070698_1005090241 | 107 |
| 78 | 3300005518 | Ga0070699_100042960 | Ga0070699_1000429604 | 107 |
| 79 | 3300005530 | Ga0070679_100005320 | Ga0070679_1000053208 | 107 |
| 80 | 3300005530 | Ga0070679_100017074 | Ga0070679_1000170746 | 107 |
| 81 | 3300005530 | Ga0070679_100118799 | Ga0070679_1001187993 | 107 |
| 82 | 3300005530 | Ga0070679_100458135 | Ga0070679_1004581352 | 107 |
| 83 | 3300005535 | Ga0070684_100040924 | Ga0070684_1000409243 | 107 |
| 84 | 3300005535 | Ga0070684_100177126 | Ga0070684_1001771262 | 107 |
| 85 | 3300005539 | Ga0068853_100165848 | Ga0068853_1001658482 | 107 |
| 86 | 3300005539 | Ga0068853_100173829 | Ga0068853_1001738293 | 107 |
| 87 | 3300005543 | Ga0070672_100082670 | Ga0070672_1000826703 | 107 |
| 88 | 3300005544 | Ga0070686_100001796 | Ga0070686_10000179612 | 107 |
| 89 | 3300005544 | Ga0070686_100011605 | Ga0070686_1000116056 | 107 |
| 90 | 3300005545 | Ga0070695_100015703 | Ga0070695_1000157033 | 107 |
| 91 | 3300005545 | Ga0070695_100241668 | Ga0070695_1002416683 | 107 |
| 92 | 3300005545 | Ga0070695_100709838 | Ga0070695_1007098381 | 107 |
| 93 | 3300005546 | Ga0070696_101304529 | Ga0070696_1013045292 | 107 |
| 94 | 3300005547 | Ga0070693_100014873 | Ga0070693_1000148733 | 107 |
| 95 | 3300005548 | Ga0070665_100008574 | Ga0070665_1000085749 | 107 |
| 96 | 3300005548 | Ga0070665_100057769 | Ga0070665_1000577693 | 107 |
| 97 | 3300005548 | Ga0070665_100107778 | Ga0070665_1001077781 | 107 |
| 98 | 3300005548 | Ga0070665_100364384 | Ga0070665_1003643841 | 107 |
| 99 | 3300005548 | Ga0070665_100592222 | Ga0070665_1005922222 | 107 |
| 100 | 3300005549 | Ga0070704_100223321 | Ga0070704_1002233213 | 107 |
| 101 | 3300005563 | Ga0068855_100007775 | Ga0068855_1000077753 | 107 |
| 102 | 3300005563 | Ga0068855_100060642 | Ga0068855_1000606422 | 107 |
| 103 | 3300005563 | Ga0068855_100362959 | Ga0068855_1003629592 | 107 |
| 104 | 3300005563 | Ga0068855_100483742 | Ga0068855_1004837422 | 107 |
| 105 | 3300005564 | Ga0070664_100007434 | Ga0070664_1000074347 | 107 |
| 106 | 3300005564 | Ga0070664_100061436 | Ga0070664_1000614363 | 107 |
| 107 | 3300005564 | Ga0070664_100495069 | Ga0070664_1004950691 | 107 |
| 108 | 3300005577 | Ga0068857_100149355 | Ga0068857_1001493552 | 107 |
| 109 | 3300005577 | Ga0068857_100512187 | Ga0068857_1005121873 | 107 |
| 110 | 3300005578 | Ga0068854_100286195 | Ga0068854_1002861952 | 107 |
| 111 | 3300005614 | Ga0068856_100097244 | Ga0068856_1000972444 | 107 |
| 112 | 3300005614 | Ga0068856_100252331 | Ga0068856_1002523312 | 107 |
| 113 | 3300005614 | Ga0068856_100647874 | Ga0068856_1006478742 | 107 |
| 114 | 3300005614 | Ga0068856_100924190 | Ga0068856_1009241902 | 107 |
| 115 | 3300005615 | Ga0070702_100002720 | Ga0070702_1000027203 | 107 |
| 116 | 3300005615 | Ga0070702_100003056 | Ga0070702_1000030568 | 107 |
| 117 | 3300005616 | Ga0068852_100130815 | Ga0068852_1001308152 | 107 |
| 118 | 3300005616 | Ga0068852_101176186 | Ga0068852_1011761861 | 107 |
| 119 | 3300005616 | Ga0068852_101322112 | Ga0068852_1013221121 | 107 |
| 120 | 3300005617 | Ga0068859_100012440 | Ga0068859_1000124403 | 107 |
| 121 | 3300005617 | Ga0068859_100027419 | Ga0068859_1000274192 | 107 |
| 122 | 3300005617 | Ga0068859_100049529 | Ga0068859_1000495296 | 107 |
| 123 | 3300005617 | Ga0068859_102966282 | Ga0068859_1029662821 | 107 |
| 124 | 3300005618 | Ga0068864_100006569 | Ga0068864_10000656910 | 107 |
| 125 | 3300005618 | Ga0068864_100017803 | Ga0068864_1000178033 | 107 |
| 126 | 3300005719 | Ga0068861_100125587 | Ga0068861_1001255871 | 107 |
| 127 | 3300005719 | Ga0068861_100191922 | Ga0068861_1001919223 | 107 |
| 128 | 3300005834 | Ga0068851_10546132 | Ga0068851_105461321 | 107 |
| 129 | 3300005840 | Ga0068870_10009276 | Ga0068870_100092764 | 107 |
| 130 | 3300005841 | Ga0068863_100002915 | Ga0068863_10000291510 | 107 |
| 131 | 3300005841 | Ga0068863_100021655 | Ga0068863_1000216556 | 107 |
| 132 | 3300005842 | Ga0068858_100001624 | Ga0068858_10000162410 | 107 |
| 133 | 3300005842 | Ga0068858_100003897 | Ga0068858_1000038975 | 107 |
| 134 | 3300005842 | Ga0068858_100008115 | Ga0068858_10000811510 | 107 |
| 135 | 3300005842 | Ga0068858_100008369 | Ga0068858_1000083696 | 107 |
| 136 | 3300005843 | Ga0068860_100001031 | Ga0068860_1000010312 | 107 |
| 137 | 3300005843 | Ga0068860_100003582 | Ga0068860_1000035829 | 107 |
| 138 | 3300005843 | Ga0068860_100577980 | Ga0068860_1005779802 | 107 |
| 139 | 3300005844 | Ga0068862_100002789 | Ga0068862_1000027891 | 107 |
| 140 | 3300005844 | Ga0068862_100033230 | Ga0068862_1000332302 | 107 |
| 141 | 3300005844 | Ga0068862_100420118 | Ga0068862_1004201182 | 107 |
| 142 | 3300005844 | Ga0068862_101037158 | Ga0068862_1010371582 | 107 |
| 143 | 3300005844 | Ga0068862_102252761 | Ga0068862_1022527612 | 107 |
| 144 | 3300005937 | Ga0081455_10325722 | Ga0081455_103257223 | 107 |
| 145 | 3300006163 | Ga0070715_10223626 | Ga0070715_102236263 | 107 |
| 146 | 3300006173 | Ga0070716_100033769 | Ga0070716_1000337693 | 107 |
| 147 | 3300006175 | Ga0070712_100039915 | Ga0070712_1000399154 | 107 |
| 148 | 3300006195 | Ga0075366_10332343 | Ga0075366_103323432 | 107 |
| 149 | 3300006237 | Ga0097621_100154132 | Ga0097621_1001541322 | 107 |
| 150 | 3300006237 | Ga0097621_100197877 | Ga0097621_1001978772 | 107 |
| 151 | 3300006237 | Ga0097621_100233878 | Ga0097621_1002338781 | 107 |
| 152 | 3300006237 | Ga0097621_100501680 | Ga0097621_1005016802 | 107 |
| 153 | 3300006237 | Ga0097621_101478377 | Ga0097621_1014783772 | 107 |
| 154 | 3300006358 | Ga0068871_100012828 | Ga0068871_1000128284 | 107 |
| 155 | 3300006358 | Ga0068871_100017723 | Ga0068871_1000177236 | 107 |
| 156 | 3300006358 | Ga0068871_100787681 | Ga0068871_1007876812 | 107 |
| 157 | 3300006358 | Ga0068871_100885703 | Ga0068871_1008857031 | 107 |
| 158 | 3300006358 | Ga0068871_101868540 | Ga0068871_1018685401 | 107 |
| 159 | 3300006844 | Ga0075428_100277023 | Ga0075428_1002770232 | 107 |
| 160 | 3300006931 | Ga0097620_100012440 | Ga0097620_1000124408 | 107 |
| 161 | 3300006931 | Ga0097620_100027419 | Ga0097620_1000274192 | 107 |
| 162 | 3300006931 | Ga0097620_100049529 | Ga0097620_1000495296 | 107 |
| 163 | 3300006931 | Ga0097620_102966061 | Ga0097620_1029660611 | 107 |
| 164 | 3300007076 | Ga0075435_101127205 | Ga0075435_1011272052 | 107 |
| 165 | 3300007265 | Ga0099794_10040579 | Ga0099794_100405792 | 107 |
| 166 | 3300007788 | Ga0099795_10028868 | Ga0099795_100288683 | 107 |
| 167 | 3300009092 | Ga0105250_10414141 | Ga0105250_104141411 | 107 |
| 168 | 3300009093 | Ga0105240_10004508 | Ga0105240_100045086 | 107 |
| 169 | 3300009093 | Ga0105240_10006950 | Ga0105240_100069506 | 107 |
| 170 | 3300009093 | Ga0105240_10034801 | Ga0105240_100348013 | 107 |
| 171 | 3300009093 | Ga0105240_10123818 | Ga0105240_101238183 | 107 |
| 172 | 3300009093 | Ga0105240_10137039 | Ga0105240_101370393 | 107 |
| 173 | 3300009093 | Ga0105240_10164797 | Ga0105240_101647972 | 107 |
| 174 | 3300009093 | Ga0105240_10315115 | Ga0105240_103151151 | 107 |
| 175 | 3300009093 | Ga0105240_10371832 | Ga0105240_103718322 | 107 |
| 176 | 3300009093 | Ga0105240_10750842 | Ga0105240_107508421 | 107 |
| 177 | 3300009094 | Ga0111539_10522401 | Ga0111539_105224013 | 107 |
| 178 | 3300009094 | Ga0111539_13274792 | Ga0111539_132747921 | 107 |
| 179 | 3300009098 | Ga0105245_10004600 | Ga0105245_1000460011 | 107 |
| 180 | 3300009098 | Ga0105245_10212834 | Ga0105245_102128343 | 107 |
| 181 | 3300009098 | Ga0105245_12807405 | Ga0105245_128074051 | 107 |
| 182 | 3300009101 | Ga0105247_10002076 | Ga0105247_1000207614 | 107 |
| 183 | 3300009101 | Ga0105247_10049060 | Ga0105247_100490603 | 107 |
| 184 | 3300009148 | Ga0105243_10911271 | Ga0105243_109112712 | 107 |
| 185 | 3300009174 | Ga0105241_10313424 | Ga0105241_103134242 | 107 |
| 186 | 3300009174 | Ga0105241_10523634 | Ga0105241_105236342 | 107 |
| 187 | 3300009174 | Ga0105241_11179072 | Ga0105241_111790722 | 107 |
| 188 | 3300009176 | Ga0105242_10210880 | Ga0105242_102108803 | 107 |
| 189 | 3300009176 | Ga0105242_10399385 | Ga0105242_103993853 | 107 |
| 190 | 3300009176 | Ga0105242_10944122 | Ga0105242_109441222 | 107 |
| 191 | 3300009177 | Ga0105248_10001365 | Ga0105248_1000136514 | 107 |
| 192 | 3300009177 | Ga0105248_10009098 | Ga0105248_100090989 | 107 |
| 193 | 3300009177 | Ga0105248_10776586 | Ga0105248_107765862 | 107 |
| 194 | 3300009177 | Ga0105248_11748534 | Ga0105248_117485341 | 107 |
| 195 | 3300009545 | Ga0105237_10098268 | Ga0105237_100982683 | 107 |
| 196 | 3300009545 | Ga0105237_10106357 | Ga0105237_101063573 | 107 |
| 197 | 3300009545 | Ga0105237_10272325 | Ga0105237_102723252 | 107 |
| 198 | 3300009545 | Ga0105237_10646707 | Ga0105237_106467073 | 107 |
| 199 | 3300009545 | Ga0105237_10744102 | Ga0105237_107441022 | 107 |
| 200 | 3300009545 | Ga0105237_10747573 | Ga0105237_107475731 | 107 |
| 201 | 3300009551 | Ga0105238_10009671 | Ga0105238_100096714 | 107 |
| 202 | 3300009551 | Ga0105238_10011065 | Ga0105238_100110659 | 107 |
| 203 | 3300009551 | Ga0105238_10043932 | Ga0105238_100439324 | 107 |
| 204 | 3300009551 | Ga0105238_10093709 | Ga0105238_100937092 | 107 |
| 205 | 3300009551 | Ga0105238_10111451 | Ga0105238_101114512 | 107 |
| 206 | 3300009551 | Ga0105238_10182990 | Ga0105238_101829902 | 107 |
| 207 | 3300009551 | Ga0105238_10265344 | Ga0105238_102653443 | 107 |
| 208 | 3300009551 | Ga0105238_10280903 | Ga0105238_102809032 | 107 |
| 209 | 3300009551 | Ga0105238_11778471 | Ga0105238_117784711 | 107 |
| 210 | 3300009553 | Ga0105249_10041100 | Ga0105249_100411002 | 107 |
| 211 | 3300009553 | Ga0105249_10609021 | Ga0105249_106090212 | 107 |
| 212 | 3300009553 | Ga0105249_13308021 | Ga0105249_133080212 | 107 |
| 213 | 3300010375 | Ga0105239_10223877 | Ga0105239_102238773 | 107 |
| 214 | 3300010375 | Ga0105239_10469108 | Ga0105239_104691082 | 107 |
| 215 | 3300010375 | Ga0105239_10673697 | Ga0105239_106736972 | 107 |
| 216 | 3300010375 | Ga0105239_11650432 | Ga0105239_116504322 | 107 |
| 217 | 3300011119 | Ga0105246_10000629 | Ga0105246_1000062915 | 107 |
| 218 | 3300011119 | Ga0105246_10246888 | Ga0105246_102468882 | 107 |
| 219 | 3300013104 | Ga0157370_10000459 | Ga0157370_100004595 | 107 |
| 220 | 3300013104 | Ga0157370_10180632 | Ga0157370_101806322 | 107 |
| 221 | 3300013105 | Ga0157369_10003155 | Ga0157369_1000315515 | 107 |
| 222 | 3300013105 | Ga0157369_10069500 | Ga0157369_100695003 | 107 |
| 223 | 3300013296 | Ga0157374_10003246 | Ga0157374_100032463 | 107 |
| 224 | 3300013296 | Ga0157374_10337957 | Ga0157374_103379572 | 107 |
| 225 | 3300013297 | Ga0157378_10093732 | Ga0157378_100937323 | 107 |
| 226 | 3300013297 | Ga0157378_10096849 | Ga0157378_100968492 | 107 |
| 227 | 3300013297 | Ga0157378_10198275 | Ga0157378_101982753 | 107 |
| 228 | 3300013306 | Ga0163162_10033820 | Ga0163162_100338205 | 107 |
| 229 | 3300013306 | Ga0163162_10133442 | Ga0163162_101334424 | 107 |
| 230 | 3300013306 | Ga0163162_10286820 | Ga0163162_102868202 | 107 |
| 231 | 3300013307 | Ga0157372_10339449 | Ga0157372_103394492 | 107 |
| 232 | 3300013307 | Ga0157372_10497216 | Ga0157372_104972162 | 107 |
| 233 | 3300013307 | Ga0157372_12327055 | Ga0157372_123270551 | 107 |
| 234 | 3300013308 | Ga0157375_10007739 | Ga0157375_100077399 | 107 |
| 235 | 3300013308 | Ga0157375_10100255 | Ga0157375_101002553 | 107 |
| 236 | 3300013308 | Ga0157375_10233645 | Ga0157375_102336453 | 107 |
| 237 | 3300014325 | Ga0163163_10000692 | Ga0163163_1000069218 | 107 |
| 238 | 3300014325 | Ga0163163_10001624 | Ga0163163_1000162415 | 107 |
| 239 | 3300014325 | Ga0163163_10164064 | Ga0163163_101640642 | 107 |
| 240 | 3300014325 | Ga0163163_10732000 | Ga0163163_107320001 | 107 |
| 241 | 3300014325 | Ga0163163_11914495 | Ga0163163_119144952 | 107 |
| 242 | 3300014326 | Ga0157380_10000885 | Ga0157380_100008856 | 107 |
| 243 | 3300014326 | Ga0157380_10574845 | Ga0157380_105748452 | 107 |
| 244 | 3300014326 | Ga0157380_11372047 | Ga0157380_113720472 | 107 |
| 245 | 3300014745 | Ga0157377_10012579 | Ga0157377_100125793 | 107 |
| 246 | 3300014745 | Ga0157377_10013226 | Ga0157377_100132265 | 107 |
| 247 | 3300014745 | Ga0157377_10342744 | Ga0157377_103427441 | 107 |
| 248 | 3300014745 | Ga0157377_10404734 | Ga0157377_104047342 | 107 |
| 249 | 3300014968 | Ga0157379_10016486 | Ga0157379_100164861 | 107 |
| 250 | 3300014968 | Ga0157379_10185619 | Ga0157379_101856192 | 107 |
| 251 | 3300014968 | Ga0157379_10297752 | Ga0157379_102977522 | 107 |
| 252 | 3300014968 | Ga0157379_12028710 | Ga0157379_120287102 | 107 |
| 253 | 3300014969 | Ga0157376_10176658 | Ga0157376_101766582 | 107 |
| 254 | 3300014969 | Ga0157376_10300082 | Ga0157376_103000822 | 107 |
| 255 | 3300014969 | Ga0157376_10314122 | Ga0157376_103141222 | 107 |
| 256 | 3300014969 | Ga0157376_10805707 | Ga0157376_108057072 | 107 |
| 257 | 3300015690 | Ga0183363_1004 | Ga0183363_1004279 | 107 |
| 258 | 3300017792 | Ga0163161_10154881 | Ga0163161_101548813 | 107 |
| 259 | 3300017792 | Ga0163161_11316457 | Ga0163161_113164571 | 107 |
| 260 | 3300020069 | Ga0197907_11203698 | Ga0197907_112036981 | 107 |
| 261 | 3300020069 | Ga0197907_11224261 | Ga0197907_112242611 | 107 |
| 262 | 3300020070 | Ga0206356_10358157 | Ga0206356_103581572 | 107 |
| 263 | 3300020070 | Ga0206356_10412598 | Ga0206356_104125982 | 107 |
| 264 | 3300020070 | Ga0206356_11614036 | Ga0206356_116140361 | 107 |
| 265 | 3300020076 | Ga0206355_1043388 | Ga0206355_10433881 | 107 |
| 266 | 3300020076 | Ga0206355_1367740 | Ga0206355_13677401 | 107 |
| 267 | 3300020076 | Ga0206355_1452525 | Ga0206355_14525252 | 107 |
| 268 | 3300020076 | Ga0206355_1480611 | Ga0206355_14806112 | 107 |
| 269 | 3300020078 | Ga0206352_10596986 | Ga0206352_105969862 | 107 |
| 270 | 3300020080 | Ga0206350_10546148 | Ga0206350_105461481 | 107 |
| 271 | 3300020081 | Ga0206354_10626539 | Ga0206354_106265392 | 107 |
| 272 | 3300020081 | Ga0206354_10890305 | Ga0206354_108903051 | 107 |
| 273 | 3300020082 | Ga0206353_11188132 | Ga0206353_111881321 | 107 |
| 274 | 3300020082 | Ga0206353_11414259 | Ga0206353_114142591 | 107 |
| 275 | 3300020610 | Ga0154015_1316723 | Ga0154015_13167232 | 107 |
| 276 | 3300020610 | Ga0154015_1381318 | Ga0154015_13813181 | 107 |
| 277 | 3300021361 | Ga0213872_10107353 | Ga0213872_101073531 | 107 |
| 278 | 3300021361 | Ga0213872_10429367 | Ga0213872_104293671 | 107 |
| 279 | 3300021377 | Ga0213874_10198054 | Ga0213874_101980542 | 107 |
| 280 | 3300021377 | Ga0213874_10306114 | Ga0213874_103061141 | 107 |
| 281 | 3300021384 | Ga0213876_10057606 | Ga0213876_100576062 | 107 |
| 282 | 3300021441 | Ga0213871_10017881 | Ga0213871_100178812 | 107 |
| 283 | 3300022467 | Ga0224712_10160465 | Ga0224712_101604652 | 107 |
| 284 | 3300022467 | Ga0224712_10287776 | Ga0224712_102877762 | 107 |
| 285 | 3300022467 | Ga0224712_10447532 | Ga0224712_104475321 | 107 |
| 286 | 3300022467 | Ga0224712_10567068 | Ga0224712_105670681 | 107 |
| 287 | 3300025261 | Ga0209233_1006030 | Ga0209233_10060305 | 107 |
| 288 | 3300025321 | Ga0207656_10269322 | Ga0207656_102693222 | 107 |
| 289 | 3300025885 | Ga0207653_10172882 | Ga0207653_101728822 | 107 |
| 290 | 3300025898 | Ga0207692_10306053 | Ga0207692_103060532 | 107 |
| 291 | 3300025899 | Ga0207642_10070818 | Ga0207642_100708182 | 107 |
| 292 | 3300025900 | Ga0207710_10049145 | Ga0207710_100491452 | 107 |
| 293 | 3300025900 | Ga0207710_10198153 | Ga0207710_101981531 | 107 |
| 294 | 3300025901 | Ga0207688_10087695 | Ga0207688_100876952 | 107 |
| 295 | 3300025903 | Ga0207680_10019137 | Ga0207680_100191373 | 107 |
| 296 | 3300025903 | Ga0207680_10061568 | Ga0207680_100615683 | 107 |
| 297 | 3300025903 | Ga0207680_10332567 | Ga0207680_103325672 | 107 |
| 298 | 3300025905 | Ga0207685_10664454 | Ga0207685_106644541 | 107 |
| 299 | 3300025906 | Ga0207699_10003329 | Ga0207699_100033292 | 107 |
| 300 | 3300025906 | Ga0207699_10389950 | Ga0207699_103899502 | 107 |
| 301 | 3300025906 | Ga0207699_11480015 | Ga0207699_114800151 | 107 |
| 302 | 3300025907 | Ga0207645_10189260 | Ga0207645_101892601 | 107 |
| 303 | 3300025907 | Ga0207645_10805441 | Ga0207645_108054412 | 107 |
| 304 | 3300025908 | Ga0207643_10024492 | Ga0207643_100244925 | 107 |
| 305 | 3300025909 | Ga0207705_10681243 | Ga0207705_106812432 | 107 |
| 306 | 3300025911 | Ga0207654_11151168 | Ga0207654_111511682 | 107 |
| 307 | 3300025912 | Ga0207707_10000751 | Ga0207707_1000075114 | 107 |
| 308 | 3300025912 | Ga0207707_10005824 | Ga0207707_100058246 | 107 |
| 309 | 3300025912 | Ga0207707_10031131 | Ga0207707_100311312 | 107 |
| 310 | 3300025912 | Ga0207707_10032336 | Ga0207707_100323364 | 107 |
| 311 | 3300025912 | Ga0207707_10065695 | Ga0207707_100656954 | 107 |
| 312 | 3300025912 | Ga0207707_10112551 | Ga0207707_101125514 | 107 |
| 313 | 3300025912 | Ga0207707_10200681 | Ga0207707_102006811 | 107 |
| 314 | 3300025913 | Ga0207695_10003874 | Ga0207695_100038746 | 107 |
| 315 | 3300025913 | Ga0207695_10015725 | Ga0207695_100157254 | 107 |
| 316 | 3300025913 | Ga0207695_10058238 | Ga0207695_100582384 | 107 |
| 317 | 3300025913 | Ga0207695_10273733 | Ga0207695_102737333 | 107 |
| 318 | 3300025913 | Ga0207695_10419846 | Ga0207695_104198461 | 107 |
| 319 | 3300025913 | Ga0207695_11260628 | Ga0207695_112606282 | 107 |
| 320 | 3300025914 | Ga0207671_10047000 | Ga0207671_100470004 | 107 |
| 321 | 3300025914 | Ga0207671_10091470 | Ga0207671_100914702 | 107 |
| 322 | 3300025914 | Ga0207671_10179431 | Ga0207671_101794313 | 107 |
| 323 | 3300025914 | Ga0207671_10563022 | Ga0207671_105630222 | 107 |
| 324 | 3300025914 | Ga0207671_10903191 | Ga0207671_109031911 | 107 |
| 325 | 3300025915 | Ga0207693_10046533 | Ga0207693_100465332 | 107 |
| 326 | 3300025916 | Ga0207663_10040738 | Ga0207663_100407384 | 107 |
| 327 | 3300025917 | Ga0207660_10420089 | Ga0207660_104200892 | 107 |
| 328 | 3300025918 | Ga0207662_10002408 | Ga0207662_100024084 | 107 |
| 329 | 3300025918 | Ga0207662_10500817 | Ga0207662_105008171 | 107 |
| 330 | 3300025919 | Ga0207657_11433754 | Ga0207657_114337541 | 107 |
| 331 | 3300025920 | Ga0207649_10005712 | Ga0207649_100057128 | 107 |
| 332 | 3300025920 | Ga0207649_10018291 | Ga0207649_100182913 | 107 |
| 333 | 3300025920 | Ga0207649_11142174 | Ga0207649_111421741 | 107 |
| 334 | 3300025921 | Ga0207652_10000818 | Ga0207652_1000081815 | 107 |
| 335 | 3300025921 | Ga0207652_10023502 | Ga0207652_100235025 | 107 |
| 336 | 3300025923 | Ga0207681_10264177 | Ga0207681_102641772 | 107 |
| 337 | 3300025924 | Ga0207694_10034992 | Ga0207694_100349922 | 107 |
| 338 | 3300025924 | Ga0207694_10051744 | Ga0207694_100517443 | 107 |
| 339 | 3300025924 | Ga0207694_10089148 | Ga0207694_100891484 | 107 |
| 340 | 3300025924 | Ga0207694_10094312 | Ga0207694_100943123 | 107 |
| 341 | 3300025924 | Ga0207694_10095989 | Ga0207694_100959893 | 107 |
| 342 | 3300025924 | Ga0207694_10170232 | Ga0207694_101702323 | 107 |
| 343 | 3300025924 | Ga0207694_10226114 | Ga0207694_102261142 | 107 |
| 344 | 3300025924 | Ga0207694_10346735 | Ga0207694_103467351 | 107 |
| 345 | 3300025924 | Ga0207694_10400451 | Ga0207694_104004512 | 107 |
| 346 | 3300025924 | Ga0207694_10450757 | Ga0207694_104507572 | 107 |
| 347 | 3300025925 | Ga0207650_10020453 | Ga0207650_100204535 | 107 |
| 348 | 3300025925 | Ga0207650_10963172 | Ga0207650_109631721 | 107 |
| 349 | 3300025926 | Ga0207659_10020775 | Ga0207659_100207754 | 107 |
| 350 | 3300025927 | Ga0207687_10000724 | Ga0207687_1000072415 | 107 |
| 351 | 3300025927 | Ga0207687_10265114 | Ga0207687_102651142 | 107 |
| 352 | 3300025927 | Ga0207687_10626670 | Ga0207687_106266702 | 107 |
| 353 | 3300025928 | Ga0207700_11132560 | Ga0207700_111325601 | 107 |
| 354 | 3300025928 | Ga0207700_11294512 | Ga0207700_112945121 | 107 |
| 355 | 3300025929 | Ga0207664_11310299 | Ga0207664_113102992 | 107 |
| 356 | 3300025931 | Ga0207644_10030294 | Ga0207644_100302944 | 107 |
| 357 | 3300025931 | Ga0207644_10094713 | Ga0207644_100947132 | 107 |
| 358 | 3300025931 | Ga0207644_11611922 | Ga0207644_116119221 | 107 |
| 359 | 3300025932 | Ga0207690_10011017 | Ga0207690_100110176 | 107 |
| 360 | 3300025932 | Ga0207690_10125790 | Ga0207690_101257903 | 107 |
| 361 | 3300025932 | Ga0207690_10160083 | Ga0207690_101600833 | 107 |
| 362 | 3300025933 | Ga0207706_10036803 | Ga0207706_100368031 | 107 |
| 363 | 3300025933 | Ga0207706_10134800 | Ga0207706_101348004 | 107 |
| 364 | 3300025933 | Ga0207706_11212466 | Ga0207706_112124662 | 107 |
| 365 | 3300025934 | Ga0207686_11399006 | Ga0207686_113990061 | 107 |
| 366 | 3300025936 | Ga0207670_10080162 | Ga0207670_100801623 | 107 |
| 367 | 3300025937 | Ga0207669_10373404 | Ga0207669_103734042 | 107 |
| 368 | 3300025938 | Ga0207704_10102410 | Ga0207704_101024102 | 107 |
| 369 | 3300025939 | Ga0207665_10005803 | Ga0207665_100058036 | 107 |
| 370 | 3300025940 | Ga0207691_10030667 | Ga0207691_100306673 | 107 |
| 371 | 3300025941 | Ga0207711_10062170 | Ga0207711_100621703 | 107 |
| 372 | 3300025941 | Ga0207711_10280180 | Ga0207711_102801802 | 107 |
| 373 | 3300025941 | Ga0207711_11039025 | Ga0207711_110390251 | 107 |
| 374 | 3300025942 | Ga0207689_10047690 | Ga0207689_100476903 | 107 |
| 375 | 3300025942 | Ga0207689_10581099 | Ga0207689_105810992 | 107 |
| 376 | 3300025942 | Ga0207689_11033401 | Ga0207689_110334011 | 107 |
| 377 | 3300025944 | Ga0207661_10159156 | Ga0207661_101591563 | 107 |
| 378 | 3300025945 | Ga0207679_10033000 | Ga0207679_100330005 | 107 |
| 379 | 3300025945 | Ga0207679_10034477 | Ga0207679_100344772 | 107 |
| 380 | 3300025945 | Ga0207679_10208304 | Ga0207679_102083042 | 107 |
| 381 | 3300025949 | Ga0207667_10002711 | Ga0207667_1000271114 | 107 |
| 382 | 3300025949 | Ga0207667_10020513 | Ga0207667_100205133 | 107 |
| 383 | 3300025949 | Ga0207667_10046088 | Ga0207667_100460885 | 107 |
| 384 | 3300025949 | Ga0207667_10210483 | Ga0207667_102104832 | 107 |
| 385 | 3300025949 | Ga0207667_10240844 | Ga0207667_102408443 | 107 |
| 386 | 3300025949 | Ga0207667_10250755 | Ga0207667_102507551 | 107 |
| 387 | 3300025960 | Ga0207651_11496591 | Ga0207651_114965912 | 107 |
| 388 | 3300025961 | Ga0207712_10030573 | Ga0207712_100305732 | 107 |
| 389 | 3300025961 | Ga0207712_10063884 | Ga0207712_100638844 | 107 |
| 390 | 3300025981 | Ga0207640_10104095 | Ga0207640_101040953 | 107 |
| 391 | 3300025981 | Ga0207640_10481768 | Ga0207640_104817682 | 107 |
| 392 | 3300025986 | Ga0207658_10028709 | Ga0207658_100287093 | 107 |
| 393 | 3300025986 | Ga0207658_10243804 | Ga0207658_102438043 | 107 |
| 394 | 3300025986 | Ga0207658_11716862 | Ga0207658_117168621 | 107 |
| 395 | 3300026023 | Ga0207677_10724913 | Ga0207677_107249131 | 107 |
| 396 | 3300026035 | Ga0207703_10000767 | Ga0207703_1000076710 | 107 |
| 397 | 3300026035 | Ga0207703_10003598 | Ga0207703_100035988 | 107 |
| 398 | 3300026035 | Ga0207703_10026715 | Ga0207703_100267156 | 107 |
| 399 | 3300026035 | Ga0207703_10030091 | Ga0207703_100300913 | 107 |
| 400 | 3300026041 | Ga0207639_10016461 | Ga0207639_100164616 | 107 |
| 401 | 3300026041 | Ga0207639_10032606 | Ga0207639_100326065 | 107 |
| 402 | 3300026041 | Ga0207639_10399889 | Ga0207639_103998892 | 107 |
| 403 | 3300026041 | Ga0207639_10617069 | Ga0207639_106170691 | 107 |
| 404 | 3300026041 | Ga0207639_12034650 | Ga0207639_120346501 | 107 |
| 405 | 3300026067 | Ga0207678_10031955 | Ga0207678_100319555 | 107 |
| 406 | 3300026067 | Ga0207678_10083126 | Ga0207678_100831263 | 107 |
| 407 | 3300026067 | Ga0207678_11885341 | Ga0207678_118853412 | 107 |
| 408 | 3300026075 | Ga0207708_10956465 | Ga0207708_109564651 | 107 |
| 409 | 3300026075 | Ga0207708_11541508 | Ga0207708_115415081 | 107 |
| 410 | 3300026078 | Ga0207702_10128822 | Ga0207702_101288222 | 107 |
| 411 | 3300026078 | Ga0207702_10617612 | Ga0207702_106176121 | 107 |
| 412 | 3300026078 | Ga0207702_10794213 | Ga0207702_107942132 | 107 |
| 413 | 3300026078 | Ga0207702_10901889 | Ga0207702_109018891 | 107 |
| 414 | 3300026088 | Ga0207641_10001749 | Ga0207641_1000174918 | 107 |
| 415 | 3300026088 | Ga0207641_10016369 | Ga0207641_100163696 | 107 |
| 416 | 3300026088 | Ga0207641_10101341 | Ga0207641_101013413 | 107 |
| 417 | 3300026089 | Ga0207648_10015173 | Ga0207648_100151739 | 107 |
| 418 | 3300026089 | Ga0207648_10786084 | Ga0207648_107860842 | 107 |
| 419 | 3300026095 | Ga0207676_10031009 | Ga0207676_100310093 | 107 |
| 420 | 3300026095 | Ga0207676_10113276 | Ga0207676_101132763 | 107 |
| 421 | 3300026116 | Ga0207674_10016484 | Ga0207674_100164842 | 107 |
| 422 | 3300026116 | Ga0207674_10248142 | Ga0207674_102481422 | 107 |
| 423 | 3300026116 | Ga0207674_10284419 | Ga0207674_102844192 | 107 |
| 424 | 3300026116 | Ga0207674_10729685 | Ga0207674_107296851 | 107 |
| 425 | 3300026118 | Ga0207675_100139626 | Ga0207675_1001396264 | 107 |
| 426 | 3300026118 | Ga0207675_100253070 | Ga0207675_1002530702 | 107 |
| 427 | 3300026118 | Ga0207675_100573859 | Ga0207675_1005738593 | 107 |
| 428 | 3300026121 | Ga0207683_10031261 | Ga0207683_100312613 | 107 |
| 429 | 3300026121 | Ga0207683_10205304 | Ga0207683_102053043 | 107 |
| 430 | 3300026142 | Ga0207698_11430596 | Ga0207698_114305962 | 107 |
| 431 | 3300027543 | Ga0209999_1083690 | Ga0209999_10836902 | 107 |
| 432 | 3300027671 | Ga0209588_1108203 | Ga0209588_11082032 | 107 |
| 433 | 3300027717 | Ga0209998_10013597 | Ga0209998_100135972 | 107 |
| 434 | 3300028379 | Ga0268266_10024612 | Ga0268266_100246125 | 107 |
| 435 | 3300028379 | Ga0268266_10041234 | Ga0268266_100412345 | 107 |
| 436 | 3300028379 | Ga0268266_10494293 | Ga0268266_104942932 | 107 |
| 437 | 3300028380 | Ga0268265_10015612 | Ga0268265_100156122 | 107 |
| 438 | 3300028380 | Ga0268265_10046107 | Ga0268265_100461072 | 107 |
| 439 | 3300028380 | Ga0268265_10561553 | Ga0268265_105615531 | 107 |
| 440 | 3300028380 | Ga0268265_10708477 | Ga0268265_107084772 | 107 |
| 441 | 3300028380 | Ga0268265_10751207 | Ga0268265_107512072 | 107 |
| 442 | 3300028381 | Ga0268264_10000034 | Ga0268264_10000034296 | 107 |
| 443 | 3300028381 | Ga0268264_10069363 | Ga0268264_100693635 | 107 |
| 444 | 3300028381 | Ga0268264_10099360 | Ga0268264_100993603 | 107 |
| 445 | 3300030521 | Ga0307511_10245353 | Ga0307511_102453531 | 107 |
| 446 | 3300030760 | Ga0265762_1120925 | Ga0265762_11209251 | 107 |
| 447 | 3300030863 | Ga0265766_1018627 | Ga0265766_10186271 | 107 |
| 448 | 3300031018 | Ga0265773_1004122 | Ga0265773_10041222 | 107 |
| 449 | 3300031238 | Ga0265332_10073069 | Ga0265332_100730692 | 107 |
| 450 | 3300031456 | Ga0307513_10215622 | Ga0307513_102156223 | 107 |
| 451 | 3300031548 | Ga0307408_100390661 | Ga0307408_1003906612 | 107 |
| 452 | 3300031665 | Ga0316575_10052474 | Ga0316575_100524743 | 107 |
| 453 | 3300031665 | Ga0316575_10319790 | Ga0316575_103197902 | 107 |
| 454 | 3300031727 | Ga0316576_10266909 | Ga0316576_102669093 | 107 |
| 455 | 3300031728 | Ga0316578_10374832 | Ga0316578_103748322 | 107 |
| 456 | 3300031730 | Ga0307516_10619235 | Ga0307516_106192351 | 107 |
| 457 | 3300031733 | Ga0316577_10161714 | Ga0316577_101617142 | 107 |
| 458 | 3300031733 | Ga0316577_10635844 | Ga0316577_106358442 | 107 |
| 459 | 3300031838 | Ga0307518_10501202 | Ga0307518_105012021 | 107 |
| 460 | 3300031852 | Ga0307410_10235849 | Ga0307410_102358492 | 107 |
| 461 | 3300031901 | Ga0307406_10240725 | Ga0307406_102407253 | 107 |
| 462 | 3300031903 | Ga0307407_10601137 | Ga0307407_106011372 | 107 |
| 463 | 3300031911 | Ga0307412_10729932 | Ga0307412_107299321 | 107 |
| 464 | 3300032002 | Ga0307416_100537147 | Ga0307416_1005371472 | 107 |
| 465 | 3300032002 | Ga0307416_101569799 | Ga0307416_1015697991 | 107 |
| 466 | 3300032126 | Ga0307415_100220596 | Ga0307415_1002205962 | 107 |
| 467 | 3300032133 | Ga0316583_10133012 | Ga0316583_101330122 | 107 |
| 468 | 3300033180 | Ga0307510_10000005 | Ga0307510_1000000589 | 107 |
| 469 | 3300033180 | Ga0307510_10015965 | Ga0307510_100159658 | 107 |
| 470 | 3300034817 | Ga0373948_0097737 | Ga0373948_0097737_22_345 | 107 |
| 471 | 3300034817 | Ga0373948_0212322 | Ga0373948_0212322_15_338 | 107 |
| 472 | 3300035084 | Ga0373928_0030234 | Ga0373928_0030234_617_940 | 107 |
| 473 | 3300035088 | Ga0373940_0159061 | Ga0373940_0159061_302_625 | 107 |
| 474 | 3300035111 | Ga0373923_0063128 | Ga0373923_0063128_1016_1339 | 107 |
| 475 | 3300035113 | Ga0373936_0393256 | Ga0373936_0393256_229_552 | 107 |
| 476 | 3300035116 | Ga0373945_0140389 | Ga0373945_0140389_378_701 | 107 |
| 477 | 3300035117 | Ga0373953_0133914 | Ga0373953_0133914_555_878 | 107 |
| 478 | 3300035119 | Ga0373956_0019200 | Ga0373956_0019200_2234_2557 | 107 |
| 479 | 3300035119 | Ga0373956_0267874 | Ga0373956_0267874_90_413 | 107 |
| 480 | 3300035120 | Ga0373957_0051890 | Ga0373957_0051890_633_956 | 107 |
| 481 | 3300035171 | Ga0373946_0111505 | Ga0373946_0111505_810_1133 | 107 |
| 482 | 3300035172 | Ga0373955_0114480 | Ga0373955_0114480_795_1118 | 107 |
| 483 | 3300035398 | Ga0316574_0042517 | Ga0316574_0042517_118_441 | 107 |
| 484 | 3300035398 | Ga0316574_0271069 | Ga0316574_0271069_21_344 | 107 |
| 485 | 3300035692 | Ga0373935_0172339 | Ga0373935_0172339_263_586 | 107 |
| 486 | 3300035692 | Ga0373935_0357917 | Ga0373935_0357917_230_553 | 107 |
| 487 | 3300035695 | Ga0373927_1112631 | Ga0373927_1112631_187_510 | 107 |
| 488 | 3300035724 | Ga0373933_0024168 | Ga0373933_0024168_1061_1384 | 107 |
| 489 | 3300035724 | Ga0373933_0101972 | Ga0373933_0101972_127_459 | 107 |
| 490 | 3300036401 | Ga0373937_0003400 | Ga0373937_0003400_11729_12052 | 107 |
| 491 | 3300036401 | Ga0373937_0046970 | Ga0373937_0046970_2505_2837 | 107 |
| 492 | 3300036401 | Ga0373937_0102977 | Ga0373937_0102977_433_756 | 107 |
| 493 | 3300036401 | Ga0373937_0172819 | Ga0373937_0172819_839_1162 | 107 |
| 494 | 3300036712 | Ga0316584_0054911 | Ga0316584_0054911_1565_1888 | 107 |
| 495 | 3300037068 | Ga0373925_0896864 | Ga0373925_0896864_383_706 | 107 |
| 496 | 3300037418 | Ga0395900_0638682 | Ga0395900_0638682_406_729 | 107 |
| 497 | 3300037466 | Ga0395898_0021247 | Ga0395898_0021247_3140_3463 | 107 |
| 498 | 3300037466 | Ga0395898_0144176 | Ga0395898_0144176_182_505 | 107 |
| 499 | 3300038443 | Ga0395901_0260698 | Ga0395901_0260698_616_942 | 107 |
| 500 | 3300038443 | Ga0395901_0773183 | Ga0395901_0773183_82_408 | 107 |
| 501 | 3300039437 | Ga0436365_0204524 | Ga0436365_0204524_4126_4449 | 107 |
| 502 | 3300039437 | Ga0436365_1728503 | Ga0436365_1728503_11_343 | 107 |
| 503 | 3300039438 | Ga0436360_0503581 | Ga0436360_0503581_251_574 | 107 |
| 504 | 3300039438 | Ga0436360_0561777 | Ga0436360_0561777_51_374 | 107 |
| 505 | 3300039438 | Ga0436360_0884838 | Ga0436360_0884838_7551_7874 | 107 |
| 506 | 3300039438 | Ga0436360_1049957 | Ga0436360_1049957_91_414 | 107 |
| 507 | 3300039438 | Ga0436360_1264219 | Ga0436360_1264219_2408_2731 | 107 |
| 508 | 3300039447 | Ga0436361_0958437 | Ga0436361_0958437_736_1059 | 107 |
| 509 | 3300039450 | Ga0436363_0402446 | Ga0436363_0402446_2708_3031 | 107 |
| 510 | 3300039450 | Ga0436363_0598179 | Ga0436363_0598179_243_566 | 107 |
| 511 | 3300039450 | Ga0436363_0854110 | Ga0436363_0854110_342_665 | 107 |
| 512 | 3300039450 | Ga0436363_1146804 | Ga0436363_1146804_1535_1858 | 107 |
| 513 | 3300039453 | Ga0436362_0372061 | Ga0436362_0372061_143_466 | 107 |
| 514 | 3300039453 | Ga0436362_0442781 | Ga0436362_0442781_145_468 | 107 |
| 515 | 3300039453 | Ga0436362_0465396 | Ga0436362_0465396_373_696 | 107 |
| 516 | 3300039453 | Ga0436362_1247594 | Ga0436362_1247594_485_808 | 107 |
| 517 | 3300041408 | Ga0439453_0159040 | Ga0439453_0159040_73_396 | 107 |
| 518 | 3300041453 | Ga0451797_0325197 | Ga0451797_0325197_192_515 | 107 |
| 519 | 3300041456 | Ga0451795_1363391 | Ga0451795_1363391_111_434 | 107 |
| 520 | 3300041491 | Ga0451833_1258513 | Ga0451833_1258513_12_335 | 107 |
| 521 | 3300042125 | Ga0450923_092392 | Ga0450923_092392_78_401 | 107 |
| 522 | 3300042156 | Ga0439446_0005312 | Ga0439446_0005312_1624_1950 | 107 |
| 523 | 3300042436 | Ga0439435_0085902 | Ga0439435_0085902_208_531 | 107 |
| 524 | 3300042530 | Ga0450916_018264 | Ga0450916_018264_232_555 | 107 |
| 525 | 3300042876 | Ga0451577_0015656 | Ga0451577_0015656_2811_3134 | 107 |
| 526 | 3300044673 | Ga0453683_0089708 | Ga0453683_0089708_1534_1857 | 107 |
| 527 | 3300044683 | Ga0466965_0121701 | Ga0466965_0121701_69_392 | 107 |
| 528 | 3300044693 | Ga0466961_0004699 | Ga0466961_0004699_6055_6378 | 107 |
| 529 | 3300044706 | Ga0466964_0005787 | Ga0466964_0005787_248_571 | 107 |
| 530 | 3300044712 | Ga0453684_0031657 | Ga0453684_0031657_3325_3648 | 107 |
| 531 | 3300044712 | Ga0453684_1788286 | Ga0453684_1788286_279_602 | 107 |
| 532 | 3300044765 | Ga0466970_0039657 | Ga0466970_0039657_1024_1347 | 107 |
| 533 | 3300045049 | Ga0466959_0040191 | Ga0466959_0040191_335_658 | 107 |
| 534 | 3300045051 | Ga0451576_0015133 | Ga0451576_0015133_6630_6953 | 107 |
| 535 | 3300045051 | Ga0451576_0142483 | Ga0451576_0142483_175_498 | 107 |
| 536 | 3300045051 | Ga0451576_1069270 | Ga0451576_1069270_68_391 | 107 |
| 537 | 3300045836 | Ga0466958_0222295 | Ga0466958_0222295_381_704 | 107 |
| 538 | 3300046455 | Ga0495603_0068798 | Ga0495603_0068798_754_1077 | 107 |
| 539 | 3300046459 | Ga0495629_0214492 | Ga0495629_0214492_488_811 | 107 |
| 540 | 3300046472 | Ga0495580_0112577 | Ga0495580_0112577_805_1128 | 107 |
| 541 | 3300046475 | Ga0495639_0166458 | Ga0495639_0166458_584_907 | 107 |
| 542 | 3300046475 | Ga0495639_0640326 | Ga0495639_0640326_94_426 | 107 |
| 543 | 3300046499 | Ga0495594_0435893 | Ga0495594_0435893_215_538 | 107 |
| 544 | 3300046506 | Ga0495583_0051955 | Ga0495583_0051955_319_642 | 107 |
| 545 | 3300046507 | Ga0495606_0579278 | Ga0495606_0579278_155_478 | 107 |
| 546 | 3300046517 | Ga0495630_0418605 | Ga0495630_0418605_306_629 | 107 |
| 547 | 3300046536 | Ga0495587_0079876 | Ga0495587_0079876_702_1025 | 107 |
| 548 | 3300046543 | Ga0495645_0868831 | Ga0495645_0868831_62_385 | 107 |
| 549 | 3300046648 | Ga0495611_0124587 | Ga0495611_0124587_191_514 | 107 |
| 550 | 3300046660 | Ga0495625_0388136 | Ga0495625_0388136_405_728 | 107 |
| 551 | 3300046664 | Ga0495659_0049173 | Ga0495659_0049173_579_902 | 107 |
| 552 | 3300046675 | Ga0495657_0066464 | Ga0495657_0066464_1888_2211 | 107 |
| 553 | 3300046675 | Ga0495657_0493905 | Ga0495657_0493905_129_452 | 107 |
| 554 | 3300046679 | Ga0495623_0024171 | Ga0495623_0024171_2372_2695 | 107 |
| 555 | 3300046681 | Ga0495647_0034424 | Ga0495647_0034424_508_831 | 107 |
| 556 | 3300046683 | Ga0495658_0114093 | Ga0495658_0114093_576_899 | 107 |
| 557 | 3300046692 | Ga0495671_0060069 | Ga0495671_0060069_1074_1397 | 107 |
| 558 | 3300046694 | Ga0495649_0180687 | Ga0495649_0180687_615_938 | 107 |
| 559 | 3300047320 | Ga0495672_0346698 | Ga0495672_0346698_303_626 | 107 |
| 560 | 3300047322 | Ga0495680_0324393 | Ga0495680_0324393_284_607 | 107 |
| 561 | 3300047443 | Ga0495687_097004 | Ga0495687_097004_365_688 | 107 |
| 562 | 3300047444 | Ga0495675_0085211 | Ga0495675_0085211_1258_1581 | 107 |
| 563 | 3300047446 | Ga0495679_047525 | Ga0495679_047525_511_864 | 107 |
| 564 | 3300047472 | Ga0495686_0005836 | Ga0495686_0005836_3977_4330 | 107 |
| 565 | 3300047472 | Ga0495686_0015719 | Ga0495686_0015719_4581_4934 | 107 |
| 566 | 3300048088 | Ga0495602_0146507 | Ga0495602_0146507_1100_1423 | 107 |
| 567 | 3300048903 | Ga0496100_0659174 | Ga0496100_0659174_44_367 | 107 |
| 568 | 3300048903 | Ga0496100_0868601 | Ga0496100_0868601_189_512 | 107 |
| 569 | 3300048904 | Ga0496101_0965309 | Ga0496101_0965309_322_645 | 107 |
| 570 | 3300048905 | Ga0496102_0022244 | Ga0496102_0022244_4571_4894 | 107 |
| 571 | 3300048905 | Ga0496102_0635779 | Ga0496102_0635779_50_373 | 107 |
| 572 | 3300048906 | Ga0496103_0342663 | Ga0496103_0342663_18_341 | 107 |
| 573 | 3300048906 | Ga0496103_0986511 | Ga0496103_0986511_121_453 | 107 |
| 574 | 3300048907 | Ga0496104_0059235 | Ga0496104_0059235_549_872 | 107 |
| 575 | 3300048908 | Ga0496105_0189689 | Ga0496105_0189689_153_476 | 107 |
| 576 | 3300048909 | Ga0496106_0101714 | Ga0496106_0101714_905_1228 | 107 |
| 577 | 3300048910 | Ga0496107_1042491 | Ga0496107_1042491_17_340 | 107 |
| 578 | 3300048911 | Ga0496108_0180231 | Ga0496108_0180231_469_792 | 107 |
| 579 | 3300048911 | Ga0496108_0252174 | Ga0496108_0252174_81_404 | 107 |
| 580 | 3300048911 | Ga0496108_1554965 | Ga0496108_1554965_115_438 | 107 |
| 581 | 3300048912 | Ga0496109_0011333 | Ga0496109_0011333_2418_2741 | 107 |
| 582 | 3300048912 | Ga0496109_0248585 | Ga0496109_0248585_146_469 | 107 |
| 583 | 3300048913 | Ga0496110_0131653 | Ga0496110_0131653_1848_2171 | 107 |
| 584 | 3300048913 | Ga0496110_0280917 | Ga0496110_0280917_218_541 | 107 |
| 585 | 3300048914 | Ga0496111_0197173 | Ga0496111_0197173_931_1254 | 107 |
| 586 | 3300048915 | Ga0496112_0002877 | Ga0496112_0002877_8219_8542 | 107 |
| 587 | 3300048915 | Ga0496112_0216241 | Ga0496112_0216241_192_515 | 107 |
| 588 | 3300048915 | Ga0496112_1553466 | Ga0496112_1553466_205_528 | 107 |
| 589 | 3300048916 | Ga0496113_1389917 | Ga0496113_1389917_201_524 | 107 |
| 590 | 3300048917 | Ga0496114_0000553 | Ga0496114_0000553_26367_26690 | 107 |
| 591 | 3300048918 | Ga0496115_0435304 | Ga0496115_0435304_353_676 | 107 |
| 592 | 3300048919 | Ga0496116_0002539 | Ga0496116_0002539_4169_4492 | 107 |
| 593 | 3300048920 | Ga0496117_0000012 | Ga0496117_0000012_522103_522426 | 107 |
| 594 | 3300048920 | Ga0496117_0330297 | Ga0496117_0330297_331_654 | 107 |
| 595 | 3300048921 | Ga0496118_0000051 | Ga0496118_0000051_153219_153542 | 107 |
| 596 | 3300048922 | Ga0496119_0001899 | Ga0496119_0001899_4998_5321 | 107 |
| 597 | 3300048922 | Ga0496119_0015454 | Ga0496119_0015454_3147_3470 | 107 |
| 598 | 3300048922 | Ga0496119_0391285 | Ga0496119_0391285_41_364 | 107 |
| 599 | 3300048923 | Ga0496120_0000191 | Ga0496120_0000191_12139_12462 | 107 |
| 600 | 3300048923 | Ga0496120_0379879 | Ga0496120_0379879_167_490 | 107 |
| 601 | 3300048924 | Ga0496121_0047554 | Ga0496121_0047554_2823_3146 | 107 |
| 602 | 3300048927 | Ga0496124_0055897 | Ga0496124_0055897_1699_2022 | 107 |
| 603 | 3300048927 | Ga0496124_0158964 | Ga0496124_0158964_307_630 | 107 |
| 604 | 3300048928 | Ga0496125_0002488 | Ga0496125_0002488_16583_16906 | 107 |
| 605 | 3300048928 | Ga0496125_0057972 | Ga0496125_0057972_1901_2224 | 107 |
| 606 | 3300048928 | Ga0496125_0389330 | Ga0496125_0389330_479_802 | 107 |
| 607 | 3300048929 | Ga0496126_0014282 | Ga0496126_0014282_777_1100 | 107 |
| 608 | 3300048929 | Ga0496126_0054680 | Ga0496126_0054680_2110_2433 | 107 |
| 609 | 3300048929 | Ga0496126_0060199 | Ga0496126_0060199_2921_3244 | 107 |
| 610 | 3300048929 | Ga0496126_1214645 | Ga0496126_1214645_34_357 | 107 |
| 611 | 3300049571 | Ga0501034_1418009 | Ga0501034_1418009_154_477 | 107 |
| 612 | 3300049572 | Ga0501036_0370075 | Ga0501036_0370075_658_981 | 107 |
| 613 | 3300049575 | Ga0501039_0030860 | Ga0501039_0030860_2793_3116 | 107 |
| 614 | 3300049576 | Ga0501040_0686352 | Ga0501040_0686352_391_714 | 107 |
| 615 | 3300049577 | Ga0501041_0114551 | Ga0501041_0114551_194_517 | 107 |
| 616 | 3300049577 | Ga0501041_0745426 | Ga0501041_0745426_210_533 | 107 |
| 617 | 3300049578 | Ga0501042_0097698 | Ga0501042_0097698_604_927 | 107 |
| 618 | 3300049579 | Ga0501043_0397993 | Ga0501043_0397993_174_497 | 107 |
| 619 | 3300049580 | Ga0501046_0670398 | Ga0501046_0670398_247_570 | 107 |
| 620 | 3300049582 | Ga0501048_0700513 | Ga0501048_0700513_10_333 | 107 |
| 621 | 3300049586 | Ga0501070_0016490 | Ga0501070_0016490_998_1324 | 107 |
| 622 | 3300049587 | Ga0501071_0564991 | Ga0501071_0564991_452_775 | 107 |
| 623 | 3300049590 | Ga0501074_0719773 | Ga0501074_0719773_22_345 | 107 |
| 624 | 3300049592 | Ga0501076_0041080 | Ga0501076_0041080_2763_3086 | 107 |
| 625 | 3300049593 | Ga0501077_0678264 | Ga0501077_0678264_316_639 | 107 |
| 626 | 3300049741 | Ga0501079_0130160 | Ga0501079_0130160_1557_1880 | 107 |
| 627 | 3300049743 | Ga0501081_0011175 | Ga0501081_0011175_4295_4618 | 107 |
| 628 | 3300049743 | Ga0501081_0324473 | Ga0501081_0324473_588_911 | 107 |
| 629 | 3300049822 | Ga0501035_0385471 | Ga0501035_0385471_585_911 | 107 |
| 630 | 3300049823 | Ga0501044_0269936 | Ga0501044_0269936_565_891 | 107 |
| 631 | 3300049824 | Ga0501045_1019955 | Ga0501045_1019955_158_481 | 107 |
| 632 | 3300050493 | nmdc:mga0k408_372635_c1 | nmdc:mga0k408_372635_c1_465_788 | 107 |
| 633 | 3300050511 | nmdc:mga08y16_447238_c1 | nmdc:mga08y16_447238_c1_516_839 | 107 |
| 634 | 3300050512 | nmdc:mga0n895_480458_c1 | nmdc:mga0n895_480458_c1_764_1087 | 107 |
| 635 | 3300050513 | nmdc:mga0rr50_488937_c1 | nmdc:mga0rr50_488937_c1_712_1035 | 107 |
| 636 | 3300053077 | Ga0495601_0052031 | Ga0495601_0052031_200_523 | 107 |
| 637 | 3300053077 | Ga0495601_0084901 | Ga0495601_0084901_229_552 | 107 |
| 638 | 3300053078 | Ga0495612_0379373 | Ga0495612_0379373_139_462 | 107 |
| 639 | 3300053084 | Ga0495595_0242483 | Ga0495595_0242483_474_797 | 107 |
| 640 | 3300053085 | Ga0495619_0754353 | Ga0495619_0754353_39_362 | 107 |
| 641 | 3300053090 | Ga0500646_0077941 | Ga0500646_0077941_516_839 | 107 |
| 642 | 3300053090 | Ga0500646_0107789 | Ga0500646_0107789_209_532 | 107 |
| 643 | 3300053092 | Ga0500583_0048764 | Ga0500583_0048764_410_733 | 107 |
| 644 | 3300053093 | Ga0500651_0088466 | Ga0500651_0088466_382_705 | 107 |
| 645 | 3300053093 | Ga0500651_0675469 | Ga0500651_0675469_70_423 | 107 |
| 646 | 3300053096 | Ga0500641_0012762 | Ga0500641_0012762_758_1081 | 107 |
| 647 | 3300053098 | Ga0500650_0189283 | Ga0500650_0189283_477_800 | 107 |
| 648 | 3300053111 | Ga0500572_034127 | Ga0500572_034127_884_1207 | 107 |
| 649 | 3300053133 | Ga0500655_062447 | Ga0500655_062447_47_370 | 107 |
| 650 | 3300053136 | Ga0500559_0091769 | Ga0500559_0091769_783_1136 | 107 |
| 651 | 3300053136 | Ga0500559_0400499 | Ga0500559_0400499_162_485 | 107 |
| 652 | 3300053139 | Ga0500568_0092059 | Ga0500568_0092059_330_653 | 107 |
| 653 | 3300053148 | Ga0500590_098499 | Ga0500590_098499_51_374 | 107 |
| 654 | 3300053153 | Ga0500616_0000018 | Ga0500616_0000018_34147_34470 | 107 |
| 655 | 3300053156 | Ga0500622_0007139 | Ga0500622_0007139_4649_4972 | 107 |
| 656 | 3300053732 | Ga0500656_058277 | Ga0500656_058277_233_556 | 107 |
| 657 | 3300059645 | Ga0587076_165251 | Ga0587076_165251_115_438 | 107 |
| 658 | 3300059645 | Ga0587076_178932 | Ga0587076_178932_42_365 | 107 |
| 659 | 3300059655 | Ga0587114_141677 | Ga0587114_141677_113_436 | 107 |
| 660 | 3300060353 | Ga0501082_0411674 | Ga0501082_0411674_677_1000 | 107 |
| 661 | 3300061719 | Ga0466962_0007877 | Ga0466962_0007877_294_617 | 107 |
| 662 | 3300061734 | Ga0530510_0685578 | Ga0530510_0685578_276_599 | 107 |
| 663 | iso_pu_bacteria | 8054302542 | 8054303952 | 107 |
| 664 | iso_pu_bacteria | 8057101203 | 8057101338 | 107 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.9375 | 3 | 96 |
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.9258 | 1 | 97 |
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.9168 | 1 | 97 |
| 2d2a-assembly2.cif.gz_B-2 | crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters | 0.9133 | 1 | 95 |
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.901 | 3 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s98A00 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.9375 | 3 | 96 | 2.60.300.12 |
| 2d2aB01 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.918 | 3 | 95 | 2.60.300.12 |
| 1s98A00 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.901 | 3 | 96 | 2.60.300.12 |
| 2d2aB01 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8994 | 3 | 95 | 2.60.300.12 |
| af_A0A0R0F1L8_21_105_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8973 | 2 | 85 | 2.60.300.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7U6KQS0-F1-model_v4 | Iron-binding protein IscA | 0.9723 | 3 | 83 |
GO:0005829
GO:0016226 GO:0051537 GO:0097428 |
| AF-A0A2E9REK1-F1-model_v4 | Iron-sulfur cluster assembly protein IscA | 0.9686 | 1 | 84 |
GO:0005829
GO:0016226 GO:0051537 GO:0097428 |
| AF-A0A376SBE1-F1-model_v4 | Iron-binding protein IscA (Iron-sulfur cluster assembly protein) | 0.9608 | 1 | 97 |
GO:0005506
GO:0005829 GO:0016226 GO:0051537 GO:0097428 |
| AF-A0A2P0QN95-F1-model_v4 | Heme biosynthesis protein | 0.9591 | 1 | 91 |
GO:0005829
GO:0016226 GO:0051537 GO:0097428 |
| AF-A0A2X4TF71-F1-model_v4 | Iron binding protein SufA for iron-sulfur cluster assembly | 0.9588 | 2 | 94 |
GO:0005829
GO:0016226 GO:0046872 GO:0051537 GO:0097428 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar