F473539

General Info

Members Datasets Scaffolds Average Seq Length
663 265 1326 103

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100266571|Ga0070708_1002665711
Length 114
Sequence VRFLDASTIQVGGEQLDVSWFLLLAAALFVLGAIGVLIRRNPLVMLICVELMLNAVNLTLVAFSRQLNNREGQLFALMTMTVAAAEAVVGLAILVDIFRVRDLEDIDELSELKG

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
186 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
187 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
188 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
191 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
209 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
210 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
211 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
212 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
213 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
214 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
215 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
234 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
235 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
250 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.21
Rhizosphere 98.79
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100266571 3300005445 Bacteria 1610
2 MRS1b_contig_5463041 2162886011 Bacteria 1146
3 ARcpr5yngRDRAFT_c012802 3300000043 Bacteria 707
4 ARCol0yngRDRAFT_1010460 3300000652 Bacteria 677
5 JGI26145J50221_1005068 3300003371 Bacteria 1078
6 JGI25405J52794_10011130 3300003911 Bacteria 1720
7 Ga0065712_10069052 3300005290 Bacteria 8153
8 Ga0065712_10074379 3300005290 Bacteria 4110
9 Ga0065715_10001241 3300005293 Bacteria 7744
10 Ga0065715_10092666 3300005293 Bacteria 4997
11 Ga0065715_10099890 3300005293 Bacteria 3334
12 Ga0065715_10337527 3300005293 Bacteria 972
13 Ga0065707_10002698 3300005295 Bacteria 6202
14 Ga0065707_10183002 3300005295 Bacteria 1406
15 Ga0065707_10302301 3300005295 Bacteria 1002
16 Ga0065707_10329768 3300005295 Bacteria 933
17 Ga0065707_10891789 3300005295 Bacteria 569
18 Ga0070658_11402524 3300005327 Unclassified 606
19 Ga0070676_10181087 3300005328 Bacteria 1370
20 Ga0070690_100056129 3300005330 Bacteria 2524
21 Ga0070690_100066544 3300005330 Bacteria 2333
22 Ga0070670_100000587 3300005331 Bacteria 28691
23 Ga0070670_100763108 3300005331 Bacteria 872
24 Ga0070677_10034843 3300005333 Bacteria 1947
25 Ga0068869_100081235 3300005334 Bacteria 2420
26 Ga0070666_10004865 3300005335 Bacteria 8209
27 Ga0070666_10030274 3300005335 Bacteria 3564
28 Ga0070680_100007262 3300005336 Bacteria 8443
29 Ga0070680_100225875 3300005336 Bacteria 1581
30 Ga0070680_100236615 3300005336 Bacteria 1543
31 Ga0070682_100623737 3300005337 Bacteria 855
32 Ga0070682_101034488 3300005337 Bacteria 684
33 Ga0068868_100239400 3300005338 Bacteria 1524
34 Ga0070660_100061389 3300005339 Bacteria 2918
35 Ga0070660_101781765 3300005339 Bacteria 524
36 Ga0070689_100179468 3300005340 Bacteria 1719
37 Ga0070691_10121914 3300005341 Bacteria 1313
38 Ga0070687_100361242 3300005343 Bacteria 940
39 Ga0070661_100014334 3300005344 Bacteria 5584
40 Ga0070661_100176781 3300005344 Unclassified 1623
41 Ga0070661_101112452 3300005344 Bacteria 658
42 Ga0070668_100634339 3300005347 Bacteria 938
43 Ga0070668_100790803 3300005347 Bacteria 842
44 Ga0070669_100073219 3300005353 Bacteria 2537
45 Ga0070669_100897787 3300005353 Bacteria 757
46 Ga0070675_100034776 3300005354 Bacteria 4090
47 Ga0070671_100046125 3300005355 Bacteria 3624
48 Ga0070671_100085973 3300005355 Bacteria 2631
49 Ga0070671_100146622 3300005355 Bacteria 1992
50 Ga0070671_100781108 3300005355 Bacteria 831
51 Ga0070674_100508146 3300005356 Bacteria 1005
52 Ga0070674_101131545 3300005356 Bacteria 692
53 Ga0070673_100019677 3300005364 Bacteria 4850
54 Ga0070673_100048005 3300005364 Bacteria 3326
55 Ga0070673_102292223 3300005364 Bacteria 513
56 Ga0070659_100044904 3300005366 Bacteria 3461
57 Ga0070659_100710715 3300005366 Bacteria 869
58 Ga0070667_100199194 3300005367 Bacteria 1777
59 Ga0070703_10004526 3300005406 Bacteria 3912
60 Ga0070703_10095179 3300005406 Bacteria 1040
61 Ga0070703_10119942 3300005406 Bacteria 953
62 Ga0070703_10132107 3300005406 Bacteria 918
63 Ga0070709_10362824 3300005434 Bacteria 1073
64 Ga0070714_100084204 3300005435 Bacteria 2774
65 Ga0070714_100364382 3300005435 Bacteria 1359
66 Ga0070714_100905238 3300005435 Bacteria 857
67 Ga0070714_101098669 3300005435 Bacteria 775
68 Ga0070714_101155813 3300005435 Bacteria 755
69 Ga0070714_101757359 3300005435 Bacteria 606
70 Ga0070713_100186123 3300005436 Bacteria 1869
71 Ga0070713_100982643 3300005436 Unclassified 814
72 Ga0070705_100001524 3300005440 Bacteria 12195
73 Ga0070705_100167654 3300005440 Bacteria 1475
74 Ga0070705_100643766 3300005440 Bacteria 825
75 Ga0070705_101324664 3300005440 Bacteria 598
76 Ga0070705_101347014 3300005440 Bacteria 593
77 Ga0070700_100543301 3300005441 Bacteria 901
78 Ga0070694_100049426 3300005444 Bacteria 2833
79 Ga0070694_100225325 3300005444 Bacteria 1408
80 Ga0070694_100282063 3300005444 Bacteria 1267
81 Ga0070694_100325613 3300005444 Bacteria 1184
82 Ga0070694_101286040 3300005444 Bacteria 615
83 Ga0070708_100000008 3300005445 Bacteria 146021
84 Ga0070708_100030965 3300005445 Bacteria 4628
85 Ga0070708_100039371 3300005445 Bacteria 4135
86 Ga0070708_100114863 3300005445 Bacteria 2478
87 Ga0070708_100118299 3300005445 Bacteria 2441
88 Ga0070708_100128887 3300005445 Bacteria 2341
89 Ga0070708_100162279 3300005445 Bacteria 2083
90 Ga0070708_100495478 3300005445 Bacteria 1152
91 Ga0070708_100610131 3300005445 Bacteria 1029
92 Ga0070708_100628271 3300005445 Bacteria 1012
93 Ga0070708_100762590 3300005445 Bacteria 910
94 Ga0070708_101476939 3300005445 Bacteria 634
95 Ga0070708_101940314 3300005445 Bacteria 546
96 Ga0070663_100413367 3300005455 Bacteria 1105
97 Ga0070663_101478395 3300005455 Bacteria 603
98 Ga0070678_100011018 3300005456 Bacteria 5554
99 Ga0070678_100029339 3300005456 Bacteria 3765
100 Ga0070662_100006396 3300005457 Bacteria 7591
101 Ga0070662_100023210 3300005457 Bacteria 4259
102 Ga0070662_100127550 3300005457 Bacteria 1957
103 Ga0070662_101077268 3300005457 Bacteria 689
104 Ga0070662_101111788 3300005457 Bacteria 678
105 Ga0070681_10000542 3300005458 Bacteria 31061
106 Ga0070681_10038572 3300005458 Bacteria 4789
107 Ga0070681_10148929 3300005458 Bacteria 2268
108 Ga0070681_10889077 3300005458 Bacteria 809
109 Ga0068867_100373540 3300005459 Bacteria 1196
110 Ga0070706_100000157 3300005467 Bacteria 86485
111 Ga0070706_100000448 3300005467 Bacteria 49282
112 Ga0070706_100000648 3300005467 Bacteria 39764
113 Ga0070706_100001738 3300005467 Bacteria 22580
114 Ga0070706_100001820 3300005467 Bacteria 22097
115 Ga0070706_100009331 3300005467 Bacteria 9142
116 Ga0070706_100017262 3300005467 Bacteria 6663
117 Ga0070706_100034340 3300005467 Bacteria 4685
118 Ga0070706_100162022 3300005467 Bacteria 2089
119 Ga0070706_100177754 3300005467 Bacteria 1987
120 Ga0070706_100204231 3300005467 Bacteria 1846
121 Ga0070706_100589091 3300005467 Bacteria 1034
122 Ga0070706_100694604 3300005467 Bacteria 944
123 Ga0070706_101253661 3300005467 Bacteria 680
124 Ga0070707_100000004 3300005468 Bacteria 265003
125 Ga0070707_100003251 3300005468 Bacteria 15402
126 Ga0070707_100021584 3300005468 Bacteria 6087
127 Ga0070707_100023480 3300005468 Bacteria 5834
128 Ga0070707_100030830 3300005468 Bacteria 5107
129 Ga0070707_100126692 3300005468 Bacteria 2481
130 Ga0070707_100128033 3300005468 Bacteria 2467
131 Ga0070707_100128265 3300005468 Bacteria 2465
132 Ga0070707_100128387 3300005468 Bacteria 2464
133 Ga0070707_100158491 3300005468 Bacteria 2205
134 Ga0070707_100305089 3300005468 Bacteria 1547
135 Ga0070707_100318558 3300005468 Bacteria 1511
136 Ga0070707_100321208 3300005468 Bacteria 1504
137 Ga0070707_100332185 3300005468 Bacteria 1477
138 Ga0070707_100418394 3300005468 Bacteria 1300
139 Ga0070707_100560518 3300005468 Bacteria 1105
140 Ga0070707_100566108 3300005468 Bacteria 1098
141 Ga0070707_100676865 3300005468 Bacteria 994
142 Ga0070707_100686692 3300005468 Bacteria 986
143 Ga0070707_100797082 3300005468 Bacteria 908
144 Ga0070707_101276755 3300005468 Bacteria 700
145 Ga0070707_101481437 3300005468 Unclassified 645
146 Ga0070698_100001828 3300005471 Bacteria 23691
147 Ga0070698_100009765 3300005471 Bacteria 10258
148 Ga0070698_100043824 3300005471 Bacteria 4585
149 Ga0070698_100045049 3300005471 Bacteria 4515
150 Ga0070698_100166325 3300005471 Bacteria 2148
151 Ga0070698_100218194 3300005471 Bacteria 1841
152 Ga0070698_100220066 3300005471 Bacteria 1832
153 Ga0070698_100266464 3300005471 Bacteria 1645
154 Ga0070698_100405732 3300005471 Bacteria 1296
155 Ga0070698_100526528 3300005471 Bacteria 1120
156 Ga0070698_100534208 3300005471 Bacteria 1111
157 Ga0070698_100672952 3300005471 Bacteria 976
158 Ga0070698_100917849 3300005471 Bacteria 821
159 Ga0070698_101429736 3300005471 Bacteria 642
160 Ga0070698_101728495 3300005471 Bacteria 578
161 Ga0070699_100000006 3300005518 Bacteria 363492
162 Ga0070699_100000118 3300005518 Bacteria 72787
163 Ga0070699_100000220 3300005518 Bacteria 56957
164 Ga0070699_100001853 3300005518 Bacteria 19179
165 Ga0070699_100010112 3300005518 Bacteria 8168
166 Ga0070699_100015054 3300005518 Bacteria 6647
167 Ga0070699_100203777 3300005518 Bacteria 1760
168 Ga0070699_100234067 3300005518 Bacteria 1638
169 Ga0070699_100570070 3300005518 Bacteria 1031
170 Ga0070699_100572818 3300005518 Bacteria 1028
171 Ga0070699_100593151 3300005518 Bacteria 1010
172 Ga0070699_100631256 3300005518 Bacteria 977
173 Ga0070699_100658790 3300005518 Bacteria 956
174 Ga0070699_100663119 3300005518 Bacteria 952
175 Ga0070699_100671961 3300005518 Bacteria 946
176 Ga0070699_100811133 3300005518 Bacteria 856
177 Ga0070699_101339192 3300005518 Bacteria 657
178 Ga0070679_100027295 3300005530 Bacteria 5618
179 Ga0070679_101364986 3300005530 Bacteria 655
180 Ga0070679_101484173 3300005530 Bacteria 625
181 Ga0070684_100152008 3300005535 Bacteria 2097
182 Ga0070684_100588540 3300005535 Bacteria 1034
183 Ga0070697_100000007 3300005536 Bacteria 197603
184 Ga0070697_100005773 3300005536 Bacteria 9542
185 Ga0070697_100012612 3300005536 Bacteria 6619
186 Ga0070697_100047037 3300005536 Bacteria 3499
187 Ga0070697_100098678 3300005536 Bacteria 2424
188 Ga0070697_100257717 3300005536 Bacteria 1493
189 Ga0070697_100286673 3300005536 Bacteria 1414
190 Ga0070697_100478254 3300005536 Bacteria 1087
191 Ga0070697_100486097 3300005536 Bacteria 1078
192 Ga0070697_100917698 3300005536 Bacteria 777
193 Ga0070697_101324141 3300005536 Bacteria 643
194 Ga0070697_101569475 3300005536 Bacteria 588
195 Ga0070697_101852954 3300005536 Bacteria 540
196 Ga0070697_101929787 3300005536 Bacteria 528
197 Ga0068853_101558151 3300005539 Bacteria 640
198 Ga0070672_100305146 3300005543 Bacteria 1350
199 Ga0070672_100610821 3300005543 Bacteria 950
200 Ga0070686_100301600 3300005544 Bacteria 1188
201 Ga0070686_100450394 3300005544 Bacteria 989
202 Ga0070695_100008054 3300005545 Bacteria 6246
203 Ga0070695_100171960 3300005545 Bacteria 1529
204 Ga0070695_100312507 3300005545 Bacteria 1165
205 Ga0070695_100369335 3300005545 Bacteria 1080
206 Ga0070695_100402442 3300005545 Bacteria 1038
207 Ga0070695_100994685 3300005545 Bacteria 682
208 Ga0070696_100035990 3300005546 Bacteria 3411
209 Ga0070696_100306945 3300005546 Bacteria 1217
210 Ga0070696_100555864 3300005546 Bacteria 920
211 Ga0070696_101326093 3300005546 Bacteria 611
212 Ga0070693_100044820 3300005547 Bacteria 2504
213 Ga0070693_100247445 3300005547 Bacteria 1180
214 Ga0070704_100116677 3300005549 Bacteria 2042
215 Ga0070704_101341776 3300005549 Bacteria 655
216 Ga0068855_100929561 3300005563 Unclassified 917
217 Ga0070664_100004565 3300005564 Bacteria 11110
218 Ga0070664_100243856 3300005564 Bacteria 1613
219 Ga0068854_100208788 3300005578 Bacteria 1539
220 Ga0068854_100312613 3300005578 Bacteria 1275
221 Ga0068856_100052132 3300005614 Bacteria 4034
222 Ga0068856_100251656 3300005614 Bacteria 1782
223 Ga0068859_100570680 3300005617 Bacteria 1225
224 Ga0068866_10217762 3300005718 Bacteria 1150
225 Ga0068866_10585624 3300005718 Bacteria 751
226 Ga0068861_100348180 3300005719 Bacteria 1299
227 Ga0068861_100474190 3300005719 Bacteria 1126
228 Ga0068863_100978486 3300005841 Bacteria 848
229 Ga0068863_101779144 3300005841 Bacteria 626
230 Ga0068863_101789084 3300005841 Unclassified 624
231 Ga0068862_101750956 3300005844 Bacteria 630
232 Ga0068862_102769510 3300005844 Bacteria 502
233 Ga0081455_10000067 3300005937 Bacteria 112338
234 Ga0081455_10109329 3300005937 Bacteria 2200
235 Ga0081538_10085604 3300005981 Bacteria 1655
236 Ga0081540_1041783 3300005983 Unclassified 2373
237 Ga0070717_10000093 3300006028 Bacteria 70046
238 Ga0070717_10000266 3300006028 Bacteria 35628
239 Ga0070717_10001892 3300006028 Bacteria 14640
240 Ga0070717_10005419 3300006028 Bacteria 9316
241 Ga0070717_10074718 3300006028 Bacteria 2834
242 Ga0070717_10478934 3300006028 Bacteria 1124
243 Ga0070717_10605926 3300006028 Bacteria 994
244 Ga0070717_11329900 3300006028 Bacteria 653
245 Ga0075432_10052780 3300006058 Bacteria 1437
246 Ga0070716_100177263 3300006173 Bacteria 1396
247 Ga0070716_100438388 3300006173 Bacteria 949
248 Ga0070712_100911494 3300006175 Bacteria 758
249 Ga0070712_102023944 3300006175 Bacteria 504
250 Ga0068871_101326450 3300006358 Bacteria 677
251 Ga0075428_100038847 3300006844 Bacteria 5238
252 Ga0075428_100451130 3300006844 Bacteria 1378
253 Ga0075428_101236907 3300006844 Unclassified 786
254 Ga0075430_100033781 3300006846 Bacteria 4340
255 Ga0075431_100133334 3300006847 Bacteria 2561
256 Ga0075431_100241991 3300006847 Bacteria 1835
257 Ga0075433_10019560 3300006852 Bacteria 5645
258 Ga0075433_10054321 3300006852 Bacteria 3494
259 Ga0075433_10162960 3300006852 Bacteria 1985
260 Ga0075433_10184095 3300006852 Bacteria 1858
261 Ga0075433_10696027 3300006852 Unclassified 890
262 Ga0075433_10842867 3300006852 Bacteria 800
263 Ga0075433_11709631 3300006852 Bacteria 542
264 Ga0075434_100004359 3300006871 Bacteria 12739
265 Ga0075434_100067976 3300006871 Bacteria 3549
266 Ga0075434_100127315 3300006871 Bacteria 2564
267 Ga0075434_100181961 3300006871 Unclassified 2122
268 Ga0075434_100187545 3300006871 Bacteria 2088
269 Ga0075434_100338749 3300006871 Bacteria 1525
270 Ga0075434_100629546 3300006871 Bacteria 1091
271 Ga0075434_100661522 3300006871 Bacteria 1063
272 Ga0075434_100729248 3300006871 Bacteria 1008
273 Ga0075434_100825667 3300006871 Bacteria 943
274 Ga0075434_101089336 3300006871 Unclassified 812
275 Ga0075429_100071618 3300006880 Bacteria 3018
276 Ga0068865_100118013 3300006881 Bacteria 1968
277 Ga0068865_100603777 3300006881 Bacteria 928
278 Ga0068865_100781222 3300006881 Bacteria 822
279 Ga0075436_100013085 3300006914 Bacteria 5688
280 Ga0075436_100019065 3300006914 Bacteria 4700
281 Ga0075436_100051562 3300006914 Bacteria 2839
282 Ga0075436_100167326 3300006914 Bacteria 1551
283 Ga0075436_100248468 3300006914 Bacteria 1266
284 Ga0075436_100258111 3300006914 Bacteria 1242
285 Ga0075436_100299450 3300006914 Bacteria 1152
286 Ga0075436_100508766 3300006914 Bacteria 881
287 Ga0075436_100708665 3300006914 Bacteria 746
288 Ga0075436_100812804 3300006914 Unclassified 696
289 Ga0075436_101283616 3300006914 Bacteria 554
290 Ga0075436_101321466 3300006914 Bacteria 546
291 Ga0097620_100570734 3300006931 Bacteria 1225
292 Ga0075435_100012619 3300007076 Bacteria 6259
293 Ga0075435_100043604 3300007076 Bacteria 3591
294 Ga0075435_100056886 3300007076 Bacteria 3162
295 Ga0075435_100470859 3300007076 Bacteria 1084
296 Ga0075435_100621081 3300007076 Bacteria 937
297 Ga0075435_100657136 3300007076 Bacteria 910
298 Ga0075435_101346066 3300007076 Bacteria 625
299 Ga0099794_10134553 3300007265 Bacteria 1249
300 Ga0099794_10178603 3300007265 Bacteria 1083
301 Ga0099794_10690772 3300007265 Bacteria 543
302 Ga0105240_10721451 3300009093 Bacteria 1086
303 Ga0111539_10079601 3300009094 Bacteria 3855
304 Ga0111539_10221875 3300009094 Bacteria 2201
305 Ga0111539_10460563 3300009094 Bacteria 1481
306 Ga0111539_11375693 3300009094 Bacteria 819
307 Ga0105245_10292673 3300009098 Bacteria 1595
308 Ga0105245_10521419 3300009098 Bacteria 1207
309 Ga0114129_10037434 3300009147 Bacteria 6849
310 Ga0114129_10089813 3300009147 Bacteria 4259
311 Ga0114129_10178929 3300009147 Bacteria 2887
312 Ga0114129_10201534 3300009147 Bacteria 2695
313 Ga0114129_10210077 3300009147 Bacteria 2632
314 Ga0114129_10274290 3300009147 Bacteria 2255
315 Ga0114129_10600216 3300009147 Bacteria 1426
316 Ga0114129_11009618 3300009147 Bacteria 1047
317 Ga0114129_11523515 3300009147 Unclassified 821
318 Ga0114129_12043736 3300009147 Bacteria 692
319 Ga0105237_11123783 3300009545 Bacteria 792
320 Ga0105249_10086597 3300009553 Bacteria 2922
321 Ga0105249_10361266 3300009553 Bacteria 1474
322 Ga0105249_12071046 3300009553 Bacteria 642
323 Ga0099796_10041362 3300010159 Bacteria 1561
324 Ga0105239_10742500 3300010375 Bacteria 1123
325 Ga0105239_11084771 3300010375 Bacteria 921
326 Ga0105246_11772656 3300011119 Bacteria 589
327 Ga0157338_1083918 3300012515 Bacteria 520
328 Ga0157369_12369611 3300013105 Unclassified 538
329 Ga0157374_11176951 3300013296 Bacteria 788
330 Ga0157378_10012655 3300013297 Bacteria 7384
331 Ga0157378_10089795 3300013297 Unclassified 2792
332 Ga0157378_11146137 3300013297 Unclassified 816
333 Ga0157378_11796837 3300013297 Bacteria 661
334 Ga0157378_12931017 3300013297 Bacteria 529
335 Ga0163162_10078365 3300013306 Bacteria 3370
336 Ga0163162_10238778 3300013306 Bacteria 1948
337 Ga0157372_11484667 3300013307 Bacteria 781
338 Ga0157375_11181746 3300013308 Bacteria 897
339 Ga0157375_11333258 3300013308 Bacteria 844
340 Ga0163163_10529840 3300014325 Bacteria 1240
341 Ga0157380_10555772 3300014326 Bacteria 1127
342 Ga0157376_10154599 3300014969 Bacteria 2072
343 Ga0157376_10457607 3300014969 Bacteria 1246
344 Ga0163161_10109656 3300017792 Bacteria 2062
345 Ga0207697_10019696 3300025315 Unclassified 2764
346 Ga0207697_10476763 3300025315 Bacteria 552
347 Ga0207653_10003320 3300025885 Bacteria 5078
348 Ga0207653_10100977 3300025885 Bacteria 1020
349 Ga0207653_10151069 3300025885 Bacteria 855
350 Ga0207653_10181103 3300025885 Bacteria 788
351 Ga0207682_10063259 3300025893 Bacteria 1553
352 Ga0207642_10466594 3300025899 Bacteria 767
353 Ga0207680_10026833 3300025903 Bacteria 3198
354 Ga0207699_10113405 3300025906 Bacteria 1741
355 Ga0207645_10183713 3300025907 Bacteria 1372
356 Ga0207684_10000005 3300025910 Bacteria 736617
357 Ga0207684_10000014 3300025910 Bacteria 440027
358 Ga0207684_10000027 3300025910 Bacteria 313272
359 Ga0207684_10000034 3300025910 Bacteria 291009
360 Ga0207684_10000183 3300025910 Bacteria 100388
361 Ga0207684_10000212 3300025910 Bacteria 89645
362 Ga0207684_10086474 3300025910 Bacteria 2670
363 Ga0207684_10144637 3300025910 Bacteria 2045
364 Ga0207684_10170444 3300025910 Bacteria 1876
365 Ga0207684_10175574 3300025910 Bacteria 1847
366 Ga0207684_10477685 3300025910 Bacteria 1069
367 Ga0207684_10521435 3300025910 Bacteria 1018
368 Ga0207684_10584994 3300025910 Bacteria 954
369 Ga0207684_10859738 3300025910 Bacteria 764
370 Ga0207684_11679211 3300025910 Unclassified 512
371 Ga0207654_10466621 3300025911 Unclassified 887
372 Ga0207707_10002190 3300025912 Bacteria 17705
373 Ga0207707_10013716 3300025912 Bacteria 7066
374 Ga0207707_10343585 3300025912 Bacteria 1287
375 Ga0207707_10715437 3300025912 Bacteria 840
376 Ga0207671_10626006 3300025914 Bacteria 857
377 Ga0207693_10589670 3300025915 Bacteria 865
378 Ga0207660_10002204 3300025917 Bacteria 12890
379 Ga0207660_10013508 3300025917 Bacteria 5352
380 Ga0207660_10828298 3300025917 Bacteria 755
381 Ga0207662_10558011 3300025918 Bacteria 794
382 Ga0207657_10012156 3300025919 Bacteria 8505
383 Ga0207657_10020858 3300025919 Bacteria 6184
384 Ga0207649_10005863 3300025920 Bacteria 6658
385 Ga0207652_10010626 3300025921 Bacteria 7412
386 Ga0207652_10222301 3300025921 Bacteria 1701
387 Ga0207652_10757392 3300025921 Bacteria 864
388 Ga0207646_10000018 3300025922 Bacteria 291009
389 Ga0207646_10000092 3300025922 Bacteria 120151
390 Ga0207646_10000111 3300025922 Bacteria 112089
391 Ga0207646_10000119 3300025922 Bacteria 107784
392 Ga0207646_10000682 3300025922 Bacteria 44027
393 Ga0207646_10003471 3300025922 Bacteria 17799
394 Ga0207646_10009428 3300025922 Bacteria 9650
395 Ga0207646_10010041 3300025922 Bacteria 9288
396 Ga0207646_10027316 3300025922 Bacteria 5204
397 Ga0207646_10031187 3300025922 Bacteria 4827
398 Ga0207646_10087604 3300025922 Bacteria 2786
399 Ga0207646_10089308 3300025922 Bacteria 2758
400 Ga0207646_10098019 3300025922 Bacteria 2627
401 Ga0207646_10104617 3300025922 Bacteria 2538
402 Ga0207646_10163235 3300025922 Bacteria 2011
403 Ga0207646_10269280 3300025922 Bacteria 1540
404 Ga0207646_10295842 3300025922 Bacteria 1463
405 Ga0207646_10334691 3300025922 Bacteria 1368
406 Ga0207646_10340067 3300025922 Bacteria 1356
407 Ga0207646_10428188 3300025922 Bacteria 1194
408 Ga0207646_10446186 3300025922 Bacteria 1167
409 Ga0207646_10527001 3300025922 Bacteria 1063
410 Ga0207646_11145456 3300025922 Bacteria 683
411 Ga0207681_10033894 3300025923 Bacteria 3353
412 Ga0207650_10001410 3300025925 Bacteria 17316
413 Ga0207650_10075705 3300025925 Bacteria 2541
414 Ga0207650_11414898 3300025925 Bacteria 592
415 Ga0207659_10303510 3300025926 Bacteria 1312
416 Ga0207687_10733268 3300025927 Bacteria 840
417 Ga0207700_10153195 3300025928 Bacteria 1907
418 Ga0207700_10356018 3300025928 Bacteria 1275
419 Ga0207664_10022585 3300025929 Bacteria 4701
420 Ga0207664_10251404 3300025929 Bacteria 1543
421 Ga0207664_10301435 3300025929 Bacteria 1410
422 Ga0207664_11198930 3300025929 Bacteria 677
423 Ga0207664_11388039 3300025929 Bacteria 623
424 Ga0207664_11405812 3300025929 Bacteria 618
425 Ga0207644_10075079 3300025931 Bacteria 2483
426 Ga0207644_10285280 3300025931 Bacteria 1326
427 Ga0207690_10004342 3300025932 Bacteria 8375
428 Ga0207690_10118564 3300025932 Bacteria 1918
429 Ga0207706_10021568 3300025933 Bacteria 5783
430 Ga0207706_10050893 3300025933 Bacteria 3659
431 Ga0207706_10192997 3300025933 Unclassified 1787
432 Ga0207709_10357702 3300025935 Bacteria 1104
433 Ga0207669_10045397 3300025937 Bacteria 2589
434 Ga0207669_10093061 3300025937 Bacteria 1969
435 Ga0207704_10066635 3300025938 Unclassified 2261
436 Ga0207704_10804172 3300025938 Bacteria 785
437 Ga0207665_10273374 3300025939 Bacteria 1255
438 Ga0207689_10392388 3300025942 Bacteria 1156
439 Ga0207661_10956305 3300025944 Bacteria 789
440 Ga0207679_10002476 3300025945 Bacteria 11368
441 Ga0207679_10135642 3300025945 Bacteria 1981
442 Ga0207679_11558213 3300025945 Bacteria 606
443 Ga0207651_10005755 3300025960 Bacteria 6400
444 Ga0207651_10081071 3300025960 Bacteria 2338
445 Ga0207668_10114928 3300025972 Bacteria 2027
446 Ga0207668_10871843 3300025972 Bacteria 800
447 Ga0207640_10031713 3300025981 Bacteria 3269
448 Ga0207640_10445530 3300025981 Bacteria 1066
449 Ga0207658_10199068 3300025986 Unclassified 1671
450 Ga0207677_10414362 3300026023 Bacteria 1146
451 Ga0207678_10203231 3300026067 Bacteria 1694
452 Ga0207702_10084482 3300026078 Bacteria 2764
453 Ga0207702_10212547 3300026078 Unclassified 1799
454 Ga0207641_10422307 3300026088 Bacteria 1284
455 Ga0207641_11382273 3300026088 Bacteria 705
456 Ga0207648_10940502 3300026089 Bacteria 808
457 Ga0207676_10898302 3300026095 Bacteria 869
458 Ga0207676_11232403 3300026095 Bacteria 742
459 Ga0207674_10408711 3300026116 Bacteria 1312
460 Ga0207675_100399356 3300026118 Bacteria 1354
461 Ga0207675_100573034 3300026118 Bacteria 1130
462 Ga0207683_10043315 3300026121 Bacteria 3934
463 Ga0207683_10078984 3300026121 Bacteria 2917
464 Ga0209973_1052734 3300027252 Bacteria 615
465 Ga0209969_1042766 3300027360 Bacteria 705
466 Ga0210000_1011426 3300027462 Bacteria 1316
467 Ga0209995_1048321 3300027471 Bacteria 721
468 Ga0209968_1005267 3300027526 Bacteria 1943
469 Ga0209982_1007076 3300027552 Bacteria 1639
470 Ga0209970_1040374 3300027614 Unclassified 829
471 Ga0210002_1018880 3300027617 Bacteria 1104
472 Ga0209983_1002852 3300027665 Bacteria 3738
473 Ga0209983_1057095 3300027665 Bacteria 859
474 Ga0209588_1057778 3300027671 Bacteria 1254
475 Ga0209971_1001507 3300027682 Bacteria 5770
476 Ga0209966_1006054 3300027695 Bacteria 2091
477 Ga0209998_10014910 3300027717 Bacteria 1625
478 Ga0209998_10022814 3300027717 Bacteria 1352
479 Ga0209974_10005960 3300027876 Bacteria 4270
480 Ga0209974_10041100 3300027876 Bacteria 1539
481 Ga0207428_10039408 3300027907 Bacteria 3837
482 Ga0207428_10065616 3300027907 Bacteria 2863
483 Ga0268266_11218363 3300028379 Bacteria 728
484 Ga0268265_10874205 3300028380 Bacteria 881
485 Ga0268265_12699834 3300028380 Bacteria 502
486 Ga0265338_10026547 3300028800 Bacteria 5837
487 Ga0265331_10342663 3300031250 Bacteria 669
488 Ga0265327_10003130 3300031251 Bacteria 16263
489 Ga0307408_100245114 3300031548 Bacteria 1475
490 Ga0307408_102103480 3300031548 Unclassified 544
491 Ga0307405_10026434 3300031731 Bacteria 3348
492 Ga0307405_11969826 3300031731 Unclassified 522
493 Ga0307413_10082199 3300031824 Bacteria 2068
494 Ga0307410_10555287 3300031852 Bacteria 952
495 Ga0307407_11065787 3300031903 Unclassified 627
496 Ga0307412_10539487 3300031911 Bacteria 978
497 Ga0307409_100090917 3300031995 Bacteria 2500
498 Ga0307409_100995360 3300031995 Archaea 856
499 Ga0307416_100011524 3300032002 Bacteria 5904
500 Ga0307416_100078632 3300032002 Bacteria 2776
501 Ga0307416_100202134 3300032002 Bacteria 1886
502 Ga0307414_10094263 3300032004 Bacteria 2234
503 Ga0307414_10387643 3300032004 Bacteria 1210
504 Ga0307411_10199956 3300032005 Bacteria 1534
505 Ga0307411_10533557 3300032005 Bacteria 998
506 Ga0307415_100032186 3300032126 Bacteria 3388
507 Ga0307415_100111441 3300032126 Bacteria 2031
508 Ga0373958_0028884 3300034819 Bacteria 1076
509 Ga0373938_0055750 3300034957 Unclassified 913
510 Ga0373926_0087804 3300035083 Bacteria 1154
511 Ga0373928_0234354 3300035084 Bacteria 541
512 Ga0373940_0020277 3300035088 Bacteria 1688
513 Ga0373940_0126973 3300035088 Unclassified 796
514 Ga0373944_0108421 3300035089 Bacteria 945
515 Ga0373949_0197910 3300035090 Bacteria 602
516 Ga0373923_0458010 3300035111 Bacteria 619
517 Ga0373932_0142019 3300035112 Unclassified 817
518 Ga0373939_0073867 3300035114 Unclassified 1117
519 Ga0373941_0017329 3300035115 Bacteria 1972
520 Ga0373945_0056850 3300035116 Bacteria 1452
521 Ga0373943_0054830 3300035170 Bacteria 1973
522 Ga0373942_0062430 3300035207 Bacteria 1070
523 Ga0373961_0283723 3300035241 Bacteria 608
524 Ga0373962_0334058 3300035242 Bacteria 544
525 Ga0373924_0107823 3300035410 Bacteria 1202
526 Ga0373931_0005703 3300035691 Bacteria 5782
527 Ga0373931_0212198 3300035691 Bacteria 1162
528 Ga0373931_0223175 3300035691 Unclassified 1135
529 Ga0373935_0044713 3300035692 Bacteria 2792
530 Ga0373947_0010197 3300035725 Bacteria 5394
531 Ga0373925_0048052 3300037068 Bacteria 3178
532 Ga0395905_0095275 3300037471 Bacteria 2794
533 Ga0395901_0470039 3300038443 Bacteria 1284
534 Ga0242420_023031 3300038996 Bacteria 1123
535 Ga0439466_0180763 3300041411 Unclassified 643
536 Ga0439443_052202 3300042003 Unclassified 718
537 Ga0439448_0038166 3300042005 Bacteria 1546
538 Ga0439432_232332 3300042006 Unclassified 531
539 Ga0439434_0012169 3300042435 Bacteria 2546
540 Ga0439435_0069735 3300042436 Bacteria 1039
541 Ga0439444_0001669 3300042437 Bacteria 2925
542 Ga0451577_0127225 3300042876 Bacteria 2283
543 Ga0466969_0308854 3300044656 Bacteria 716
544 Ga0453683_0000163 3300044673 Bacteria 97466
545 Ga0453684_0000036 3300044712 Bacteria 711481
546 Ga0453684_0035413 3300044712 Bacteria 6900
547 Ga0453684_0209826 3300044712 Bacteria 2265
548 Ga0453684_0372910 3300044712 Bacteria 1604
549 Ga0451576_0004128 3300045051 Bacteria 19154
550 Ga0451576_0196784 3300045051 Bacteria 2105
551 Ga0451576_1065316 3300045051 Bacteria 846
552 Ga0451576_1091224 3300045051 Bacteria 835
553 Ga0451576_1157227 3300045051 Bacteria 808
554 Ga0495603_0176612 3300046455 Bacteria 1236
555 Ga0495629_0167729 3300046459 Bacteria 1525
556 Ga0495580_0154401 3300046472 Bacteria 1590
557 Ga0495580_0286526 3300046472 Bacteria 1123
558 Ga0495594_0825760 3300046499 Bacteria 522
559 Ga0495598_0110989 3300046537 Bacteria 919
560 Ga0495598_0395924 3300046537 Bacteria 539
561 Ga0496101_0721712 3300048904 Bacteria 787
562 Ga0496102_0623374 3300048905 Bacteria 1002
563 Ga0496106_0205398 3300048909 Bacteria 1569
564 Ga0496107_0920414 3300048910 Bacteria 637
565 Ga0496108_0324599 3300048911 Unclassified 1342
566 Ga0496112_0034283 3300048915 Bacteria 4939
567 Ga0496112_0159881 3300048915 Unclassified 2219
568 Ga0496113_1080463 3300048916 Bacteria 630
569 Ga0501291_028213 3300049514 Bacteria 933
570 Ga0501298_081485 3300049521 Unclassified 712
571 Ga0501299_083638 3300049522 Unclassified 713
572 Ga0501039_1295513 3300049575 Unclassified 562
573 Ga0501040_0042164 3300049576 Bacteria 3108
574 Ga0501040_0086783 3300049576 Bacteria 2173
575 Ga0501041_0048893 3300049577 Bacteria 2576
576 Ga0501046_0118052 3300049580 Bacteria 2021
577 Ga0501046_0933658 3300049580 Bacteria 604
578 Ga0501071_0013599 3300049587 Bacteria 5551
579 Ga0501071_0291964 3300049587 Bacteria 1235
580 Ga0501071_1188956 3300049587 Bacteria 589
581 Ga0501072_0099622 3300049588 Bacteria 2310
582 Ga0501072_0810388 3300049588 Bacteria 733
583 Ga0501072_0846222 3300049588 Bacteria 715
584 Ga0501074_0399160 3300049590 Bacteria 975
585 Ga0501075_0038351 3300049591 Bacteria 3581
586 Ga0501075_0414245 3300049591 Bacteria 1027
587 Ga0501075_0812991 3300049591 Bacteria 711
588 Ga0501076_0008462 3300049592 Bacteria 7541
589 Ga0501076_1693134 3300049592 Bacteria 519
590 Ga0501077_0019207 3300049593 Bacteria 4322
591 Ga0501077_0353641 3300049593 Bacteria 938
592 Ga0501079_0175482 3300049741 Bacteria 1671
593 Ga0501080_0341232 3300049742 Bacteria 1354
594 Ga0501081_0012012 3300049743 Bacteria 5676
595 Ga0501081_0084834 3300049743 Bacteria 2222
596 Ga0501081_0406046 3300049743 Unclassified 1009
597 Ga0501081_1423968 3300049743 Bacteria 526
598 Ga0501272_041152 3300049769 Unclassified 617
599 Ga0501273_013461 3300049770 Unclassified 1043
600 Ga0501035_0309636 3300049822 Bacteria 1329
601 Ga0501045_0295707 3300049824 Unclassified 1205
602 Ga0501045_1376228 3300049824 Bacteria 513
603 nmdc:mga05p37_1065956_c1 3300050507 Unclassified 851
604 nmdc:mga05p37_1206437_c1 3300050507 Bacteria 781
605 nmdc:mga05p37_157517_c1 3300050507 Bacteria 2775
606 nmdc:mga05p37_289229_c1 3300050507 Bacteria 1951
607 nmdc:mga05p37_31497_c1 3300050507 Bacteria 6478
608 nmdc:mga05p37_69550_c1 3300050507 Bacteria 4330
609 nmdc:mga09592_104309_c1 3300050508 Bacteria 2430
610 nmdc:mga09592_147125_c1 3300050508 Bacteria 2031
611 nmdc:mga09592_156026_c1 3300050508 Bacteria 1970
612 nmdc:mga09592_784834_c1 3300050508 Bacteria 806
613 nmdc:mga0qj67_665112_c1 3300050509 Bacteria 830
614 nmdc:mga06r32_112139_c1 3300050510 Bacteria 2684
615 nmdc:mga08y16_169221_c1 3300050511 Bacteria 2270
616 nmdc:mga08y16_172977_c1 3300050511 Bacteria 2243
617 nmdc:mga08y16_336701_c1 3300050511 Bacteria 1551
618 nmdc:mga0n895_1014282_c1 3300050512 Bacteria 811
619 nmdc:mga0n895_1115227_c1 3300050512 Bacteria 766
620 nmdc:mga0n895_115781_c1 3300050512 Bacteria 2699
621 nmdc:mga0n895_176355_c1 3300050512 Unclassified 2168
622 nmdc:mga0n895_243882_c1 3300050512 Bacteria 1824
623 nmdc:mga0n895_352083_c1 3300050512 Bacteria 1491
624 nmdc:mga0n895_408730_c1 3300050512 Bacteria 1373
625 nmdc:mga0n895_4591_c1 3300050512 Bacteria 11376
626 nmdc:mga0n895_707231_c1 3300050512 Bacteria 1003
627 nmdc:mga0n895_94347_c1 3300050512 Bacteria 2996
628 nmdc:mga0rr50_1058423_c1 3300050513 Bacteria 691
629 nmdc:mga0rr50_135994_c1 3300050513 Bacteria 1973
630 nmdc:mga0rr50_154307_c1 3300050513 Bacteria 1859
631 nmdc:mga0rr50_177238_c1 3300050513 Unclassified 1741
632 nmdc:mga0rr50_619078_c1 3300050513 Bacteria 923
633 nmdc:mga08x19_109087_c1 3300050514 Bacteria 1845
634 nmdc:mga08x19_1222311_c1 3300050514 Bacteria 533
635 nmdc:mga08x19_1265918_c1 3300050514 Bacteria 523
636 nmdc:mga08x19_257349_c1 3300050514 Unclassified 1206
637 nmdc:mga08x19_258750_c1 3300050514 Bacteria 1203
638 nmdc:mga08x19_26410_c1 3300050514 Unclassified 3623
639 nmdc:mga08x19_29154_c1 3300050514 Bacteria 3461
640 nmdc:mga08x19_413013_c1 3300050514 Bacteria 948
641 nmdc:mga08x19_49221_c1 3300050514 Bacteria 2702
642 nmdc:mga08x19_72168_c1 3300050514 Bacteria 2252
643 nmdc:mga08x19_85351_c1 3300050514 Bacteria 2078
644 nmdc:mga08x19_94619_c1 3300050514 Bacteria 1975
645 nmdc:mga0a205_114767_c1 3300050515 Bacteria 2592
646 nmdc:mga0a205_1287873_c1 3300050515 Bacteria 579
647 nmdc:mga0a205_1456725_c1 3300050515 Bacteria 533
648 nmdc:mga0a205_21722_c1 3300050515 Bacteria 6068
649 nmdc:mga0a205_222503_c1 3300050515 Bacteria 1773
650 nmdc:mga0a205_411087_c1 3300050515 Bacteria 1216
651 nmdc:mga0a205_613456_c1 3300050515 Bacteria 941
652 nmdc:mga0a205_911998_c1 3300050515 Bacteria 725
653 Ga0501084_0081354 3300054114 Bacteria 2717
654 Ga0501084_0774673 3300054114 Bacteria 808
655 Ga0501084_0800665 3300054114 Bacteria 794
656 Ga0590075_006579 3300059424 Bacteria 2754
657 Ga0501082_0028955 3300060353 Bacteria 4771
658 Ga0501082_0183880 3300060353 Bacteria 1818
659 Ga0501082_0189832 3300060353 Unclassified 1788
660 Ga0501082_0544555 3300060353 Bacteria 1015
661 Ga0530510_0032769 3300061734 Bacteria 3740
662 Ga0530510_1139766 3300061734 Unclassified 598
663 Ga0530510_1428446 3300061734 Bacteria 531
664 Ga0070708_100266571
665 MRS1b_contig_5463041
666 ARcpr5yngRDRAFT_c012802
667 ARCol0yngRDRAFT_1010460
668 JGI26145J50221_1005068
669 JGI25405J52794_10011130
670 Ga0065712_10069052
671 Ga0065712_10074379
672 Ga0065715_10001241
673 Ga0065715_10092666
674 Ga0065715_10099890
675 Ga0065715_10337527
676 Ga0065707_10002698
677 Ga0065707_10183002
678 Ga0065707_10302301
679 Ga0065707_10329768
680 Ga0065707_10891789
681 Ga0070658_11402524
682 Ga0070676_10181087
683 Ga0070690_100056129
684 Ga0070690_100066544
685 Ga0070670_100000587
686 Ga0070670_100763108
687 Ga0070677_10034843
688 Ga0068869_100081235
689 Ga0070666_10004865
690 Ga0070666_10030274
691 Ga0070680_100007262
692 Ga0070680_100225875
693 Ga0070680_100236615
694 Ga0070682_100623737
695 Ga0070682_101034488
696 Ga0068868_100239400
697 Ga0070660_100061389
698 Ga0070660_101781765
699 Ga0070689_100179468
700 Ga0070691_10121914
701 Ga0070687_100361242
702 Ga0070661_100014334
703 Ga0070661_100176781
704 Ga0070661_101112452
705 Ga0070668_100634339
706 Ga0070668_100790803
707 Ga0070669_100073219
708 Ga0070669_100897787
709 Ga0070675_100034776
710 Ga0070671_100046125
711 Ga0070671_100085973
712 Ga0070671_100146622
713 Ga0070671_100781108
714 Ga0070674_100508146
715 Ga0070674_101131545
716 Ga0070673_100019677
717 Ga0070673_100048005
718 Ga0070673_102292223
719 Ga0070659_100044904
720 Ga0070659_100710715
721 Ga0070667_100199194
722 Ga0070703_10004526
723 Ga0070703_10095179
724 Ga0070703_10119942
725 Ga0070703_10132107
726 Ga0070709_10362824
727 Ga0070714_100084204
728 Ga0070714_100364382
729 Ga0070714_100905238
730 Ga0070714_101098669
731 Ga0070714_101155813
732 Ga0070714_101757359
733 Ga0070713_100186123
734 Ga0070713_100982643
735 Ga0070705_100001524
736 Ga0070705_100167654
737 Ga0070705_100643766
738 Ga0070705_101324664
739 Ga0070705_101347014
740 Ga0070700_100543301
741 Ga0070694_100049426
742 Ga0070694_100225325
743 Ga0070694_100282063
744 Ga0070694_100325613
745 Ga0070694_101286040
746 Ga0070708_100000008
747 Ga0070708_100030965
748 Ga0070708_100039371
749 Ga0070708_100114863
750 Ga0070708_100118299
751 Ga0070708_100128887
752 Ga0070708_100162279
753 Ga0070708_100495478
754 Ga0070708_100610131
755 Ga0070708_100628271
756 Ga0070708_100762590
757 Ga0070708_101476939
758 Ga0070708_101940314
759 Ga0070663_100413367
760 Ga0070663_101478395
761 Ga0070678_100011018
762 Ga0070678_100029339
763 Ga0070662_100006396
764 Ga0070662_100023210
765 Ga0070662_100127550
766 Ga0070662_101077268
767 Ga0070662_101111788
768 Ga0070681_10000542
769 Ga0070681_10038572
770 Ga0070681_10148929
771 Ga0070681_10889077
772 Ga0068867_100373540
773 Ga0070706_100000157
774 Ga0070706_100000448
775 Ga0070706_100000648
776 Ga0070706_100001738
777 Ga0070706_100001820
778 Ga0070706_100009331
779 Ga0070706_100017262
780 Ga0070706_100034340
781 Ga0070706_100162022
782 Ga0070706_100177754
783 Ga0070706_100204231
784 Ga0070706_100589091
785 Ga0070706_100694604
786 Ga0070706_101253661
787 Ga0070707_100000004
788 Ga0070707_100003251
789 Ga0070707_100021584
790 Ga0070707_100023480
791 Ga0070707_100030830
792 Ga0070707_100126692
793 Ga0070707_100128033
794 Ga0070707_100128265
795 Ga0070707_100128387
796 Ga0070707_100158491
797 Ga0070707_100305089
798 Ga0070707_100318558
799 Ga0070707_100321208
800 Ga0070707_100332185
801 Ga0070707_100418394
802 Ga0070707_100560518
803 Ga0070707_100566108
804 Ga0070707_100676865
805 Ga0070707_100686692
806 Ga0070707_100797082
807 Ga0070707_101276755
808 Ga0070707_101481437
809 Ga0070698_100001828
810 Ga0070698_100009765
811 Ga0070698_100043824
812 Ga0070698_100045049
813 Ga0070698_100166325
814 Ga0070698_100218194
815 Ga0070698_100220066
816 Ga0070698_100266464
817 Ga0070698_100405732
818 Ga0070698_100526528
819 Ga0070698_100534208
820 Ga0070698_100672952
821 Ga0070698_100917849
822 Ga0070698_101429736
823 Ga0070698_101728495
824 Ga0070699_100000006
825 Ga0070699_100000118
826 Ga0070699_100000220
827 Ga0070699_100001853
828 Ga0070699_100010112
829 Ga0070699_100015054
830 Ga0070699_100203777
831 Ga0070699_100234067
832 Ga0070699_100570070
833 Ga0070699_100572818
834 Ga0070699_100593151
835 Ga0070699_100631256
836 Ga0070699_100658790
837 Ga0070699_100663119
838 Ga0070699_100671961
839 Ga0070699_100811133
840 Ga0070699_101339192
841 Ga0070679_100027295
842 Ga0070679_101364986
843 Ga0070679_101484173
844 Ga0070684_100152008
845 Ga0070684_100588540
846 Ga0070697_100000007
847 Ga0070697_100005773
848 Ga0070697_100012612
849 Ga0070697_100047037
850 Ga0070697_100098678
851 Ga0070697_100257717
852 Ga0070697_100286673
853 Ga0070697_100478254
854 Ga0070697_100486097
855 Ga0070697_100917698
856 Ga0070697_101324141
857 Ga0070697_101569475
858 Ga0070697_101852954
859 Ga0070697_101929787
860 Ga0068853_101558151
861 Ga0070672_100305146
862 Ga0070672_100610821
863 Ga0070686_100301600
864 Ga0070686_100450394
865 Ga0070695_100008054
866 Ga0070695_100171960
867 Ga0070695_100312507
868 Ga0070695_100369335
869 Ga0070695_100402442
870 Ga0070695_100994685
871 Ga0070696_100035990
872 Ga0070696_100306945
873 Ga0070696_100555864
874 Ga0070696_101326093
875 Ga0070693_100044820
876 Ga0070693_100247445
877 Ga0070704_100116677
878 Ga0070704_101341776
879 Ga0068855_100929561
880 Ga0070664_100004565
881 Ga0070664_100243856
882 Ga0068854_100208788
883 Ga0068854_100312613
884 Ga0068856_100052132
885 Ga0068856_100251656
886 Ga0068859_100570680
887 Ga0068866_10217762
888 Ga0068866_10585624
889 Ga0068861_100348180
890 Ga0068861_100474190
891 Ga0068863_100978486
892 Ga0068863_101779144
893 Ga0068863_101789084
894 Ga0068862_101750956
895 Ga0068862_102769510
896 Ga0081455_10000067
897 Ga0081455_10109329
898 Ga0081538_10085604
899 Ga0081540_1041783
900 Ga0070717_10000093
901 Ga0070717_10000266
902 Ga0070717_10001892
903 Ga0070717_10005419
904 Ga0070717_10074718
905 Ga0070717_10478934
906 Ga0070717_10605926
907 Ga0070717_11329900
908 Ga0075432_10052780
909 Ga0070716_100177263
910 Ga0070716_100438388
911 Ga0070712_100911494
912 Ga0070712_102023944
913 Ga0068871_101326450
914 Ga0075428_100038847
915 Ga0075428_100451130
916 Ga0075428_101236907
917 Ga0075430_100033781
918 Ga0075431_100133334
919 Ga0075431_100241991
920 Ga0075433_10019560
921 Ga0075433_10054321
922 Ga0075433_10162960
923 Ga0075433_10184095
924 Ga0075433_10696027
925 Ga0075433_10842867
926 Ga0075433_11709631
927 Ga0075434_100004359
928 Ga0075434_100067976
929 Ga0075434_100127315
930 Ga0075434_100181961
931 Ga0075434_100187545
932 Ga0075434_100338749
933 Ga0075434_100629546
934 Ga0075434_100661522
935 Ga0075434_100729248
936 Ga0075434_100825667
937 Ga0075434_101089336
938 Ga0075429_100071618
939 Ga0068865_100118013
940 Ga0068865_100603777
941 Ga0068865_100781222
942 Ga0075436_100013085
943 Ga0075436_100019065
944 Ga0075436_100051562
945 Ga0075436_100167326
946 Ga0075436_100248468
947 Ga0075436_100258111
948 Ga0075436_100299450
949 Ga0075436_100508766
950 Ga0075436_100708665
951 Ga0075436_100812804
952 Ga0075436_101283616
953 Ga0075436_101321466
954 Ga0097620_100570734
955 Ga0075435_100012619
956 Ga0075435_100043604
957 Ga0075435_100056886
958 Ga0075435_100470859
959 Ga0075435_100621081
960 Ga0075435_100657136
961 Ga0075435_101346066
962 Ga0099794_10134553
963 Ga0099794_10178603
964 Ga0099794_10690772
965 Ga0105240_10721451
966 Ga0111539_10079601
967 Ga0111539_10221875
968 Ga0111539_10460563
969 Ga0111539_11375693
970 Ga0105245_10292673
971 Ga0105245_10521419
972 Ga0114129_10037434
973 Ga0114129_10089813
974 Ga0114129_10178929
975 Ga0114129_10201534
976 Ga0114129_10210077
977 Ga0114129_10274290
978 Ga0114129_10600216
979 Ga0114129_11009618
980 Ga0114129_11523515
981 Ga0114129_12043736
982 Ga0105237_11123783
983 Ga0105249_10086597
984 Ga0105249_10361266
985 Ga0105249_12071046
986 Ga0099796_10041362
987 Ga0105239_10742500
988 Ga0105239_11084771
989 Ga0105246_11772656
990 Ga0157338_1083918
991 Ga0157369_12369611
992 Ga0157374_11176951
993 Ga0157378_10012655
994 Ga0157378_10089795
995 Ga0157378_11146137
996 Ga0157378_11796837
997 Ga0157378_12931017
998 Ga0163162_10078365
999 Ga0163162_10238778
1000 Ga0157372_11484667
1001 Ga0157375_11181746
1002 Ga0157375_11333258
1003 Ga0163163_10529840
1004 Ga0157380_10555772
1005 Ga0157376_10154599
1006 Ga0157376_10457607
1007 Ga0163161_10109656
1008 Ga0207697_10019696
1009 Ga0207697_10476763
1010 Ga0207653_10003320
1011 Ga0207653_10100977
1012 Ga0207653_10151069
1013 Ga0207653_10181103
1014 Ga0207682_10063259
1015 Ga0207642_10466594
1016 Ga0207680_10026833
1017 Ga0207699_10113405
1018 Ga0207645_10183713
1019 Ga0207684_10000005
1020 Ga0207684_10000014
1021 Ga0207684_10000027
1022 Ga0207684_10000034
1023 Ga0207684_10000183
1024 Ga0207684_10000212
1025 Ga0207684_10086474
1026 Ga0207684_10144637
1027 Ga0207684_10170444
1028 Ga0207684_10175574
1029 Ga0207684_10477685
1030 Ga0207684_10521435
1031 Ga0207684_10584994
1032 Ga0207684_10859738
1033 Ga0207684_11679211
1034 Ga0207654_10466621
1035 Ga0207707_10002190
1036 Ga0207707_10013716
1037 Ga0207707_10343585
1038 Ga0207707_10715437
1039 Ga0207671_10626006
1040 Ga0207693_10589670
1041 Ga0207660_10002204
1042 Ga0207660_10013508
1043 Ga0207660_10828298
1044 Ga0207662_10558011
1045 Ga0207657_10012156
1046 Ga0207657_10020858
1047 Ga0207649_10005863
1048 Ga0207652_10010626
1049 Ga0207652_10222301
1050 Ga0207652_10757392
1051 Ga0207646_10000018
1052 Ga0207646_10000092
1053 Ga0207646_10000111
1054 Ga0207646_10000119
1055 Ga0207646_10000682
1056 Ga0207646_10003471
1057 Ga0207646_10009428
1058 Ga0207646_10010041
1059 Ga0207646_10027316
1060 Ga0207646_10031187
1061 Ga0207646_10087604
1062 Ga0207646_10089308
1063 Ga0207646_10098019
1064 Ga0207646_10104617
1065 Ga0207646_10163235
1066 Ga0207646_10269280
1067 Ga0207646_10295842
1068 Ga0207646_10334691
1069 Ga0207646_10340067
1070 Ga0207646_10428188
1071 Ga0207646_10446186
1072 Ga0207646_10527001
1073 Ga0207646_11145456
1074 Ga0207681_10033894
1075 Ga0207650_10001410
1076 Ga0207650_10075705
1077 Ga0207650_11414898
1078 Ga0207659_10303510
1079 Ga0207687_10733268
1080 Ga0207700_10153195
1081 Ga0207700_10356018
1082 Ga0207664_10022585
1083 Ga0207664_10251404
1084 Ga0207664_10301435
1085 Ga0207664_11198930
1086 Ga0207664_11388039
1087 Ga0207664_11405812
1088 Ga0207644_10075079
1089 Ga0207644_10285280
1090 Ga0207690_10004342
1091 Ga0207690_10118564
1092 Ga0207706_10021568
1093 Ga0207706_10050893
1094 Ga0207706_10192997
1095 Ga0207709_10357702
1096 Ga0207669_10045397
1097 Ga0207669_10093061
1098 Ga0207704_10066635
1099 Ga0207704_10804172
1100 Ga0207665_10273374
1101 Ga0207689_10392388
1102 Ga0207661_10956305
1103 Ga0207679_10002476
1104 Ga0207679_10135642
1105 Ga0207679_11558213
1106 Ga0207651_10005755
1107 Ga0207651_10081071
1108 Ga0207668_10114928
1109 Ga0207668_10871843
1110 Ga0207640_10031713
1111 Ga0207640_10445530
1112 Ga0207658_10199068
1113 Ga0207677_10414362
1114 Ga0207678_10203231
1115 Ga0207702_10084482
1116 Ga0207702_10212547
1117 Ga0207641_10422307
1118 Ga0207641_11382273
1119 Ga0207648_10940502
1120 Ga0207676_10898302
1121 Ga0207676_11232403
1122 Ga0207674_10408711
1123 Ga0207675_100399356
1124 Ga0207675_100573034
1125 Ga0207683_10043315
1126 Ga0207683_10078984
1127 Ga0209973_1052734
1128 Ga0209969_1042766
1129 Ga0210000_1011426
1130 Ga0209995_1048321
1131 Ga0209968_1005267
1132 Ga0209982_1007076
1133 Ga0209970_1040374
1134 Ga0210002_1018880
1135 Ga0209983_1002852
1136 Ga0209983_1057095
1137 Ga0209588_1057778
1138 Ga0209971_1001507
1139 Ga0209966_1006054
1140 Ga0209998_10014910
1141 Ga0209998_10022814
1142 Ga0209974_10005960
1143 Ga0209974_10041100
1144 Ga0207428_10039408
1145 Ga0207428_10065616
1146 Ga0268266_11218363
1147 Ga0268265_10874205
1148 Ga0268265_12699834
1149 Ga0265338_10026547
1150 Ga0265331_10342663
1151 Ga0265327_10003130
1152 Ga0307408_100245114
1153 Ga0307408_102103480
1154 Ga0307405_10026434
1155 Ga0307405_11969826
1156 Ga0307413_10082199
1157 Ga0307410_10555287
1158 Ga0307407_11065787
1159 Ga0307412_10539487
1160 Ga0307409_100090917
1161 Ga0307409_100995360
1162 Ga0307416_100011524
1163 Ga0307416_100078632
1164 Ga0307416_100202134
1165 Ga0307414_10094263
1166 Ga0307414_10387643
1167 Ga0307411_10199956
1168 Ga0307411_10533557
1169 Ga0307415_100032186
1170 Ga0307415_100111441
1171 Ga0373958_0028884
1172 Ga0373938_0055750
1173 Ga0373926_0087804
1174 Ga0373928_0234354
1175 Ga0373940_0020277
1176 Ga0373940_0126973
1177 Ga0373944_0108421
1178 Ga0373949_0197910
1179 Ga0373923_0458010
1180 Ga0373932_0142019
1181 Ga0373939_0073867
1182 Ga0373941_0017329
1183 Ga0373945_0056850
1184 Ga0373943_0054830
1185 Ga0373942_0062430
1186 Ga0373961_0283723
1187 Ga0373962_0334058
1188 Ga0373924_0107823
1189 Ga0373931_0005703
1190 Ga0373931_0212198
1191 Ga0373931_0223175
1192 Ga0373935_0044713
1193 Ga0373947_0010197
1194 Ga0373925_0048052
1195 Ga0395905_0095275
1196 Ga0395901_0470039
1197 Ga0242420_023031
1198 Ga0439466_0180763
1199 Ga0439443_052202
1200 Ga0439448_0038166
1201 Ga0439432_232332
1202 Ga0439434_0012169
1203 Ga0439435_0069735
1204 Ga0439444_0001669
1205 Ga0451577_0127225
1206 Ga0466969_0308854
1207 Ga0453683_0000163
1208 Ga0453684_0000036
1209 Ga0453684_0035413
1210 Ga0453684_0209826
1211 Ga0453684_0372910
1212 Ga0451576_0004128
1213 Ga0451576_0196784
1214 Ga0451576_1065316
1215 Ga0451576_1091224
1216 Ga0451576_1157227
1217 Ga0495603_0176612
1218 Ga0495629_0167729
1219 Ga0495580_0154401
1220 Ga0495580_0286526
1221 Ga0495594_0825760
1222 Ga0495598_0110989
1223 Ga0495598_0395924
1224 Ga0496101_0721712
1225 Ga0496102_0623374
1226 Ga0496106_0205398
1227 Ga0496107_0920414
1228 Ga0496108_0324599
1229 Ga0496112_0034283
1230 Ga0496112_0159881
1231 Ga0496113_1080463
1232 Ga0501291_028213
1233 Ga0501298_081485
1234 Ga0501299_083638
1235 Ga0501039_1295513
1236 Ga0501040_0042164
1237 Ga0501040_0086783
1238 Ga0501041_0048893
1239 Ga0501046_0118052
1240 Ga0501046_0933658
1241 Ga0501071_0013599
1242 Ga0501071_0291964
1243 Ga0501071_1188956
1244 Ga0501072_0099622
1245 Ga0501072_0810388
1246 Ga0501072_0846222
1247 Ga0501074_0399160
1248 Ga0501075_0038351
1249 Ga0501075_0414245
1250 Ga0501075_0812991
1251 Ga0501076_0008462
1252 Ga0501076_1693134
1253 Ga0501077_0019207
1254 Ga0501077_0353641
1255 Ga0501079_0175482
1256 Ga0501080_0341232
1257 Ga0501081_0012012
1258 Ga0501081_0084834
1259 Ga0501081_0406046
1260 Ga0501081_1423968
1261 Ga0501272_041152
1262 Ga0501273_013461
1263 Ga0501035_0309636
1264 Ga0501045_0295707
1265 Ga0501045_1376228
1266 nmdc:mga05p37_1065956_c1
1267 nmdc:mga05p37_1206437_c1
1268 nmdc:mga05p37_157517_c1
1269 nmdc:mga05p37_289229_c1
1270 nmdc:mga05p37_31497_c1
1271 nmdc:mga05p37_69550_c1
1272 nmdc:mga09592_104309_c1
1273 nmdc:mga09592_147125_c1
1274 nmdc:mga09592_156026_c1
1275 nmdc:mga09592_784834_c1
1276 nmdc:mga0qj67_665112_c1
1277 nmdc:mga06r32_112139_c1
1278 nmdc:mga08y16_169221_c1
1279 nmdc:mga08y16_172977_c1
1280 nmdc:mga08y16_336701_c1
1281 nmdc:mga0n895_1014282_c1
1282 nmdc:mga0n895_1115227_c1
1283 nmdc:mga0n895_115781_c1
1284 nmdc:mga0n895_176355_c1
1285 nmdc:mga0n895_243882_c1
1286 nmdc:mga0n895_352083_c1
1287 nmdc:mga0n895_408730_c1
1288 nmdc:mga0n895_4591_c1
1289 nmdc:mga0n895_707231_c1
1290 nmdc:mga0n895_94347_c1
1291 nmdc:mga0rr50_1058423_c1
1292 nmdc:mga0rr50_135994_c1
1293 nmdc:mga0rr50_154307_c1
1294 nmdc:mga0rr50_177238_c1
1295 nmdc:mga0rr50_619078_c1
1296 nmdc:mga08x19_109087_c1
1297 nmdc:mga08x19_1222311_c1
1298 nmdc:mga08x19_1265918_c1
1299 nmdc:mga08x19_257349_c1
1300 nmdc:mga08x19_258750_c1
1301 nmdc:mga08x19_26410_c1
1302 nmdc:mga08x19_29154_c1
1303 nmdc:mga08x19_413013_c1
1304 nmdc:mga08x19_49221_c1
1305 nmdc:mga08x19_72168_c1
1306 nmdc:mga08x19_85351_c1
1307 nmdc:mga08x19_94619_c1
1308 nmdc:mga0a205_114767_c1
1309 nmdc:mga0a205_1287873_c1
1310 nmdc:mga0a205_1456725_c1
1311 nmdc:mga0a205_21722_c1
1312 nmdc:mga0a205_222503_c1
1313 nmdc:mga0a205_411087_c1
1314 nmdc:mga0a205_613456_c1
1315 nmdc:mga0a205_911998_c1
1316 Ga0501084_0081354
1317 Ga0501084_0774673
1318 Ga0501084_0800665
1319 Ga0590075_006579
1320 Ga0501082_0028955
1321 Ga0501082_0183880
1322 Ga0501082_0189832
1323 Ga0501082_0544555
1324 Ga0530510_0032769
1325 Ga0530510_1139766
1326 Ga0530510_1428446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

20

114

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nci-assembly1.cif.gz_B crystal structure of cdp-chase: vector data collection 0.926 11 42
6nch-assembly1.cif.gz_B crystal structure of cdp-chase: raster data collection 0.9234 11 42
4hfq-assembly1.cif.gz_B crystal structure of udp-x diphosphatase 0.9062 4 48
7q21-assembly1.cif.gz_k iii2-iv2 respiratory supercomplex from corynebacterium glutamicum 0.8514 4 53
6h8k-assembly1.cif.gz_L crystal structure of a variant (q133c in psst) of yarrowia lipolytica complex i 0.8177 9 82
ID Description Score Start End Superfamily
af_P0A6E6_91_134_1.20.5.440 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 0.9294 8 47 1.20.5.440
6nchB01 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9241 11 41 6.10.250.1120
af_I1K550_171_269_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8774 15 55 1.20.58.160
af_Q96M86_1187_1351_1.20.140.100 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Dynein motor heavy chain, linker domain, N-terminal subdomain 0.8616 1 50 1.20.140.100
af_A0A1D6IER6_82_233_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8462 8 52 1.20.140.150
ID Description Score Start End GO Terms
AF-C8XH07-F1-model_v4 Multiple resistance and pH regulation protein F 0.8467 4 78 GO:0005886
GO:0015385
AF-A0A1H2EIT5-F1-model_v4 Multisubunit potassium/proton antiporter, PhaF subunit 0.8456 4 74 GO:0005886
GO:0015385
AF-A0A6L9IPF2-F1-model_v4 Cation:proton antiporter 0.845 4 76 GO:0005886
GO:0015385
AF-A0A3Q8T7R5-F1-model_v4 Cation:proton antiporter 0.8441 3 86 GO:0016020
AF-A0A6B1A7X9-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.8436 1 86 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136

Map