F473615

General Info

Members Datasets Scaffolds Average Seq Length
664 354 662 107

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10750842|Ga0105240_107508421
Length 131
Sequence MHCVHALESGRRLKSQALKFPHRAMSISLTESAAQRVKTFLTARGRGLGLRLGVRKTGCSGFAYVINYADDANPDDLVFEDRGVKVFVDPASLSLIDGTIVDFVKQGLNEAFRFKNPNVKGECGCGESFSV

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
114 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
193 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
200 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
201 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
204 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
214 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
215 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
216 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
239 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
240 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
241 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
242 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
243 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
244 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
245 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
246 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
249 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
250 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
251 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
252 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
253 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
257 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
262 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
275 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
276 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
281 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
304 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
319 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
320 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
321 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
322 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
323 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
324 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
327 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
336 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
337 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
338 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
339 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
340 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
341 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
342 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
343 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
344 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
345 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
346 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
347 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
348 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
351 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
352 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
353 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
354 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.18
Metatranscriptomes 4.52
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.86
Nodule 0
Rhizoplane 4.07
Rhizosphere 87.8
Stem 0
Stem Tuber 0
Unclassified 5.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11957120 3300004799 Bacteria 929
2 Ga0058861_11958246 3300004800 Unclassified 669
3 Ga0058862_12257844 3300004803 Unclassified 596
4 Ga0065704_10465469 3300005289 Bacteria 693
5 Ga0065715_10247026 3300005293 Bacteria 1180
6 Ga0065715_10808713 3300005293 Bacteria 607
7 Ga0065707_10081981 3300005295 Bacteria 26321
8 Ga0070658_10461614 3300005327 Unclassified 1095
9 Ga0070676_11008436 3300005328 Bacteria 625
10 Ga0070683_100145553 3300005329 Bacteria 2245
11 Ga0070690_100002121 3300005330 Bacteria 10594
12 Ga0070690_100086925 3300005330 Bacteria 2053
13 Ga0070670_100001924 3300005331 Bacteria 17002
14 Ga0070670_100099387 3300005331 Bacteria 2503
15 Ga0070670_100933581 3300005331 Unclassified 787
16 Ga0068869_100035837 3300005334 Bacteria 3519
17 Ga0068869_100481751 3300005334 Bacteria 1033
18 Ga0070666_10011147 3300005335 Bacteria 5633
19 Ga0070666_11355469 3300005335 Unclassified 531
20 Ga0070680_100147093 3300005336 Bacteria 1977
21 Ga0070680_100151322 3300005336 Bacteria 1948
22 Ga0070680_100242182 3300005336 Bacteria 1524
23 Ga0070682_100894863 3300005337 Bacteria 729
24 Ga0068868_100001397 3300005338 Bacteria 16654
25 Ga0068868_100023979 3300005338 Bacteria 4624
26 Ga0070660_100809383 3300005339 Bacteria 788
27 Ga0070689_100001863 3300005340 Bacteria 13592
28 Ga0070689_100024663 3300005340 Bacteria 4511
29 Ga0070687_100344915 3300005343 Bacteria 959
30 Ga0070661_100166812 3300005344 Bacteria 1671
31 Ga0070661_100212839 3300005344 Bacteria 1480
32 Ga0070661_100444680 3300005344 Bacteria 1031
33 Ga0070661_100631639 3300005344 Bacteria 868
34 Ga0070668_102218060 3300005347 Unclassified 507
35 Ga0070669_100330030 3300005353 Bacteria 1234
36 Ga0070675_100432322 3300005354 Bacteria 1178
37 Ga0070671_100010034 3300005355 Bacteria 7606
38 Ga0070671_100042592 3300005355 Bacteria 3774
39 Ga0070671_100312097 3300005355 Bacteria 1339
40 Ga0070671_101345848 3300005355 Bacteria 630
41 Ga0070674_100647812 3300005356 Bacteria 898
42 Ga0070673_100070874 3300005364 Bacteria 2799
43 Ga0070673_100077826 3300005364 Bacteria 2681
44 Ga0070673_100109305 3300005364 Bacteria 2290
45 Ga0070673_100846816 3300005364 Bacteria 846
46 Ga0070667_100015817 3300005367 Bacteria 6242
47 Ga0070667_100135150 3300005367 Bacteria 2156
48 Ga0070667_100203437 3300005367 Bacteria 1757
49 Ga0070667_101889047 3300005367 Bacteria 562
50 Ga0070703_10193838 3300005406 Unclassified 793
51 Ga0070703_10458897 3300005406 Bacteria 566
52 Ga0070709_10010626 3300005434 Bacteria 5104
53 Ga0070709_10291274 3300005434 Bacteria 1190
54 Ga0070709_11078165 3300005434 Bacteria 642
55 Ga0070714_100639068 3300005435 Bacteria 1024
56 Ga0070713_101217907 3300005436 Unclassified 729
57 Ga0070713_101745695 3300005436 Bacteria 604
58 Ga0070701_10060226 3300005438 Bacteria 1998
59 Ga0070711_100103312 3300005439 Bacteria 2077
60 Ga0070711_100432853 3300005439 Unclassified 1074
61 Ga0070705_100007578 3300005440 Bacteria 5347
62 Ga0070700_100048866 3300005441 Bacteria 2623
63 Ga0070694_100392628 3300005444 Unclassified 1084
64 Ga0070678_100795147 3300005456 Bacteria 858
65 Ga0070662_100637218 3300005457 Unclassified 898
66 Ga0070681_10001620 3300005458 Bacteria 20049
67 Ga0070681_10002862 3300005458 Bacteria 15945
68 Ga0070681_10006571 3300005458 Bacteria 11322
69 Ga0070681_10041707 3300005458 Bacteria 4600
70 Ga0070681_10053934 3300005458 Bacteria 4006
71 Ga0070681_10132051 3300005458 Bacteria 2429
72 Ga0068867_100008135 3300005459 Bacteria 7411
73 Ga0070685_10232602 3300005466 Bacteria 1213
74 Ga0070685_10407011 3300005466 Bacteria 943
75 Ga0070707_100124009 3300005468 Bacteria 2509
76 Ga0070707_101596557 3300005468 Bacteria 619
77 Ga0070698_100509024 3300005471 Bacteria 1142
78 Ga0070699_100042960 3300005518 Bacteria 3913
79 Ga0070679_100005320 3300005530 Bacteria 11910
80 Ga0070679_100017074 3300005530 Bacteria 7016
81 Ga0070679_100118799 3300005530 Bacteria 2628
82 Ga0070679_100458135 3300005530 Bacteria 1220
83 Ga0070684_100040924 3300005535 Bacteria 3993
84 Ga0070684_100177126 3300005535 Bacteria 1938
85 Ga0068853_100165848 3300005539 Bacteria 1996
86 Ga0068853_100173829 3300005539 Bacteria 1950
87 Ga0070672_100082670 3300005543 Bacteria 2576
88 Ga0070686_100001796 3300005544 Bacteria 11966
89 Ga0070686_100011605 3300005544 Bacteria 5003
90 Ga0070695_100015703 3300005545 Bacteria 4574
91 Ga0070695_100241668 3300005545 Bacteria 1310
92 Ga0070695_100709838 3300005545 Bacteria 799
93 Ga0070696_101304529 3300005546 Bacteria 616
94 Ga0070693_100014873 3300005547 Bacteria 3998
95 Ga0070665_100008574 3300005548 Bacteria 10347
96 Ga0070665_100057769 3300005548 Bacteria 3890
97 Ga0070665_100107778 3300005548 Unclassified 2788
98 Ga0070665_100364384 3300005548 Bacteria 1452
99 Ga0070665_100592222 3300005548 Unclassified 1122
100 Ga0070704_100223321 3300005549 Bacteria 1533
101 Ga0068855_100007775 3300005563 Bacteria 12949
102 Ga0068855_100060642 3300005563 Bacteria 4423
103 Ga0068855_100362959 3300005563 Bacteria 1593
104 Ga0068855_100483742 3300005563 Bacteria 1347
105 Ga0070664_100007434 3300005564 Bacteria 8841
106 Ga0070664_100061436 3300005564 Bacteria 3202
107 Ga0070664_100495069 3300005564 Bacteria 1126
108 Ga0068857_100149355 3300005577 Bacteria 2116
109 Ga0068857_100512187 3300005577 Bacteria 1127
110 Ga0068854_100286195 3300005578 Bacteria 1329
111 Ga0068856_100097244 3300005614 Bacteria 2933
112 Ga0068856_100252331 3300005614 Bacteria 1779
113 Ga0068856_100647874 3300005614 Bacteria 1077
114 Ga0068856_100924190 3300005614 Bacteria 891
115 Ga0070702_100002720 3300005615 Bacteria 7730
116 Ga0070702_100003056 3300005615 Bacteria 7405
117 Ga0068852_100130815 3300005616 Bacteria 2311
118 Ga0068852_101176186 3300005616 Bacteria 788
119 Ga0068852_101322112 3300005616 Bacteria 743
120 Ga0068859_100012440 3300005617 Bacteria 8563
121 Ga0068859_100027419 3300005617 Bacteria 5713
122 Ga0068859_100049529 3300005617 Bacteria 4218
123 Ga0068859_102966282 3300005617 Bacteria 519
124 Ga0068864_100006569 3300005618 Bacteria 9522
125 Ga0068864_100017803 3300005618 Bacteria 5927
126 Ga0068861_100125587 3300005719 Bacteria 2075
127 Ga0068861_100191922 3300005719 Bacteria 1708
128 Ga0068851_10546132 3300005834 Bacteria 700
129 Ga0068870_10009276 3300005840 Bacteria 4467
130 Ga0068863_100002915 3300005841 Bacteria 16961
131 Ga0068863_100021655 3300005841 Bacteria 6131
132 Ga0068858_100001624 3300005842 Bacteria 22933
133 Ga0068858_100003897 3300005842 Bacteria 14743
134 Ga0068858_100008115 3300005842 Bacteria 10102
135 Ga0068858_100008369 3300005842 Bacteria 9950
136 Ga0068860_100001031 3300005843 Bacteria 30723
137 Ga0068860_100003582 3300005843 Bacteria 15965
138 Ga0068860_100577980 3300005843 Bacteria 1127
139 Ga0068862_100002789 3300005844 Bacteria 15310
140 Ga0068862_100033230 3300005844 Bacteria 4359
141 Ga0068862_100420118 3300005844 Bacteria 1255
142 Ga0068862_101037158 3300005844 Bacteria 812
143 Ga0068862_102252761 3300005844 Bacteria 556
144 Ga0081455_10325722 3300005937 Bacteria 1092
145 Ga0070715_10223626 3300006163 Bacteria 969
146 Ga0070716_100033769 3300006173 Bacteria 2801
147 Ga0070712_100039915 3300006175 Bacteria 3214
148 Ga0075366_10332343 3300006195 Bacteria 932
149 Ga0097621_100154132 3300006237 Bacteria 1971
150 Ga0097621_100197877 3300006237 Unclassified 1743
151 Ga0097621_100233878 3300006237 Bacteria 1605
152 Ga0097621_100501680 3300006237 Bacteria 1099
153 Ga0097621_101478377 3300006237 Bacteria 644
154 Ga0068871_100012828 3300006358 Bacteria 6202
155 Ga0068871_100017723 3300006358 Bacteria 5396
156 Ga0068871_100787681 3300006358 Bacteria 876
157 Ga0068871_100885703 3300006358 Bacteria 827
158 Ga0068871_101868540 3300006358 Bacteria 571
159 Ga0075428_100277023 3300006844 Bacteria 1805
160 Ga0097620_100012440 3300006931 Bacteria 8563
161 Ga0097620_100027419 3300006931 Bacteria 5713
162 Ga0097620_100049529 3300006931 Bacteria 4218
163 Ga0097620_102966061 3300006931 Bacteria 519
164 Ga0075435_101127205 3300007076 Bacteria 686
165 Ga0099794_10040579 3300007265 Bacteria 2214
166 Ga0099795_10028868 3300007788 Bacteria 1891
167 Ga0105250_10414141 3300009092 Archaea 600
168 Ga0105240_10004508 3300009093 Bacteria 21175
169 Ga0105240_10006950 3300009093 Bacteria 16531
170 Ga0105240_10034801 3300009093 Bacteria 6495
171 Ga0105240_10123818 3300009093 Bacteria 3110
172 Ga0105240_10137039 3300009093 Bacteria 2931
173 Ga0105240_10164797 3300009093 Bacteria 2629
174 Ga0105240_10315115 3300009093 Bacteria 1785
175 Ga0105240_10371832 3300009093 Bacteria 1616
176 Ga0105240_10750842 3300009093 Unclassified 1061
177 Ga0111539_10522401 3300009094 Bacteria 1383
178 Ga0111539_13274792 3300009094 Bacteria 522
179 Ga0105245_10004600 3300009098 Bacteria 12183
180 Ga0105245_10212834 3300009098 Bacteria 1861
181 Ga0105245_12807405 3300009098 Unclassified 540
182 Ga0105247_10002076 3300009101 Bacteria 13871
183 Ga0105247_10049060 3300009101 Bacteria 2595
184 Ga0105243_10911271 3300009148 Bacteria 875
185 Ga0105241_10313424 3300009174 Bacteria 1350
186 Ga0105241_10523634 3300009174 Bacteria 1061
187 Ga0105241_11179072 3300009174 Unclassified 724
188 Ga0105242_10210880 3300009176 Bacteria 1731
189 Ga0105242_10399385 3300009176 Bacteria 1282
190 Ga0105242_10944122 3300009176 Bacteria 866
191 Ga0105248_10001365 3300009177 Bacteria 27260
192 Ga0105248_10009098 3300009177 Bacteria 10925
193 Ga0105248_10776586 3300009177 Bacteria 1081
194 Ga0105248_11748534 3300009177 Bacteria 705
195 Ga0105237_10098268 3300009545 Bacteria 2918
196 Ga0105237_10106357 3300009545 Bacteria 2798
197 Ga0105237_10272325 3300009545 Bacteria 1696
198 Ga0105237_10646707 3300009545 Bacteria 1064
199 Ga0105237_10744102 3300009545 Bacteria 987
200 Ga0105237_10747573 3300009545 Unclassified 984
201 Ga0105238_10009671 3300009551 Bacteria 9650
202 Ga0105238_10011065 3300009551 Bacteria 9066
203 Ga0105238_10043932 3300009551 Bacteria 4520
204 Ga0105238_10093709 3300009551 Bacteria 2991
205 Ga0105238_10111451 3300009551 Bacteria 2716
206 Ga0105238_10182990 3300009551 Bacteria 2072
207 Ga0105238_10265344 3300009551 Bacteria 1697
208 Ga0105238_10280903 3300009551 Bacteria 1646
209 Ga0105238_11778471 3300009551 Bacteria 648
210 Ga0105249_10041100 3300009553 Bacteria 4203
211 Ga0105249_10609021 3300009553 Unclassified 1147
212 Ga0105249_13308021 3300009553 Bacteria 519
213 Ga0105239_10223877 3300010375 Bacteria 2110
214 Ga0105239_10469108 3300010375 Bacteria 1429
215 Ga0105239_10673697 3300010375 Bacteria 1182
216 Ga0105239_11650432 3300010375 Bacteria 742
217 Ga0105246_10000629 3300011119 Bacteria 19668
218 Ga0105246_10246888 3300011119 Bacteria 1414
219 Ga0157370_10000459 3300013104 Bacteria 51005
220 Ga0157370_10180632 3300013104 Bacteria 1961
221 Ga0157369_10003155 3300013105 Bacteria 19674
222 Ga0157369_10069500 3300013105 Bacteria 3783
223 Ga0157374_10003246 3300013296 Bacteria 13663
224 Ga0157374_10337957 3300013296 Bacteria 1494
225 Ga0157378_10093732 3300013297 Bacteria 2734
226 Ga0157378_10096849 3300013297 Bacteria 2689
227 Ga0157378_10198275 3300013297 Bacteria 1897
228 Ga0163162_10033820 3300013306 Bacteria 5082
229 Ga0163162_10133442 3300013306 Bacteria 2593
230 Ga0163162_10286820 3300013306 Bacteria 1778
231 Ga0157372_10339449 3300013307 Bacteria 1750
232 Ga0157372_10497216 3300013307 Bacteria 1422
233 Ga0157372_12327055 3300013307 Unclassified 615
234 Ga0157375_10007739 3300013308 Bacteria 9406
235 Ga0157375_10100255 3300013308 Bacteria 2976
236 Ga0157375_10233645 3300013308 Bacteria 1998
237 Ga0163163_10000692 3300014325 Bacteria 28661
238 Ga0163163_10001624 3300014325 Bacteria 18915
239 Ga0163163_10164064 3300014325 Bacteria 2267
240 Ga0163163_10732000 3300014325 Unclassified 1053
241 Ga0163163_11914495 3300014325 Bacteria 653
242 Ga0157380_10000885 3300014326 Bacteria 18825
243 Ga0157380_10574845 3300014326 Bacteria 1110
244 Ga0157380_11372047 3300014326 Bacteria 756
245 Ga0157377_10012579 3300014745 Bacteria 4259
246 Ga0157377_10013226 3300014745 Bacteria 4173
247 Ga0157377_10342744 3300014745 Bacteria 1000
248 Ga0157377_10404734 3300014745 Bacteria 930
249 Ga0157379_10016486 3300014968 Bacteria 6499
250 Ga0157379_10185619 3300014968 Bacteria 1879
251 Ga0157379_10297752 3300014968 Bacteria 1470
252 Ga0157379_12028710 3300014968 Bacteria 569
253 Ga0157376_10176658 3300014969 Bacteria 1948
254 Ga0157376_10300082 3300014969 Bacteria 1520
255 Ga0157376_10314122 3300014969 Bacteria 1487
256 Ga0157376_10805707 3300014969 Bacteria 952
257 Ga0183363_1004 3300015690 Bacteria 416766
258 Ga0163161_10154881 3300017792 Bacteria 1744
259 Ga0163161_11316457 3300017792 Unclassified 628
260 Ga0197907_11203698 3300020069 Bacteria 545
261 Ga0197907_11224261 3300020069 Unclassified 700
262 Ga0206356_10358157 3300020070 Unclassified 582
263 Ga0206356_10412598 3300020070 Bacteria 888
264 Ga0206356_11614036 3300020070 Unclassified 538
265 Ga0206355_1043388 3300020076 Unclassified 719
266 Ga0206355_1367740 3300020076 Bacteria 563
267 Ga0206355_1452525 3300020076 Bacteria 670
268 Ga0206355_1480611 3300020076 Bacteria 777
269 Ga0206352_10596986 3300020078 Bacteria 594
270 Ga0206350_10546148 3300020080 Bacteria 577
271 Ga0206354_10626539 3300020081 Bacteria 735
272 Ga0206354_10890305 3300020081 Bacteria 505
273 Ga0206353_11188132 3300020082 Bacteria 595
274 Ga0206353_11414259 3300020082 Bacteria 725
275 Ga0154015_1316723 3300020610 Unclassified 656
276 Ga0154015_1381318 3300020610 Unclassified 554
277 Ga0213872_10107353 3300021361 Bacteria 1242
278 Ga0213872_10429367 3300021361 Unclassified 533
279 Ga0213874_10198054 3300021377 Bacteria 721
280 Ga0213874_10306114 3300021377 Bacteria 599
281 Ga0213876_10057606 3300021384 Bacteria 2052
282 Ga0213871_10017881 3300021441 Bacteria 1728
283 Ga0224712_10160465 3300022467 Bacteria 1002
284 Ga0224712_10287776 3300022467 Bacteria 766
285 Ga0224712_10447532 3300022467 Bacteria 620
286 Ga0224712_10567068 3300022467 Bacteria 553
287 Ga0209233_1006030 3300025261 Bacteria 3949
288 Ga0207656_10269322 3300025321 Bacteria 838
289 Ga0207653_10172882 3300025885 Unclassified 805
290 Ga0207692_10306053 3300025898 Unclassified 969
291 Ga0207642_10070818 3300025899 Bacteria 1659
292 Ga0207710_10049145 3300025900 Bacteria 1889
293 Ga0207710_10198153 3300025900 Bacteria 991
294 Ga0207688_10087695 3300025901 Bacteria 1784
295 Ga0207680_10019137 3300025903 Bacteria 3657
296 Ga0207680_10061568 3300025903 Bacteria 2289
297 Ga0207680_10332567 3300025903 Bacteria 1064
298 Ga0207685_10664454 3300025905 Bacteria 564
299 Ga0207699_10003329 3300025906 Bacteria 7663
300 Ga0207699_10389950 3300025906 Bacteria 990
301 Ga0207699_11480015 3300025906 Unclassified 502
302 Ga0207645_10189260 3300025907 Unclassified 1352
303 Ga0207645_10805441 3300025907 Bacteria 639
304 Ga0207643_10024492 3300025908 Bacteria 3331
305 Ga0207705_10681243 3300025909 Unclassified 799
306 Ga0207654_11151168 3300025911 Bacteria 565
307 Ga0207707_10000751 3300025912 Bacteria 31949
308 Ga0207707_10005824 3300025912 Bacteria 10768
309 Ga0207707_10031131 3300025912 Bacteria 4668
310 Ga0207707_10032336 3300025912 Bacteria 4578
311 Ga0207707_10065695 3300025912 Bacteria 3160
312 Ga0207707_10112551 3300025912 Bacteria 2380
313 Ga0207707_10200681 3300025912 Unclassified 1739
314 Ga0207695_10003874 3300025913 Bacteria 20704
315 Ga0207695_10015725 3300025913 Bacteria 8896
316 Ga0207695_10058238 3300025913 Bacteria 4011
317 Ga0207695_10273733 3300025913 Bacteria 1583
318 Ga0207695_10419846 3300025913 Bacteria 1222
319 Ga0207695_11260628 3300025913 Bacteria 619
320 Ga0207671_10047000 3300025914 Bacteria 3194
321 Ga0207671_10091470 3300025914 Bacteria 2293
322 Ga0207671_10179431 3300025914 Bacteria 1647
323 Ga0207671_10563022 3300025914 Bacteria 909
324 Ga0207671_10903191 3300025914 Unclassified 698
325 Ga0207693_10046533 3300025915 Bacteria 3408
326 Ga0207663_10040738 3300025916 Bacteria 2826
327 Ga0207660_10420089 3300025917 Unclassified 1078
328 Ga0207662_10002408 3300025918 Bacteria 9382
329 Ga0207662_10500817 3300025918 Bacteria 836
330 Ga0207657_11433754 3300025919 Bacteria 518
331 Ga0207649_10005712 3300025920 Bacteria 6734
332 Ga0207649_10018291 3300025920 Bacteria 3982
333 Ga0207649_11142174 3300025920 Bacteria 615
334 Ga0207652_10000818 3300025921 Bacteria 29680
335 Ga0207652_10023502 3300025921 Bacteria 5108
336 Ga0207681_10264177 3300025923 Bacteria 1349
337 Ga0207694_10034992 3300025924 Bacteria 3852
338 Ga0207694_10051744 3300025924 Bacteria 3183
339 Ga0207694_10089148 3300025924 Bacteria 2432
340 Ga0207694_10094312 3300025924 Bacteria 2365
341 Ga0207694_10095989 3300025924 Bacteria 2345
342 Ga0207694_10170232 3300025924 Bacteria 1763
343 Ga0207694_10226114 3300025924 Bacteria 1527
344 Ga0207694_10346735 3300025924 Unclassified 1229
345 Ga0207694_10400451 3300025924 Bacteria 1141
346 Ga0207694_10450757 3300025924 Bacteria 1074
347 Ga0207650_10020453 3300025925 Bacteria 4668
348 Ga0207650_10963172 3300025925 Bacteria 725
349 Ga0207659_10020775 3300025926 Bacteria 4347
350 Ga0207687_10000724 3300025927 Bacteria 22410
351 Ga0207687_10265114 3300025927 Bacteria 1371
352 Ga0207687_10626670 3300025927 Unclassified 908
353 Ga0207700_11132560 3300025928 Bacteria 699
354 Ga0207700_11294512 3300025928 Bacteria 649
355 Ga0207664_11310299 3300025929 Bacteria 644
356 Ga0207644_10030294 3300025931 Bacteria 3762
357 Ga0207644_10094713 3300025931 Bacteria 2231
358 Ga0207644_11611922 3300025931 Bacteria 544
359 Ga0207690_10011017 3300025932 Bacteria 5390
360 Ga0207690_10125790 3300025932 Bacteria 1869
361 Ga0207690_10160083 3300025932 Bacteria 1677
362 Ga0207706_10036803 3300025933 Bacteria 4347
363 Ga0207706_10134800 3300025933 Bacteria 2172
364 Ga0207706_11212466 3300025933 Bacteria 627
365 Ga0207686_11399006 3300025934 Unclassified 576
366 Ga0207670_10080162 3300025936 Bacteria 2281
367 Ga0207669_10373404 3300025937 Bacteria 1109
368 Ga0207704_10102410 3300025938 Bacteria 1912
369 Ga0207665_10005803 3300025939 Bacteria 8213
370 Ga0207691_10030667 3300025940 Bacteria 5022
371 Ga0207711_10062170 3300025941 Bacteria 3221
372 Ga0207711_10280180 3300025941 Bacteria 1535
373 Ga0207711_11039025 3300025941 Bacteria 759
374 Ga0207689_10047690 3300025942 Bacteria 3535
375 Ga0207689_10581099 3300025942 Bacteria 942
376 Ga0207689_11033401 3300025942 Bacteria 693
377 Ga0207661_10159156 3300025944 Bacteria 1958
378 Ga0207679_10033000 3300025945 Bacteria 3640
379 Ga0207679_10034477 3300025945 Bacteria 3571
380 Ga0207679_10208304 3300025945 Bacteria 1638
381 Ga0207667_10002711 3300025949 Bacteria 21894
382 Ga0207667_10020513 3300025949 Bacteria 7346
383 Ga0207667_10046088 3300025949 Bacteria 4616
384 Ga0207667_10210483 3300025949 Bacteria 1993
385 Ga0207667_10240844 3300025949 Bacteria 1851
386 Ga0207667_10250755 3300025949 Bacteria 1811
387 Ga0207651_11496591 3300025960 Bacteria 608
388 Ga0207712_10030573 3300025961 Bacteria 3622
389 Ga0207712_10063884 3300025961 Bacteria 2622
390 Ga0207640_10104095 3300025981 Bacteria 1997
391 Ga0207640_10481768 3300025981 Bacteria 1029
392 Ga0207658_10028709 3300025986 Bacteria 3921
393 Ga0207658_10243804 3300025986 Bacteria 1524
394 Ga0207658_11716862 3300025986 Bacteria 573
395 Ga0207677_10724913 3300026023 Bacteria 884
396 Ga0207703_10000767 3300026035 Bacteria 31611
397 Ga0207703_10003598 3300026035 Bacteria 12943
398 Ga0207703_10026715 3300026035 Bacteria 4546
399 Ga0207703_10030091 3300026035 Bacteria 4289
400 Ga0207639_10016461 3300026041 Bacteria 5233
401 Ga0207639_10032606 3300026041 Bacteria 3836
402 Ga0207639_10399889 3300026041 Bacteria 1237
403 Ga0207639_10617069 3300026041 Unclassified 1001
404 Ga0207639_12034650 3300026041 Unclassified 535
405 Ga0207678_10031955 3300026067 Bacteria 4589
406 Ga0207678_10083126 3300026067 Bacteria 2739
407 Ga0207678_11885341 3300026067 Bacteria 522
408 Ga0207708_10956465 3300026075 Bacteria 743
409 Ga0207708_11541508 3300026075 Unclassified 584
410 Ga0207702_10128822 3300026078 Bacteria 2275
411 Ga0207702_10617612 3300026078 Bacteria 1064
412 Ga0207702_10794213 3300026078 Bacteria 935
413 Ga0207702_10901889 3300026078 Bacteria 876
414 Ga0207641_10001749 3300026088 Bacteria 20947
415 Ga0207641_10016369 3300026088 Bacteria 6070
416 Ga0207641_10101341 3300026088 Bacteria 2537
417 Ga0207648_10015173 3300026089 Bacteria 7091
418 Ga0207648_10786084 3300026089 Bacteria 885
419 Ga0207676_10031009 3300026095 Bacteria 4017
420 Ga0207676_10113276 3300026095 Bacteria 2273
421 Ga0207674_10016484 3300026116 Bacteria 8087
422 Ga0207674_10248142 3300026116 Bacteria 1727
423 Ga0207674_10284419 3300026116 Bacteria 1602
424 Ga0207674_10729685 3300026116 Bacteria 956
425 Ga0207675_100139626 3300026118 Bacteria 2301
426 Ga0207675_100253070 3300026118 Bacteria 1705
427 Ga0207675_100573859 3300026118 Bacteria 1129
428 Ga0207683_10031261 3300026121 Bacteria 4620
429 Ga0207683_10205304 3300026121 Bacteria 1792
430 Ga0207698_11430596 3300026142 Archaea 706
431 Ga0209999_1083690 3300027543 Bacteria 616
432 Ga0209588_1108203 3300027671 Bacteria 893
433 Ga0209998_10013597 3300027717 Bacteria 1695
434 Ga0268266_10024612 3300028379 Bacteria 5121
435 Ga0268266_10041234 3300028379 Bacteria 3938
436 Ga0268266_10494293 3300028379 Unclassified 1167
437 Ga0268265_10015612 3300028380 Bacteria 5200
438 Ga0268265_10046107 3300028380 Bacteria 3256
439 Ga0268265_10561553 3300028380 Bacteria 1085
440 Ga0268265_10708477 3300028380 Bacteria 973
441 Ga0268265_10751207 3300028380 Bacteria 947
442 Ga0268264_10000034 3300028381 Bacteria 401894
443 Ga0268264_10069363 3300028381 Bacteria 2981
444 Ga0268264_10099360 3300028381 Bacteria 2525
445 Ga0307511_10245353 3300030521 Bacteria 868
446 Ga0265762_1120925 3300030760 Unclassified 599
447 Ga0265766_1018627 3300030863 Bacteria 558
448 Ga0265773_1004122 3300031018 Bacteria 991
449 Ga0265332_10073069 3300031238 Bacteria 1460
450 Ga0307513_10215622 3300031456 Bacteria 1746
451 Ga0307408_100390661 3300031548 Bacteria 1192
452 Ga0316575_10052474 3300031665 Bacteria 1624
453 Ga0316575_10319790 3300031665 Bacteria 658
454 Ga0316576_10266909 3300031727 Bacteria 1283
455 Ga0316578_10374832 3300031728 Bacteria 845
456 Ga0307516_10619235 3300031730 Bacteria 737
457 Ga0316577_10161714 3300031733 Bacteria 1263
458 Ga0316577_10635844 3300031733 Bacteria 607
459 Ga0307518_10501202 3300031838 Unclassified 625
460 Ga0307410_10235849 3300031852 Bacteria 1415
461 Ga0307406_10240725 3300031901 Bacteria 1357
462 Ga0307407_10601137 3300031903 Bacteria 819
463 Ga0307412_10729932 3300031911 Bacteria 853
464 Ga0307416_100537147 3300032002 Bacteria 1240
465 Ga0307416_101569799 3300032002 Unclassified 764
466 Ga0307415_100220596 3300032126 Bacteria 1520
467 Ga0316583_10133012 3300032133 Bacteria 867
468 Ga0307510_10000005 3300033180 Bacteria 633068
469 Ga0307510_10015965 3300033180 Bacteria 8872
470 Ga0373948_0097737 3300034817 Bacteria 688
471 Ga0373948_0212322 3300034817 Bacteria 509
472 Ga0373928_0030234 3300035084 Bacteria 1196
473 Ga0373940_0159061 3300035088 Bacteria 724
474 Ga0373923_0063128 3300035111 Bacteria 1577
475 Ga0373936_0393256 3300035113 Bacteria 636
476 Ga0373945_0140389 3300035116 Bacteria 974
477 Ga0373953_0133914 3300035117 Bacteria 1058
478 Ga0373956_0019200 3300035119 Bacteria 2899
479 Ga0373956_0267874 3300035119 Bacteria 813
480 Ga0373957_0051890 3300035120 Bacteria 1570
481 Ga0373946_0111505 3300035171 Bacteria 1239
482 Ga0373955_0114480 3300035172 Bacteria 1562
483 Ga0316574_0042517 3300035398 Bacteria 2804
484 Ga0316574_0271069 3300035398 Bacteria 1082
485 Ga0373935_0172339 3300035692 Bacteria 1481
486 Ga0373935_0357917 3300035692 Bacteria 1042
487 Ga0373927_1112631 3300035695 Bacteria 521
488 Ga0373933_0024168 3300035724 Bacteria 3479
489 Ga0373933_0101972 3300035724 Bacteria 1781
490 Ga0373937_0003400 3300036401 Bacteria 13356
491 Ga0373937_0046970 3300036401 Bacteria 3949
492 Ga0373937_0102977 3300036401 Bacteria 2651
493 Ga0373937_0172819 3300036401 Bacteria 2027
494 Ga0316584_0054911 3300036712 Bacteria 2983
495 Ga0373925_0896864 3300037068 Bacteria 731
496 Ga0395900_0638682 3300037418 Bacteria 1002
497 Ga0395898_0021247 3300037466 Bacteria 6583
498 Ga0395898_0144176 3300037466 Bacteria 2280
499 Ga0395901_0260698 3300038443 Bacteria 1804
500 Ga0395901_0773183 3300038443 Bacteria 951
501 Ga0436365_0204524 3300039437 Bacteria 6125
502 Ga0436365_1728503 3300039437 Bacteria 1616
503 Ga0436360_0503581 3300039438 Bacteria 2372
504 Ga0436360_0561777 3300039438 Bacteria 766
505 Ga0436360_0884838 3300039438 Bacteria 11741
506 Ga0436360_1049957 3300039438 Unclassified 586
507 Ga0436360_1264219 3300039438 Bacteria 2925
508 Ga0436361_0958437 3300039447 Bacteria 2391
509 Ga0436363_0402446 3300039450 Bacteria 5372
510 Ga0436363_0598179 3300039450 Bacteria 646
511 Ga0436363_0854110 3300039450 Bacteria 851
512 Ga0436363_1146804 3300039450 Bacteria 2704
513 Ga0436362_0372061 3300039453 Unclassified 604
514 Ga0436362_0442781 3300039453 Bacteria 655
515 Ga0436362_0465396 3300039453 Bacteria 996
516 Ga0436362_1247594 3300039453 Bacteria 1082
517 Ga0439453_0159040 3300041408 Unclassified 540
518 Ga0451797_0325197 3300041453 Bacteria 637
519 Ga0451795_1363391 3300041456 Unclassified 693
520 Ga0451833_1258513 3300041491 Bacteria 597
521 Ga0450923_092392 3300042125 Bacteria 691
522 Ga0439446_0005312 3300042156 Bacteria 3310
523 Ga0439435_0085902 3300042436 Bacteria 950
524 Ga0450916_018264 3300042530 Bacteria 943
525 Ga0451577_0015656 3300042876 Bacteria 7047
526 Ga0453683_0089708 3300044673 Bacteria 1927
527 Ga0466965_0121701 3300044683 Bacteria 1348
528 Ga0466961_0004699 3300044693 Bacteria 8586
529 Ga0466964_0005787 3300044706 Bacteria 4602
530 Ga0453684_0031657 3300044712 Bacteria 7426
531 Ga0453684_1788286 3300044712 Bacteria 625
532 Ga0466970_0039657 3300044765 Bacteria 2499
533 Ga0466959_0040191 3300045049 Bacteria 3455
534 Ga0451576_0015133 3300045051 Bacteria 8563
535 Ga0451576_0142483 3300045051 Bacteria 2499
536 Ga0451576_1069270 3300045051 Bacteria 845
537 Ga0466958_0222295 3300045836 Bacteria 1205
538 Ga0495603_0068798 3300046455 Bacteria 2083
539 Ga0495629_0214492 3300046459 Bacteria 1329
540 Ga0495580_0112577 3300046472 Bacteria 1890
541 Ga0495639_0166458 3300046475 Bacteria 1069
542 Ga0495639_0640326 3300046475 Bacteria 548
543 Ga0495594_0435893 3300046499 Bacteria 745
544 Ga0495583_0051955 3300046506 Bacteria 1866
545 Ga0495606_0579278 3300046507 Bacteria 554
546 Ga0495630_0418605 3300046517 Bacteria 1026
547 Ga0495587_0079876 3300046536 Bacteria 1896
548 Ga0495645_0868831 3300046543 Bacteria 537
549 Ga0495611_0124587 3300046648 Bacteria 1202
550 Ga0495625_0388136 3300046660 Bacteria 875
551 Ga0495659_0049173 3300046664 Bacteria 1530
552 Ga0495657_0066464 3300046675 Bacteria 2369
553 Ga0495657_0493905 3300046675 Viruses 714
554 Ga0495623_0024171 3300046679 Bacteria 3919
555 Ga0495647_0034424 3300046681 Bacteria 1897
556 Ga0495658_0114093 3300046683 Bacteria 1628
557 Ga0495671_0060069 3300046692 Bacteria 1877
558 Ga0495649_0180687 3300046694 Bacteria 1101
559 Ga0495672_0346698 3300047320 Bacteria 691
560 Ga0495680_0324393 3300047322 Unclassified 1077
561 Ga0495687_097004 3300047443 Bacteria 1115
562 Ga0495675_0085211 3300047444 Bacteria 1987
563 Ga0495679_047525 3300047446 Bacteria 1302
564 Ga0495686_0005836 3300047472 Bacteria 9601
565 Ga0495686_0015719 3300047472 Bacteria 5157
566 Ga0495602_0146507 3300048088 Bacteria 1862
567 Ga0496100_0659174 3300048903 Bacteria 815
568 Ga0496100_0868601 3300048903 Bacteria 708
569 Ga0496101_0965309 3300048904 Bacteria 670
570 Ga0496102_0022244 3300048905 Bacteria 5617
571 Ga0496102_0635779 3300048905 Bacteria 990
572 Ga0496103_0342663 3300048906 Bacteria 961
573 Ga0496103_0986511 3300048906 Bacteria 525
574 Ga0496104_0059235 3300048907 Bacteria 3625
575 Ga0496105_0189689 3300048908 Bacteria 1681
576 Ga0496106_0101714 3300048909 Bacteria 2229
577 Ga0496107_1042491 3300048910 Unclassified 592
578 Ga0496108_0180231 3300048911 Bacteria 1829
579 Ga0496108_0252174 3300048911 Bacteria 1535
580 Ga0496108_1554965 3300048911 Unclassified 549
581 Ga0496109_0011333 3300048912 Bacteria 7660
582 Ga0496109_0248585 3300048912 Bacteria 1674
583 Ga0496110_0131653 3300048913 Bacteria 2259
584 Ga0496110_0280917 3300048913 Bacteria 1516
585 Ga0496111_0197173 3300048914 Bacteria 1497
586 Ga0496112_0002877 3300048915 Bacteria 14002
587 Ga0496112_0216241 3300048915 Bacteria 1873
588 Ga0496112_1553466 3300048915 Bacteria 575
589 Ga0496113_1389917 3300048916 Bacteria 544
590 Ga0496114_0000553 3300048917 Bacteria 27690
591 Ga0496115_0435304 3300048918 Unclassified 1061
592 Ga0496116_0002539 3300048919 Bacteria 19102
593 Ga0496117_0000012 3300048920 Bacteria 608530
594 Ga0496117_0330297 3300048920 Bacteria 795
595 Ga0496118_0000051 3300048921 Bacteria 241198
596 Ga0496119_0001899 3300048922 Bacteria 23977
597 Ga0496119_0015454 3300048922 Bacteria 5875
598 Ga0496119_0391285 3300048922 Bacteria 665
599 Ga0496120_0000191 3300048923 Bacteria 105146
600 Ga0496120_0379879 3300048923 Unclassified 628
601 Ga0496121_0047554 3300048924 Bacteria 3659
602 Ga0496124_0055897 3300048927 Bacteria 3332
603 Ga0496124_0158964 3300048927 Bacteria 1764
604 Ga0496125_0002488 3300048928 Bacteria 23850
605 Ga0496125_0057972 3300048928 Bacteria 3131
606 Ga0496125_0389330 3300048928 Unclassified 819
607 Ga0496126_0014282 3300048929 Bacteria 8035
608 Ga0496126_0054680 3300048929 Bacteria 3614
609 Ga0496126_0060199 3300048929 Bacteria 3416
610 Ga0496126_1214645 3300048929 Unclassified 554
611 Ga0501034_1418009 3300049571 Bacteria 569
612 Ga0501036_0370075 3300049572 Bacteria 1196
613 Ga0501039_0030860 3300049575 Bacteria 4133
614 Ga0501040_0686352 3300049576 Bacteria 740
615 Ga0501041_0114551 3300049577 Bacteria 1674
616 Ga0501041_0745426 3300049577 Bacteria 627
617 Ga0501042_0097698 3300049578 Bacteria 2111
618 Ga0501043_0397993 3300049579 Bacteria 1041
619 Ga0501046_0670398 3300049580 Bacteria 732
620 Ga0501048_0700513 3300049582 Bacteria 727
621 Ga0501070_0016490 3300049586 Bacteria 6207
622 Ga0501071_0564991 3300049587 Bacteria 874
623 Ga0501074_0719773 3300049590 Bacteria 704
624 Ga0501076_0041080 3300049592 Bacteria 3637
625 Ga0501077_0678264 3300049593 Bacteria 662
626 Ga0501079_0130160 3300049741 Bacteria 1958
627 Ga0501081_0011175 3300049743 Bacteria 5872
628 Ga0501081_0324473 3300049743 Bacteria 1132
629 Ga0501035_0385471 3300049822 Bacteria 1168
630 Ga0501044_0269936 3300049823 Bacteria 1637
631 Ga0501045_1019955 3300049824 Bacteria 606
632 nmdc:mga0k408_372635_c1 3300050493 Bacteria 851
633 nmdc:mga08y16_447238_c1 3300050511 Bacteria 1318
634 nmdc:mga0n895_480458_c1 3300050512 Bacteria 1253
635 nmdc:mga0rr50_488937_c1 3300050513 Bacteria 1045
636 Ga0495601_0052031 3300053077 Bacteria 2585
637 Ga0495601_0084901 3300053077 Bacteria 2034
638 Ga0495612_0379373 3300053078 Bacteria 641
639 Ga0495595_0242483 3300053084 Bacteria 902
640 Ga0495619_0754353 3300053085 Bacteria 660
641 Ga0500646_0077941 3300053090 Unclassified 1006
642 Ga0500646_0107789 3300053090 Bacteria 882
643 Ga0500583_0048764 3300053092 Bacteria 1956
644 Ga0500651_0088466 3300053093 Bacteria 1910
645 Ga0500651_0675469 3300053093 Bacteria 554
646 Ga0500641_0012762 3300053096 Bacteria 3075
647 Ga0500650_0189283 3300053098 Bacteria 940
648 Ga0500572_034127 3300053111 Bacteria 1440
649 Ga0500655_062447 3300053133 Unclassified 752
650 Ga0500559_0091769 3300053136 Bacteria 1391
651 Ga0500559_0400499 3300053136 Bacteria 638
652 Ga0500568_0092059 3300053139 Bacteria 1143
653 Ga0500590_098499 3300053148 Bacteria 1408
654 Ga0500616_0000018 3300053153 Bacteria 610976
655 Ga0500622_0007139 3300053156 Bacteria 6373
656 Ga0500656_058277 3300053732 Bacteria 574
657 Ga0587076_165251 3300059645 Unclassified 547
658 Ga0587076_178932 3300059645 Unclassified 533
659 Ga0587114_141677 3300059655 Unclassified 503
660 Ga0501082_0411674 3300060353 Bacteria 1180
661 Ga0466962_0007877 3300061719 Bacteria 5109
662 Ga0530510_0685578 3300061734 Bacteria 781

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300004799 Ga0058863_11957120 Ga0058863_119571202 107
2 3300004800 Ga0058861_11958246 Ga0058861_119582462 107
3 3300004803 Ga0058862_12257844 Ga0058862_122578441 107
4 3300005289 Ga0065704_10465469 Ga0065704_104654691 107
5 3300005293 Ga0065715_10247026 Ga0065715_102470263 107
6 3300005293 Ga0065715_10808713 Ga0065715_108087131 107
7 3300005295 Ga0065707_10081981 Ga0065707_100819815 107
8 3300005327 Ga0070658_10461614 Ga0070658_104616141 107
9 3300005328 Ga0070676_11008436 Ga0070676_110084362 107
10 3300005329 Ga0070683_100145553 Ga0070683_1001455533 107
11 3300005330 Ga0070690_100002121 Ga0070690_1000021219 107
12 3300005330 Ga0070690_100086925 Ga0070690_1000869253 107
13 3300005331 Ga0070670_100001924 Ga0070670_10000192411 107
14 3300005331 Ga0070670_100099387 Ga0070670_1000993873 107
15 3300005331 Ga0070670_100933581 Ga0070670_1009335811 107
16 3300005334 Ga0068869_100035837 Ga0068869_1000358371 107
17 3300005334 Ga0068869_100481751 Ga0068869_1004817512 107
18 3300005335 Ga0070666_10011147 Ga0070666_100111476 107
19 3300005335 Ga0070666_11355469 Ga0070666_113554691 107
20 3300005336 Ga0070680_100147093 Ga0070680_1001470932 107
21 3300005336 Ga0070680_100151322 Ga0070680_1001513222 107
22 3300005336 Ga0070680_100242182 Ga0070680_1002421822 107
23 3300005337 Ga0070682_100894863 Ga0070682_1008948631 107
24 3300005338 Ga0068868_100001397 Ga0068868_10000139716 107
25 3300005338 Ga0068868_100023979 Ga0068868_1000239796 107
26 3300005339 Ga0070660_100809383 Ga0070660_1008093831 107
27 3300005340 Ga0070689_100001863 Ga0070689_1000018639 107
28 3300005340 Ga0070689_100024663 Ga0070689_1000246635 107
29 3300005343 Ga0070687_100344915 Ga0070687_1003449151 107
30 3300005344 Ga0070661_100166812 Ga0070661_1001668123 107
31 3300005344 Ga0070661_100212839 Ga0070661_1002128392 107
32 3300005344 Ga0070661_100444680 Ga0070661_1004446802 107
33 3300005344 Ga0070661_100631639 Ga0070661_1006316391 107
34 3300005347 Ga0070668_102218060 Ga0070668_1022180601 107
35 3300005353 Ga0070669_100330030 Ga0070669_1003300302 107
36 3300005354 Ga0070675_100432322 Ga0070675_1004323223 107
37 3300005355 Ga0070671_100010034 Ga0070671_1000100347 107
38 3300005355 Ga0070671_100042592 Ga0070671_1000425924 107
39 3300005355 Ga0070671_100312097 Ga0070671_1003120972 107
40 3300005355 Ga0070671_101345848 Ga0070671_1013458482 107
41 3300005356 Ga0070674_100647812 Ga0070674_1006478121 107
42 3300005364 Ga0070673_100070874 Ga0070673_1000708743 107
43 3300005364 Ga0070673_100077826 Ga0070673_1000778263 107
44 3300005364 Ga0070673_100109305 Ga0070673_1001093053 107
45 3300005364 Ga0070673_100846816 Ga0070673_1008468161 107
46 3300005367 Ga0070667_100015817 Ga0070667_1000158177 107
47 3300005367 Ga0070667_100135150 Ga0070667_1001351501 107
48 3300005367 Ga0070667_100203437 Ga0070667_1002034372 107
49 3300005367 Ga0070667_101889047 Ga0070667_1018890472 107
50 3300005406 Ga0070703_10193838 Ga0070703_101938381 107
51 3300005406 Ga0070703_10458897 Ga0070703_104588971 107
52 3300005434 Ga0070709_10010626 Ga0070709_100106266 107
53 3300005434 Ga0070709_10291274 Ga0070709_102912742 107
54 3300005434 Ga0070709_11078165 Ga0070709_110781651 107
55 3300005435 Ga0070714_100639068 Ga0070714_1006390681 107
56 3300005436 Ga0070713_101217907 Ga0070713_1012179072 107
57 3300005436 Ga0070713_101745695 Ga0070713_1017456951 107
58 3300005438 Ga0070701_10060226 Ga0070701_100602263 107
59 3300005439 Ga0070711_100103312 Ga0070711_1001033123 107
60 3300005439 Ga0070711_100432853 Ga0070711_1004328531 107
61 3300005440 Ga0070705_100007578 Ga0070705_1000075786 107
62 3300005441 Ga0070700_100048866 Ga0070700_1000488662 107
63 3300005444 Ga0070694_100392628 Ga0070694_1003926283 107
64 3300005456 Ga0070678_100795147 Ga0070678_1007951472 107
65 3300005457 Ga0070662_100637218 Ga0070662_1006372181 107
66 3300005458 Ga0070681_10001620 Ga0070681_1000162016 107
67 3300005458 Ga0070681_10002862 Ga0070681_1000286216 107
68 3300005458 Ga0070681_10006571 Ga0070681_100065713 107
69 3300005458 Ga0070681_10041707 Ga0070681_100417073 107
70 3300005458 Ga0070681_10053934 Ga0070681_100539342 107
71 3300005458 Ga0070681_10132051 Ga0070681_101320513 107
72 3300005459 Ga0068867_100008135 Ga0068867_1000081358 107
73 3300005466 Ga0070685_10232602 Ga0070685_102326022 107
74 3300005466 Ga0070685_10407011 Ga0070685_104070112 107
75 3300005468 Ga0070707_100124009 Ga0070707_1001240093 107
76 3300005468 Ga0070707_101596557 Ga0070707_1015965571 107
77 3300005471 Ga0070698_100509024 Ga0070698_1005090241 107
78 3300005518 Ga0070699_100042960 Ga0070699_1000429604 107
79 3300005530 Ga0070679_100005320 Ga0070679_1000053208 107
80 3300005530 Ga0070679_100017074 Ga0070679_1000170746 107
81 3300005530 Ga0070679_100118799 Ga0070679_1001187993 107
82 3300005530 Ga0070679_100458135 Ga0070679_1004581352 107
83 3300005535 Ga0070684_100040924 Ga0070684_1000409243 107
84 3300005535 Ga0070684_100177126 Ga0070684_1001771262 107
85 3300005539 Ga0068853_100165848 Ga0068853_1001658482 107
86 3300005539 Ga0068853_100173829 Ga0068853_1001738293 107
87 3300005543 Ga0070672_100082670 Ga0070672_1000826703 107
88 3300005544 Ga0070686_100001796 Ga0070686_10000179612 107
89 3300005544 Ga0070686_100011605 Ga0070686_1000116056 107
90 3300005545 Ga0070695_100015703 Ga0070695_1000157033 107
91 3300005545 Ga0070695_100241668 Ga0070695_1002416683 107
92 3300005545 Ga0070695_100709838 Ga0070695_1007098381 107
93 3300005546 Ga0070696_101304529 Ga0070696_1013045292 107
94 3300005547 Ga0070693_100014873 Ga0070693_1000148733 107
95 3300005548 Ga0070665_100008574 Ga0070665_1000085749 107
96 3300005548 Ga0070665_100057769 Ga0070665_1000577693 107
97 3300005548 Ga0070665_100107778 Ga0070665_1001077781 107
98 3300005548 Ga0070665_100364384 Ga0070665_1003643841 107
99 3300005548 Ga0070665_100592222 Ga0070665_1005922222 107
100 3300005549 Ga0070704_100223321 Ga0070704_1002233213 107
101 3300005563 Ga0068855_100007775 Ga0068855_1000077753 107
102 3300005563 Ga0068855_100060642 Ga0068855_1000606422 107
103 3300005563 Ga0068855_100362959 Ga0068855_1003629592 107
104 3300005563 Ga0068855_100483742 Ga0068855_1004837422 107
105 3300005564 Ga0070664_100007434 Ga0070664_1000074347 107
106 3300005564 Ga0070664_100061436 Ga0070664_1000614363 107
107 3300005564 Ga0070664_100495069 Ga0070664_1004950691 107
108 3300005577 Ga0068857_100149355 Ga0068857_1001493552 107
109 3300005577 Ga0068857_100512187 Ga0068857_1005121873 107
110 3300005578 Ga0068854_100286195 Ga0068854_1002861952 107
111 3300005614 Ga0068856_100097244 Ga0068856_1000972444 107
112 3300005614 Ga0068856_100252331 Ga0068856_1002523312 107
113 3300005614 Ga0068856_100647874 Ga0068856_1006478742 107
114 3300005614 Ga0068856_100924190 Ga0068856_1009241902 107
115 3300005615 Ga0070702_100002720 Ga0070702_1000027203 107
116 3300005615 Ga0070702_100003056 Ga0070702_1000030568 107
117 3300005616 Ga0068852_100130815 Ga0068852_1001308152 107
118 3300005616 Ga0068852_101176186 Ga0068852_1011761861 107
119 3300005616 Ga0068852_101322112 Ga0068852_1013221121 107
120 3300005617 Ga0068859_100012440 Ga0068859_1000124403 107
121 3300005617 Ga0068859_100027419 Ga0068859_1000274192 107
122 3300005617 Ga0068859_100049529 Ga0068859_1000495296 107
123 3300005617 Ga0068859_102966282 Ga0068859_1029662821 107
124 3300005618 Ga0068864_100006569 Ga0068864_10000656910 107
125 3300005618 Ga0068864_100017803 Ga0068864_1000178033 107
126 3300005719 Ga0068861_100125587 Ga0068861_1001255871 107
127 3300005719 Ga0068861_100191922 Ga0068861_1001919223 107
128 3300005834 Ga0068851_10546132 Ga0068851_105461321 107
129 3300005840 Ga0068870_10009276 Ga0068870_100092764 107
130 3300005841 Ga0068863_100002915 Ga0068863_10000291510 107
131 3300005841 Ga0068863_100021655 Ga0068863_1000216556 107
132 3300005842 Ga0068858_100001624 Ga0068858_10000162410 107
133 3300005842 Ga0068858_100003897 Ga0068858_1000038975 107
134 3300005842 Ga0068858_100008115 Ga0068858_10000811510 107
135 3300005842 Ga0068858_100008369 Ga0068858_1000083696 107
136 3300005843 Ga0068860_100001031 Ga0068860_1000010312 107
137 3300005843 Ga0068860_100003582 Ga0068860_1000035829 107
138 3300005843 Ga0068860_100577980 Ga0068860_1005779802 107
139 3300005844 Ga0068862_100002789 Ga0068862_1000027891 107
140 3300005844 Ga0068862_100033230 Ga0068862_1000332302 107
141 3300005844 Ga0068862_100420118 Ga0068862_1004201182 107
142 3300005844 Ga0068862_101037158 Ga0068862_1010371582 107
143 3300005844 Ga0068862_102252761 Ga0068862_1022527612 107
144 3300005937 Ga0081455_10325722 Ga0081455_103257223 107
145 3300006163 Ga0070715_10223626 Ga0070715_102236263 107
146 3300006173 Ga0070716_100033769 Ga0070716_1000337693 107
147 3300006175 Ga0070712_100039915 Ga0070712_1000399154 107
148 3300006195 Ga0075366_10332343 Ga0075366_103323432 107
149 3300006237 Ga0097621_100154132 Ga0097621_1001541322 107
150 3300006237 Ga0097621_100197877 Ga0097621_1001978772 107
151 3300006237 Ga0097621_100233878 Ga0097621_1002338781 107
152 3300006237 Ga0097621_100501680 Ga0097621_1005016802 107
153 3300006237 Ga0097621_101478377 Ga0097621_1014783772 107
154 3300006358 Ga0068871_100012828 Ga0068871_1000128284 107
155 3300006358 Ga0068871_100017723 Ga0068871_1000177236 107
156 3300006358 Ga0068871_100787681 Ga0068871_1007876812 107
157 3300006358 Ga0068871_100885703 Ga0068871_1008857031 107
158 3300006358 Ga0068871_101868540 Ga0068871_1018685401 107
159 3300006844 Ga0075428_100277023 Ga0075428_1002770232 107
160 3300006931 Ga0097620_100012440 Ga0097620_1000124408 107
161 3300006931 Ga0097620_100027419 Ga0097620_1000274192 107
162 3300006931 Ga0097620_100049529 Ga0097620_1000495296 107
163 3300006931 Ga0097620_102966061 Ga0097620_1029660611 107
164 3300007076 Ga0075435_101127205 Ga0075435_1011272052 107
165 3300007265 Ga0099794_10040579 Ga0099794_100405792 107
166 3300007788 Ga0099795_10028868 Ga0099795_100288683 107
167 3300009092 Ga0105250_10414141 Ga0105250_104141411 107
168 3300009093 Ga0105240_10004508 Ga0105240_100045086 107
169 3300009093 Ga0105240_10006950 Ga0105240_100069506 107
170 3300009093 Ga0105240_10034801 Ga0105240_100348013 107
171 3300009093 Ga0105240_10123818 Ga0105240_101238183 107
172 3300009093 Ga0105240_10137039 Ga0105240_101370393 107
173 3300009093 Ga0105240_10164797 Ga0105240_101647972 107
174 3300009093 Ga0105240_10315115 Ga0105240_103151151 107
175 3300009093 Ga0105240_10371832 Ga0105240_103718322 107
176 3300009093 Ga0105240_10750842 Ga0105240_107508421 107
177 3300009094 Ga0111539_10522401 Ga0111539_105224013 107
178 3300009094 Ga0111539_13274792 Ga0111539_132747921 107
179 3300009098 Ga0105245_10004600 Ga0105245_1000460011 107
180 3300009098 Ga0105245_10212834 Ga0105245_102128343 107
181 3300009098 Ga0105245_12807405 Ga0105245_128074051 107
182 3300009101 Ga0105247_10002076 Ga0105247_1000207614 107
183 3300009101 Ga0105247_10049060 Ga0105247_100490603 107
184 3300009148 Ga0105243_10911271 Ga0105243_109112712 107
185 3300009174 Ga0105241_10313424 Ga0105241_103134242 107
186 3300009174 Ga0105241_10523634 Ga0105241_105236342 107
187 3300009174 Ga0105241_11179072 Ga0105241_111790722 107
188 3300009176 Ga0105242_10210880 Ga0105242_102108803 107
189 3300009176 Ga0105242_10399385 Ga0105242_103993853 107
190 3300009176 Ga0105242_10944122 Ga0105242_109441222 107
191 3300009177 Ga0105248_10001365 Ga0105248_1000136514 107
192 3300009177 Ga0105248_10009098 Ga0105248_100090989 107
193 3300009177 Ga0105248_10776586 Ga0105248_107765862 107
194 3300009177 Ga0105248_11748534 Ga0105248_117485341 107
195 3300009545 Ga0105237_10098268 Ga0105237_100982683 107
196 3300009545 Ga0105237_10106357 Ga0105237_101063573 107
197 3300009545 Ga0105237_10272325 Ga0105237_102723252 107
198 3300009545 Ga0105237_10646707 Ga0105237_106467073 107
199 3300009545 Ga0105237_10744102 Ga0105237_107441022 107
200 3300009545 Ga0105237_10747573 Ga0105237_107475731 107
201 3300009551 Ga0105238_10009671 Ga0105238_100096714 107
202 3300009551 Ga0105238_10011065 Ga0105238_100110659 107
203 3300009551 Ga0105238_10043932 Ga0105238_100439324 107
204 3300009551 Ga0105238_10093709 Ga0105238_100937092 107
205 3300009551 Ga0105238_10111451 Ga0105238_101114512 107
206 3300009551 Ga0105238_10182990 Ga0105238_101829902 107
207 3300009551 Ga0105238_10265344 Ga0105238_102653443 107
208 3300009551 Ga0105238_10280903 Ga0105238_102809032 107
209 3300009551 Ga0105238_11778471 Ga0105238_117784711 107
210 3300009553 Ga0105249_10041100 Ga0105249_100411002 107
211 3300009553 Ga0105249_10609021 Ga0105249_106090212 107
212 3300009553 Ga0105249_13308021 Ga0105249_133080212 107
213 3300010375 Ga0105239_10223877 Ga0105239_102238773 107
214 3300010375 Ga0105239_10469108 Ga0105239_104691082 107
215 3300010375 Ga0105239_10673697 Ga0105239_106736972 107
216 3300010375 Ga0105239_11650432 Ga0105239_116504322 107
217 3300011119 Ga0105246_10000629 Ga0105246_1000062915 107
218 3300011119 Ga0105246_10246888 Ga0105246_102468882 107
219 3300013104 Ga0157370_10000459 Ga0157370_100004595 107
220 3300013104 Ga0157370_10180632 Ga0157370_101806322 107
221 3300013105 Ga0157369_10003155 Ga0157369_1000315515 107
222 3300013105 Ga0157369_10069500 Ga0157369_100695003 107
223 3300013296 Ga0157374_10003246 Ga0157374_100032463 107
224 3300013296 Ga0157374_10337957 Ga0157374_103379572 107
225 3300013297 Ga0157378_10093732 Ga0157378_100937323 107
226 3300013297 Ga0157378_10096849 Ga0157378_100968492 107
227 3300013297 Ga0157378_10198275 Ga0157378_101982753 107
228 3300013306 Ga0163162_10033820 Ga0163162_100338205 107
229 3300013306 Ga0163162_10133442 Ga0163162_101334424 107
230 3300013306 Ga0163162_10286820 Ga0163162_102868202 107
231 3300013307 Ga0157372_10339449 Ga0157372_103394492 107
232 3300013307 Ga0157372_10497216 Ga0157372_104972162 107
233 3300013307 Ga0157372_12327055 Ga0157372_123270551 107
234 3300013308 Ga0157375_10007739 Ga0157375_100077399 107
235 3300013308 Ga0157375_10100255 Ga0157375_101002553 107
236 3300013308 Ga0157375_10233645 Ga0157375_102336453 107
237 3300014325 Ga0163163_10000692 Ga0163163_1000069218 107
238 3300014325 Ga0163163_10001624 Ga0163163_1000162415 107
239 3300014325 Ga0163163_10164064 Ga0163163_101640642 107
240 3300014325 Ga0163163_10732000 Ga0163163_107320001 107
241 3300014325 Ga0163163_11914495 Ga0163163_119144952 107
242 3300014326 Ga0157380_10000885 Ga0157380_100008856 107
243 3300014326 Ga0157380_10574845 Ga0157380_105748452 107
244 3300014326 Ga0157380_11372047 Ga0157380_113720472 107
245 3300014745 Ga0157377_10012579 Ga0157377_100125793 107
246 3300014745 Ga0157377_10013226 Ga0157377_100132265 107
247 3300014745 Ga0157377_10342744 Ga0157377_103427441 107
248 3300014745 Ga0157377_10404734 Ga0157377_104047342 107
249 3300014968 Ga0157379_10016486 Ga0157379_100164861 107
250 3300014968 Ga0157379_10185619 Ga0157379_101856192 107
251 3300014968 Ga0157379_10297752 Ga0157379_102977522 107
252 3300014968 Ga0157379_12028710 Ga0157379_120287102 107
253 3300014969 Ga0157376_10176658 Ga0157376_101766582 107
254 3300014969 Ga0157376_10300082 Ga0157376_103000822 107
255 3300014969 Ga0157376_10314122 Ga0157376_103141222 107
256 3300014969 Ga0157376_10805707 Ga0157376_108057072 107
257 3300015690 Ga0183363_1004 Ga0183363_1004279 107
258 3300017792 Ga0163161_10154881 Ga0163161_101548813 107
259 3300017792 Ga0163161_11316457 Ga0163161_113164571 107
260 3300020069 Ga0197907_11203698 Ga0197907_112036981 107
261 3300020069 Ga0197907_11224261 Ga0197907_112242611 107
262 3300020070 Ga0206356_10358157 Ga0206356_103581572 107
263 3300020070 Ga0206356_10412598 Ga0206356_104125982 107
264 3300020070 Ga0206356_11614036 Ga0206356_116140361 107
265 3300020076 Ga0206355_1043388 Ga0206355_10433881 107
266 3300020076 Ga0206355_1367740 Ga0206355_13677401 107
267 3300020076 Ga0206355_1452525 Ga0206355_14525252 107
268 3300020076 Ga0206355_1480611 Ga0206355_14806112 107
269 3300020078 Ga0206352_10596986 Ga0206352_105969862 107
270 3300020080 Ga0206350_10546148 Ga0206350_105461481 107
271 3300020081 Ga0206354_10626539 Ga0206354_106265392 107
272 3300020081 Ga0206354_10890305 Ga0206354_108903051 107
273 3300020082 Ga0206353_11188132 Ga0206353_111881321 107
274 3300020082 Ga0206353_11414259 Ga0206353_114142591 107
275 3300020610 Ga0154015_1316723 Ga0154015_13167232 107
276 3300020610 Ga0154015_1381318 Ga0154015_13813181 107
277 3300021361 Ga0213872_10107353 Ga0213872_101073531 107
278 3300021361 Ga0213872_10429367 Ga0213872_104293671 107
279 3300021377 Ga0213874_10198054 Ga0213874_101980542 107
280 3300021377 Ga0213874_10306114 Ga0213874_103061141 107
281 3300021384 Ga0213876_10057606 Ga0213876_100576062 107
282 3300021441 Ga0213871_10017881 Ga0213871_100178812 107
283 3300022467 Ga0224712_10160465 Ga0224712_101604652 107
284 3300022467 Ga0224712_10287776 Ga0224712_102877762 107
285 3300022467 Ga0224712_10447532 Ga0224712_104475321 107
286 3300022467 Ga0224712_10567068 Ga0224712_105670681 107
287 3300025261 Ga0209233_1006030 Ga0209233_10060305 107
288 3300025321 Ga0207656_10269322 Ga0207656_102693222 107
289 3300025885 Ga0207653_10172882 Ga0207653_101728822 107
290 3300025898 Ga0207692_10306053 Ga0207692_103060532 107
291 3300025899 Ga0207642_10070818 Ga0207642_100708182 107
292 3300025900 Ga0207710_10049145 Ga0207710_100491452 107
293 3300025900 Ga0207710_10198153 Ga0207710_101981531 107
294 3300025901 Ga0207688_10087695 Ga0207688_100876952 107
295 3300025903 Ga0207680_10019137 Ga0207680_100191373 107
296 3300025903 Ga0207680_10061568 Ga0207680_100615683 107
297 3300025903 Ga0207680_10332567 Ga0207680_103325672 107
298 3300025905 Ga0207685_10664454 Ga0207685_106644541 107
299 3300025906 Ga0207699_10003329 Ga0207699_100033292 107
300 3300025906 Ga0207699_10389950 Ga0207699_103899502 107
301 3300025906 Ga0207699_11480015 Ga0207699_114800151 107
302 3300025907 Ga0207645_10189260 Ga0207645_101892601 107
303 3300025907 Ga0207645_10805441 Ga0207645_108054412 107
304 3300025908 Ga0207643_10024492 Ga0207643_100244925 107
305 3300025909 Ga0207705_10681243 Ga0207705_106812432 107
306 3300025911 Ga0207654_11151168 Ga0207654_111511682 107
307 3300025912 Ga0207707_10000751 Ga0207707_1000075114 107
308 3300025912 Ga0207707_10005824 Ga0207707_100058246 107
309 3300025912 Ga0207707_10031131 Ga0207707_100311312 107
310 3300025912 Ga0207707_10032336 Ga0207707_100323364 107
311 3300025912 Ga0207707_10065695 Ga0207707_100656954 107
312 3300025912 Ga0207707_10112551 Ga0207707_101125514 107
313 3300025912 Ga0207707_10200681 Ga0207707_102006811 107
314 3300025913 Ga0207695_10003874 Ga0207695_100038746 107
315 3300025913 Ga0207695_10015725 Ga0207695_100157254 107
316 3300025913 Ga0207695_10058238 Ga0207695_100582384 107
317 3300025913 Ga0207695_10273733 Ga0207695_102737333 107
318 3300025913 Ga0207695_10419846 Ga0207695_104198461 107
319 3300025913 Ga0207695_11260628 Ga0207695_112606282 107
320 3300025914 Ga0207671_10047000 Ga0207671_100470004 107
321 3300025914 Ga0207671_10091470 Ga0207671_100914702 107
322 3300025914 Ga0207671_10179431 Ga0207671_101794313 107
323 3300025914 Ga0207671_10563022 Ga0207671_105630222 107
324 3300025914 Ga0207671_10903191 Ga0207671_109031911 107
325 3300025915 Ga0207693_10046533 Ga0207693_100465332 107
326 3300025916 Ga0207663_10040738 Ga0207663_100407384 107
327 3300025917 Ga0207660_10420089 Ga0207660_104200892 107
328 3300025918 Ga0207662_10002408 Ga0207662_100024084 107
329 3300025918 Ga0207662_10500817 Ga0207662_105008171 107
330 3300025919 Ga0207657_11433754 Ga0207657_114337541 107
331 3300025920 Ga0207649_10005712 Ga0207649_100057128 107
332 3300025920 Ga0207649_10018291 Ga0207649_100182913 107
333 3300025920 Ga0207649_11142174 Ga0207649_111421741 107
334 3300025921 Ga0207652_10000818 Ga0207652_1000081815 107
335 3300025921 Ga0207652_10023502 Ga0207652_100235025 107
336 3300025923 Ga0207681_10264177 Ga0207681_102641772 107
337 3300025924 Ga0207694_10034992 Ga0207694_100349922 107
338 3300025924 Ga0207694_10051744 Ga0207694_100517443 107
339 3300025924 Ga0207694_10089148 Ga0207694_100891484 107
340 3300025924 Ga0207694_10094312 Ga0207694_100943123 107
341 3300025924 Ga0207694_10095989 Ga0207694_100959893 107
342 3300025924 Ga0207694_10170232 Ga0207694_101702323 107
343 3300025924 Ga0207694_10226114 Ga0207694_102261142 107
344 3300025924 Ga0207694_10346735 Ga0207694_103467351 107
345 3300025924 Ga0207694_10400451 Ga0207694_104004512 107
346 3300025924 Ga0207694_10450757 Ga0207694_104507572 107
347 3300025925 Ga0207650_10020453 Ga0207650_100204535 107
348 3300025925 Ga0207650_10963172 Ga0207650_109631721 107
349 3300025926 Ga0207659_10020775 Ga0207659_100207754 107
350 3300025927 Ga0207687_10000724 Ga0207687_1000072415 107
351 3300025927 Ga0207687_10265114 Ga0207687_102651142 107
352 3300025927 Ga0207687_10626670 Ga0207687_106266702 107
353 3300025928 Ga0207700_11132560 Ga0207700_111325601 107
354 3300025928 Ga0207700_11294512 Ga0207700_112945121 107
355 3300025929 Ga0207664_11310299 Ga0207664_113102992 107
356 3300025931 Ga0207644_10030294 Ga0207644_100302944 107
357 3300025931 Ga0207644_10094713 Ga0207644_100947132 107
358 3300025931 Ga0207644_11611922 Ga0207644_116119221 107
359 3300025932 Ga0207690_10011017 Ga0207690_100110176 107
360 3300025932 Ga0207690_10125790 Ga0207690_101257903 107
361 3300025932 Ga0207690_10160083 Ga0207690_101600833 107
362 3300025933 Ga0207706_10036803 Ga0207706_100368031 107
363 3300025933 Ga0207706_10134800 Ga0207706_101348004 107
364 3300025933 Ga0207706_11212466 Ga0207706_112124662 107
365 3300025934 Ga0207686_11399006 Ga0207686_113990061 107
366 3300025936 Ga0207670_10080162 Ga0207670_100801623 107
367 3300025937 Ga0207669_10373404 Ga0207669_103734042 107
368 3300025938 Ga0207704_10102410 Ga0207704_101024102 107
369 3300025939 Ga0207665_10005803 Ga0207665_100058036 107
370 3300025940 Ga0207691_10030667 Ga0207691_100306673 107
371 3300025941 Ga0207711_10062170 Ga0207711_100621703 107
372 3300025941 Ga0207711_10280180 Ga0207711_102801802 107
373 3300025941 Ga0207711_11039025 Ga0207711_110390251 107
374 3300025942 Ga0207689_10047690 Ga0207689_100476903 107
375 3300025942 Ga0207689_10581099 Ga0207689_105810992 107
376 3300025942 Ga0207689_11033401 Ga0207689_110334011 107
377 3300025944 Ga0207661_10159156 Ga0207661_101591563 107
378 3300025945 Ga0207679_10033000 Ga0207679_100330005 107
379 3300025945 Ga0207679_10034477 Ga0207679_100344772 107
380 3300025945 Ga0207679_10208304 Ga0207679_102083042 107
381 3300025949 Ga0207667_10002711 Ga0207667_1000271114 107
382 3300025949 Ga0207667_10020513 Ga0207667_100205133 107
383 3300025949 Ga0207667_10046088 Ga0207667_100460885 107
384 3300025949 Ga0207667_10210483 Ga0207667_102104832 107
385 3300025949 Ga0207667_10240844 Ga0207667_102408443 107
386 3300025949 Ga0207667_10250755 Ga0207667_102507551 107
387 3300025960 Ga0207651_11496591 Ga0207651_114965912 107
388 3300025961 Ga0207712_10030573 Ga0207712_100305732 107
389 3300025961 Ga0207712_10063884 Ga0207712_100638844 107
390 3300025981 Ga0207640_10104095 Ga0207640_101040953 107
391 3300025981 Ga0207640_10481768 Ga0207640_104817682 107
392 3300025986 Ga0207658_10028709 Ga0207658_100287093 107
393 3300025986 Ga0207658_10243804 Ga0207658_102438043 107
394 3300025986 Ga0207658_11716862 Ga0207658_117168621 107
395 3300026023 Ga0207677_10724913 Ga0207677_107249131 107
396 3300026035 Ga0207703_10000767 Ga0207703_1000076710 107
397 3300026035 Ga0207703_10003598 Ga0207703_100035988 107
398 3300026035 Ga0207703_10026715 Ga0207703_100267156 107
399 3300026035 Ga0207703_10030091 Ga0207703_100300913 107
400 3300026041 Ga0207639_10016461 Ga0207639_100164616 107
401 3300026041 Ga0207639_10032606 Ga0207639_100326065 107
402 3300026041 Ga0207639_10399889 Ga0207639_103998892 107
403 3300026041 Ga0207639_10617069 Ga0207639_106170691 107
404 3300026041 Ga0207639_12034650 Ga0207639_120346501 107
405 3300026067 Ga0207678_10031955 Ga0207678_100319555 107
406 3300026067 Ga0207678_10083126 Ga0207678_100831263 107
407 3300026067 Ga0207678_11885341 Ga0207678_118853412 107
408 3300026075 Ga0207708_10956465 Ga0207708_109564651 107
409 3300026075 Ga0207708_11541508 Ga0207708_115415081 107
410 3300026078 Ga0207702_10128822 Ga0207702_101288222 107
411 3300026078 Ga0207702_10617612 Ga0207702_106176121 107
412 3300026078 Ga0207702_10794213 Ga0207702_107942132 107
413 3300026078 Ga0207702_10901889 Ga0207702_109018891 107
414 3300026088 Ga0207641_10001749 Ga0207641_1000174918 107
415 3300026088 Ga0207641_10016369 Ga0207641_100163696 107
416 3300026088 Ga0207641_10101341 Ga0207641_101013413 107
417 3300026089 Ga0207648_10015173 Ga0207648_100151739 107
418 3300026089 Ga0207648_10786084 Ga0207648_107860842 107
419 3300026095 Ga0207676_10031009 Ga0207676_100310093 107
420 3300026095 Ga0207676_10113276 Ga0207676_101132763 107
421 3300026116 Ga0207674_10016484 Ga0207674_100164842 107
422 3300026116 Ga0207674_10248142 Ga0207674_102481422 107
423 3300026116 Ga0207674_10284419 Ga0207674_102844192 107
424 3300026116 Ga0207674_10729685 Ga0207674_107296851 107
425 3300026118 Ga0207675_100139626 Ga0207675_1001396264 107
426 3300026118 Ga0207675_100253070 Ga0207675_1002530702 107
427 3300026118 Ga0207675_100573859 Ga0207675_1005738593 107
428 3300026121 Ga0207683_10031261 Ga0207683_100312613 107
429 3300026121 Ga0207683_10205304 Ga0207683_102053043 107
430 3300026142 Ga0207698_11430596 Ga0207698_114305962 107
431 3300027543 Ga0209999_1083690 Ga0209999_10836902 107
432 3300027671 Ga0209588_1108203 Ga0209588_11082032 107
433 3300027717 Ga0209998_10013597 Ga0209998_100135972 107
434 3300028379 Ga0268266_10024612 Ga0268266_100246125 107
435 3300028379 Ga0268266_10041234 Ga0268266_100412345 107
436 3300028379 Ga0268266_10494293 Ga0268266_104942932 107
437 3300028380 Ga0268265_10015612 Ga0268265_100156122 107
438 3300028380 Ga0268265_10046107 Ga0268265_100461072 107
439 3300028380 Ga0268265_10561553 Ga0268265_105615531 107
440 3300028380 Ga0268265_10708477 Ga0268265_107084772 107
441 3300028380 Ga0268265_10751207 Ga0268265_107512072 107
442 3300028381 Ga0268264_10000034 Ga0268264_10000034296 107
443 3300028381 Ga0268264_10069363 Ga0268264_100693635 107
444 3300028381 Ga0268264_10099360 Ga0268264_100993603 107
445 3300030521 Ga0307511_10245353 Ga0307511_102453531 107
446 3300030760 Ga0265762_1120925 Ga0265762_11209251 107
447 3300030863 Ga0265766_1018627 Ga0265766_10186271 107
448 3300031018 Ga0265773_1004122 Ga0265773_10041222 107
449 3300031238 Ga0265332_10073069 Ga0265332_100730692 107
450 3300031456 Ga0307513_10215622 Ga0307513_102156223 107
451 3300031548 Ga0307408_100390661 Ga0307408_1003906612 107
452 3300031665 Ga0316575_10052474 Ga0316575_100524743 107
453 3300031665 Ga0316575_10319790 Ga0316575_103197902 107
454 3300031727 Ga0316576_10266909 Ga0316576_102669093 107
455 3300031728 Ga0316578_10374832 Ga0316578_103748322 107
456 3300031730 Ga0307516_10619235 Ga0307516_106192351 107
457 3300031733 Ga0316577_10161714 Ga0316577_101617142 107
458 3300031733 Ga0316577_10635844 Ga0316577_106358442 107
459 3300031838 Ga0307518_10501202 Ga0307518_105012021 107
460 3300031852 Ga0307410_10235849 Ga0307410_102358492 107
461 3300031901 Ga0307406_10240725 Ga0307406_102407253 107
462 3300031903 Ga0307407_10601137 Ga0307407_106011372 107
463 3300031911 Ga0307412_10729932 Ga0307412_107299321 107
464 3300032002 Ga0307416_100537147 Ga0307416_1005371472 107
465 3300032002 Ga0307416_101569799 Ga0307416_1015697991 107
466 3300032126 Ga0307415_100220596 Ga0307415_1002205962 107
467 3300032133 Ga0316583_10133012 Ga0316583_101330122 107
468 3300033180 Ga0307510_10000005 Ga0307510_1000000589 107
469 3300033180 Ga0307510_10015965 Ga0307510_100159658 107
470 3300034817 Ga0373948_0097737 Ga0373948_0097737_22_345 107
471 3300034817 Ga0373948_0212322 Ga0373948_0212322_15_338 107
472 3300035084 Ga0373928_0030234 Ga0373928_0030234_617_940 107
473 3300035088 Ga0373940_0159061 Ga0373940_0159061_302_625 107
474 3300035111 Ga0373923_0063128 Ga0373923_0063128_1016_1339 107
475 3300035113 Ga0373936_0393256 Ga0373936_0393256_229_552 107
476 3300035116 Ga0373945_0140389 Ga0373945_0140389_378_701 107
477 3300035117 Ga0373953_0133914 Ga0373953_0133914_555_878 107
478 3300035119 Ga0373956_0019200 Ga0373956_0019200_2234_2557 107
479 3300035119 Ga0373956_0267874 Ga0373956_0267874_90_413 107
480 3300035120 Ga0373957_0051890 Ga0373957_0051890_633_956 107
481 3300035171 Ga0373946_0111505 Ga0373946_0111505_810_1133 107
482 3300035172 Ga0373955_0114480 Ga0373955_0114480_795_1118 107
483 3300035398 Ga0316574_0042517 Ga0316574_0042517_118_441 107
484 3300035398 Ga0316574_0271069 Ga0316574_0271069_21_344 107
485 3300035692 Ga0373935_0172339 Ga0373935_0172339_263_586 107
486 3300035692 Ga0373935_0357917 Ga0373935_0357917_230_553 107
487 3300035695 Ga0373927_1112631 Ga0373927_1112631_187_510 107
488 3300035724 Ga0373933_0024168 Ga0373933_0024168_1061_1384 107
489 3300035724 Ga0373933_0101972 Ga0373933_0101972_127_459 107
490 3300036401 Ga0373937_0003400 Ga0373937_0003400_11729_12052 107
491 3300036401 Ga0373937_0046970 Ga0373937_0046970_2505_2837 107
492 3300036401 Ga0373937_0102977 Ga0373937_0102977_433_756 107
493 3300036401 Ga0373937_0172819 Ga0373937_0172819_839_1162 107
494 3300036712 Ga0316584_0054911 Ga0316584_0054911_1565_1888 107
495 3300037068 Ga0373925_0896864 Ga0373925_0896864_383_706 107
496 3300037418 Ga0395900_0638682 Ga0395900_0638682_406_729 107
497 3300037466 Ga0395898_0021247 Ga0395898_0021247_3140_3463 107
498 3300037466 Ga0395898_0144176 Ga0395898_0144176_182_505 107
499 3300038443 Ga0395901_0260698 Ga0395901_0260698_616_942 107
500 3300038443 Ga0395901_0773183 Ga0395901_0773183_82_408 107
501 3300039437 Ga0436365_0204524 Ga0436365_0204524_4126_4449 107
502 3300039437 Ga0436365_1728503 Ga0436365_1728503_11_343 107
503 3300039438 Ga0436360_0503581 Ga0436360_0503581_251_574 107
504 3300039438 Ga0436360_0561777 Ga0436360_0561777_51_374 107
505 3300039438 Ga0436360_0884838 Ga0436360_0884838_7551_7874 107
506 3300039438 Ga0436360_1049957 Ga0436360_1049957_91_414 107
507 3300039438 Ga0436360_1264219 Ga0436360_1264219_2408_2731 107
508 3300039447 Ga0436361_0958437 Ga0436361_0958437_736_1059 107
509 3300039450 Ga0436363_0402446 Ga0436363_0402446_2708_3031 107
510 3300039450 Ga0436363_0598179 Ga0436363_0598179_243_566 107
511 3300039450 Ga0436363_0854110 Ga0436363_0854110_342_665 107
512 3300039450 Ga0436363_1146804 Ga0436363_1146804_1535_1858 107
513 3300039453 Ga0436362_0372061 Ga0436362_0372061_143_466 107
514 3300039453 Ga0436362_0442781 Ga0436362_0442781_145_468 107
515 3300039453 Ga0436362_0465396 Ga0436362_0465396_373_696 107
516 3300039453 Ga0436362_1247594 Ga0436362_1247594_485_808 107
517 3300041408 Ga0439453_0159040 Ga0439453_0159040_73_396 107
518 3300041453 Ga0451797_0325197 Ga0451797_0325197_192_515 107
519 3300041456 Ga0451795_1363391 Ga0451795_1363391_111_434 107
520 3300041491 Ga0451833_1258513 Ga0451833_1258513_12_335 107
521 3300042125 Ga0450923_092392 Ga0450923_092392_78_401 107
522 3300042156 Ga0439446_0005312 Ga0439446_0005312_1624_1950 107
523 3300042436 Ga0439435_0085902 Ga0439435_0085902_208_531 107
524 3300042530 Ga0450916_018264 Ga0450916_018264_232_555 107
525 3300042876 Ga0451577_0015656 Ga0451577_0015656_2811_3134 107
526 3300044673 Ga0453683_0089708 Ga0453683_0089708_1534_1857 107
527 3300044683 Ga0466965_0121701 Ga0466965_0121701_69_392 107
528 3300044693 Ga0466961_0004699 Ga0466961_0004699_6055_6378 107
529 3300044706 Ga0466964_0005787 Ga0466964_0005787_248_571 107
530 3300044712 Ga0453684_0031657 Ga0453684_0031657_3325_3648 107
531 3300044712 Ga0453684_1788286 Ga0453684_1788286_279_602 107
532 3300044765 Ga0466970_0039657 Ga0466970_0039657_1024_1347 107
533 3300045049 Ga0466959_0040191 Ga0466959_0040191_335_658 107
534 3300045051 Ga0451576_0015133 Ga0451576_0015133_6630_6953 107
535 3300045051 Ga0451576_0142483 Ga0451576_0142483_175_498 107
536 3300045051 Ga0451576_1069270 Ga0451576_1069270_68_391 107
537 3300045836 Ga0466958_0222295 Ga0466958_0222295_381_704 107
538 3300046455 Ga0495603_0068798 Ga0495603_0068798_754_1077 107
539 3300046459 Ga0495629_0214492 Ga0495629_0214492_488_811 107
540 3300046472 Ga0495580_0112577 Ga0495580_0112577_805_1128 107
541 3300046475 Ga0495639_0166458 Ga0495639_0166458_584_907 107
542 3300046475 Ga0495639_0640326 Ga0495639_0640326_94_426 107
543 3300046499 Ga0495594_0435893 Ga0495594_0435893_215_538 107
544 3300046506 Ga0495583_0051955 Ga0495583_0051955_319_642 107
545 3300046507 Ga0495606_0579278 Ga0495606_0579278_155_478 107
546 3300046517 Ga0495630_0418605 Ga0495630_0418605_306_629 107
547 3300046536 Ga0495587_0079876 Ga0495587_0079876_702_1025 107
548 3300046543 Ga0495645_0868831 Ga0495645_0868831_62_385 107
549 3300046648 Ga0495611_0124587 Ga0495611_0124587_191_514 107
550 3300046660 Ga0495625_0388136 Ga0495625_0388136_405_728 107
551 3300046664 Ga0495659_0049173 Ga0495659_0049173_579_902 107
552 3300046675 Ga0495657_0066464 Ga0495657_0066464_1888_2211 107
553 3300046675 Ga0495657_0493905 Ga0495657_0493905_129_452 107
554 3300046679 Ga0495623_0024171 Ga0495623_0024171_2372_2695 107
555 3300046681 Ga0495647_0034424 Ga0495647_0034424_508_831 107
556 3300046683 Ga0495658_0114093 Ga0495658_0114093_576_899 107
557 3300046692 Ga0495671_0060069 Ga0495671_0060069_1074_1397 107
558 3300046694 Ga0495649_0180687 Ga0495649_0180687_615_938 107
559 3300047320 Ga0495672_0346698 Ga0495672_0346698_303_626 107
560 3300047322 Ga0495680_0324393 Ga0495680_0324393_284_607 107
561 3300047443 Ga0495687_097004 Ga0495687_097004_365_688 107
562 3300047444 Ga0495675_0085211 Ga0495675_0085211_1258_1581 107
563 3300047446 Ga0495679_047525 Ga0495679_047525_511_864 107
564 3300047472 Ga0495686_0005836 Ga0495686_0005836_3977_4330 107
565 3300047472 Ga0495686_0015719 Ga0495686_0015719_4581_4934 107
566 3300048088 Ga0495602_0146507 Ga0495602_0146507_1100_1423 107
567 3300048903 Ga0496100_0659174 Ga0496100_0659174_44_367 107
568 3300048903 Ga0496100_0868601 Ga0496100_0868601_189_512 107
569 3300048904 Ga0496101_0965309 Ga0496101_0965309_322_645 107
570 3300048905 Ga0496102_0022244 Ga0496102_0022244_4571_4894 107
571 3300048905 Ga0496102_0635779 Ga0496102_0635779_50_373 107
572 3300048906 Ga0496103_0342663 Ga0496103_0342663_18_341 107
573 3300048906 Ga0496103_0986511 Ga0496103_0986511_121_453 107
574 3300048907 Ga0496104_0059235 Ga0496104_0059235_549_872 107
575 3300048908 Ga0496105_0189689 Ga0496105_0189689_153_476 107
576 3300048909 Ga0496106_0101714 Ga0496106_0101714_905_1228 107
577 3300048910 Ga0496107_1042491 Ga0496107_1042491_17_340 107
578 3300048911 Ga0496108_0180231 Ga0496108_0180231_469_792 107
579 3300048911 Ga0496108_0252174 Ga0496108_0252174_81_404 107
580 3300048911 Ga0496108_1554965 Ga0496108_1554965_115_438 107
581 3300048912 Ga0496109_0011333 Ga0496109_0011333_2418_2741 107
582 3300048912 Ga0496109_0248585 Ga0496109_0248585_146_469 107
583 3300048913 Ga0496110_0131653 Ga0496110_0131653_1848_2171 107
584 3300048913 Ga0496110_0280917 Ga0496110_0280917_218_541 107
585 3300048914 Ga0496111_0197173 Ga0496111_0197173_931_1254 107
586 3300048915 Ga0496112_0002877 Ga0496112_0002877_8219_8542 107
587 3300048915 Ga0496112_0216241 Ga0496112_0216241_192_515 107
588 3300048915 Ga0496112_1553466 Ga0496112_1553466_205_528 107
589 3300048916 Ga0496113_1389917 Ga0496113_1389917_201_524 107
590 3300048917 Ga0496114_0000553 Ga0496114_0000553_26367_26690 107
591 3300048918 Ga0496115_0435304 Ga0496115_0435304_353_676 107
592 3300048919 Ga0496116_0002539 Ga0496116_0002539_4169_4492 107
593 3300048920 Ga0496117_0000012 Ga0496117_0000012_522103_522426 107
594 3300048920 Ga0496117_0330297 Ga0496117_0330297_331_654 107
595 3300048921 Ga0496118_0000051 Ga0496118_0000051_153219_153542 107
596 3300048922 Ga0496119_0001899 Ga0496119_0001899_4998_5321 107
597 3300048922 Ga0496119_0015454 Ga0496119_0015454_3147_3470 107
598 3300048922 Ga0496119_0391285 Ga0496119_0391285_41_364 107
599 3300048923 Ga0496120_0000191 Ga0496120_0000191_12139_12462 107
600 3300048923 Ga0496120_0379879 Ga0496120_0379879_167_490 107
601 3300048924 Ga0496121_0047554 Ga0496121_0047554_2823_3146 107
602 3300048927 Ga0496124_0055897 Ga0496124_0055897_1699_2022 107
603 3300048927 Ga0496124_0158964 Ga0496124_0158964_307_630 107
604 3300048928 Ga0496125_0002488 Ga0496125_0002488_16583_16906 107
605 3300048928 Ga0496125_0057972 Ga0496125_0057972_1901_2224 107
606 3300048928 Ga0496125_0389330 Ga0496125_0389330_479_802 107
607 3300048929 Ga0496126_0014282 Ga0496126_0014282_777_1100 107
608 3300048929 Ga0496126_0054680 Ga0496126_0054680_2110_2433 107
609 3300048929 Ga0496126_0060199 Ga0496126_0060199_2921_3244 107
610 3300048929 Ga0496126_1214645 Ga0496126_1214645_34_357 107
611 3300049571 Ga0501034_1418009 Ga0501034_1418009_154_477 107
612 3300049572 Ga0501036_0370075 Ga0501036_0370075_658_981 107
613 3300049575 Ga0501039_0030860 Ga0501039_0030860_2793_3116 107
614 3300049576 Ga0501040_0686352 Ga0501040_0686352_391_714 107
615 3300049577 Ga0501041_0114551 Ga0501041_0114551_194_517 107
616 3300049577 Ga0501041_0745426 Ga0501041_0745426_210_533 107
617 3300049578 Ga0501042_0097698 Ga0501042_0097698_604_927 107
618 3300049579 Ga0501043_0397993 Ga0501043_0397993_174_497 107
619 3300049580 Ga0501046_0670398 Ga0501046_0670398_247_570 107
620 3300049582 Ga0501048_0700513 Ga0501048_0700513_10_333 107
621 3300049586 Ga0501070_0016490 Ga0501070_0016490_998_1324 107
622 3300049587 Ga0501071_0564991 Ga0501071_0564991_452_775 107
623 3300049590 Ga0501074_0719773 Ga0501074_0719773_22_345 107
624 3300049592 Ga0501076_0041080 Ga0501076_0041080_2763_3086 107
625 3300049593 Ga0501077_0678264 Ga0501077_0678264_316_639 107
626 3300049741 Ga0501079_0130160 Ga0501079_0130160_1557_1880 107
627 3300049743 Ga0501081_0011175 Ga0501081_0011175_4295_4618 107
628 3300049743 Ga0501081_0324473 Ga0501081_0324473_588_911 107
629 3300049822 Ga0501035_0385471 Ga0501035_0385471_585_911 107
630 3300049823 Ga0501044_0269936 Ga0501044_0269936_565_891 107
631 3300049824 Ga0501045_1019955 Ga0501045_1019955_158_481 107
632 3300050493 nmdc:mga0k408_372635_c1 nmdc:mga0k408_372635_c1_465_788 107
633 3300050511 nmdc:mga08y16_447238_c1 nmdc:mga08y16_447238_c1_516_839 107
634 3300050512 nmdc:mga0n895_480458_c1 nmdc:mga0n895_480458_c1_764_1087 107
635 3300050513 nmdc:mga0rr50_488937_c1 nmdc:mga0rr50_488937_c1_712_1035 107
636 3300053077 Ga0495601_0052031 Ga0495601_0052031_200_523 107
637 3300053077 Ga0495601_0084901 Ga0495601_0084901_229_552 107
638 3300053078 Ga0495612_0379373 Ga0495612_0379373_139_462 107
639 3300053084 Ga0495595_0242483 Ga0495595_0242483_474_797 107
640 3300053085 Ga0495619_0754353 Ga0495619_0754353_39_362 107
641 3300053090 Ga0500646_0077941 Ga0500646_0077941_516_839 107
642 3300053090 Ga0500646_0107789 Ga0500646_0107789_209_532 107
643 3300053092 Ga0500583_0048764 Ga0500583_0048764_410_733 107
644 3300053093 Ga0500651_0088466 Ga0500651_0088466_382_705 107
645 3300053093 Ga0500651_0675469 Ga0500651_0675469_70_423 107
646 3300053096 Ga0500641_0012762 Ga0500641_0012762_758_1081 107
647 3300053098 Ga0500650_0189283 Ga0500650_0189283_477_800 107
648 3300053111 Ga0500572_034127 Ga0500572_034127_884_1207 107
649 3300053133 Ga0500655_062447 Ga0500655_062447_47_370 107
650 3300053136 Ga0500559_0091769 Ga0500559_0091769_783_1136 107
651 3300053136 Ga0500559_0400499 Ga0500559_0400499_162_485 107
652 3300053139 Ga0500568_0092059 Ga0500568_0092059_330_653 107
653 3300053148 Ga0500590_098499 Ga0500590_098499_51_374 107
654 3300053153 Ga0500616_0000018 Ga0500616_0000018_34147_34470 107
655 3300053156 Ga0500622_0007139 Ga0500622_0007139_4649_4972 107
656 3300053732 Ga0500656_058277 Ga0500656_058277_233_556 107
657 3300059645 Ga0587076_165251 Ga0587076_165251_115_438 107
658 3300059645 Ga0587076_178932 Ga0587076_178932_42_365 107
659 3300059655 Ga0587114_141677 Ga0587114_141677_113_436 107
660 3300060353 Ga0501082_0411674 Ga0501082_0411674_677_1000 107
661 3300061719 Ga0466962_0007877 Ga0466962_0007877_294_617 107
662 3300061734 Ga0530510_0685578 Ga0530510_0685578_276_599 107
663 iso_pu_bacteria 8054302542 8054303952 107
664 iso_pu_bacteria 8057101203 8057101338 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

25

127

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.9375 3 96
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.9258 1 97
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.9168 1 97
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.9133 1 95
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.901 3 96
ID Description Score Start End Superfamily
1s98A00 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9375 3 96 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.918 3 95 2.60.300.12
1s98A00 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.901 3 96 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8994 3 95 2.60.300.12
af_A0A0R0F1L8_21_105_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8973 2 85 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A7U6KQS0-F1-model_v4 Iron-binding protein IscA 0.9723 3 83 GO:0005829
GO:0016226
GO:0051537
GO:0097428
AF-A0A2E9REK1-F1-model_v4 Iron-sulfur cluster assembly protein IscA 0.9686 1 84 GO:0005829
GO:0016226
GO:0051537
GO:0097428
AF-A0A376SBE1-F1-model_v4 Iron-binding protein IscA (Iron-sulfur cluster assembly protein) 0.9608 1 97 GO:0005506
GO:0005829
GO:0016226
GO:0051537
GO:0097428
AF-A0A2P0QN95-F1-model_v4 Heme biosynthesis protein 0.9591 1 91 GO:0005829
GO:0016226
GO:0051537
GO:0097428
AF-A0A2X4TF71-F1-model_v4 Iron binding protein SufA for iron-sulfur cluster assembly 0.9588 2 94 GO:0005829
GO:0016226
GO:0046872
GO:0051537
GO:0097428

Feature Viewer

pLDDT pTM Quality
82.7 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map