F473512

General Info

Members Datasets Scaffolds Average Seq Length
662 325 658 257

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_0044291|Ga0501079_0044291_624_1520
Length 298
Sequence MNADVVFRALADPTRRGLLDALFRRDGQSLSQLGGRLRMTRFGVMKHLRVLEEAGLVVTRRRGREKLHFLNPVPIRRIHDRWIDKYTEPWAAMLSGLKDDLEGERMEKVFEIYIKTTPERLWQAITEPAMRAKYTFGVGVYSDWTPGSSYQSRTTELNGTAGMPIGEGENLEVDPPRRLVQTFRALWSDEVKGEGFSRVTWEIEPVADSCRLTVTHDQLRAGANDELYGGWPMVLSGLKTLLETGETLTTPGSLMYLAPQPAARRGCRLVTLSAAKGAMSALAPFTSFSGDHEQSGDP

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2643221629 Devosia sp. Root105 Isolate Unclassified
3 2643221662 Devosia sp. Root413D1 Isolate Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
148 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
149 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
150 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
185 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
189 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
232 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
282 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
283 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
284 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
301 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
304 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
308 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
324 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
325 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.22
Metatranscriptomes 3.17
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0
Rhizoplane 4.68
Rhizosphere 90.33
Stem 0
Stem Tuber 0
Unclassified 2.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000359 3300002738 Bacteria 25837
2 JGI25152J39213_1000382 3300002773 Bacteria 27117
3 rootH2_10001322 3300003320 Bacteria 5897
4 rootH1_10026887 3300003323 Bacteria 2982
5 Ga0065707_10137443 3300005295 Bacteria 1820
6 Ga0070683_100008203 3300005329 Bacteria 8871
7 Ga0070683_100121625 3300005329 Bacteria 2466
8 Ga0070680_100053941 3300005336 Bacteria 3282
9 Ga0070682_100000102 3300005337 Bacteria 76457
10 Ga0070682_100053250 3300005337 Bacteria 2536
11 Ga0068868_100480151 3300005338 Bacteria 1085
12 Ga0070692_10206871 3300005345 Bacteria 1153
13 Ga0070668_100019331 3300005347 Bacteria 5127
14 Ga0070669_100004092 3300005353 Bacteria 10567
15 Ga0070675_100004821 3300005354 Bacteria 10290
16 Ga0070675_100044230 3300005354 Bacteria 3642
17 Ga0070675_100376558 3300005354 Bacteria 1263
18 Ga0070673_100421442 3300005364 Bacteria 1197
19 Ga0070659_100063726 3300005366 Bacteria 2916
20 Ga0070714_100000036 3300005435 Bacteria 126916
21 Ga0070714_100000603 3300005435 Bacteria 25692
22 Ga0070714_100190398 3300005435 Bacteria 1872
23 Ga0070714_100475281 3300005435 Bacteria 1189
24 Ga0070713_100021009 3300005436 Bacteria 5012
25 Ga0070713_100231567 3300005436 Bacteria 1679
26 Ga0070713_100367587 3300005436 Bacteria 1337
27 Ga0070710_10011130 3300005437 Bacteria 4437
28 Ga0070701_10215201 3300005438 Bacteria 1143
29 Ga0070711_100010804 3300005439 Bacteria 5662
30 Ga0070711_100017660 3300005439 Bacteria 4545
31 Ga0070711_100061287 3300005439 Bacteria 2618
32 Ga0070711_100126795 3300005439 Bacteria 1896
33 Ga0070705_100002225 3300005440 Bacteria 9855
34 Ga0070705_100476761 3300005440 Bacteria 942
35 Ga0070700_100146364 3300005441 Bacteria 1611
36 Ga0070694_100051461 3300005444 Bacteria 2780
37 Ga0070708_100000432 3300005445 Bacteria 31219
38 Ga0070708_100072392 3300005445 Bacteria 3105
39 Ga0070708_100117158 3300005445 Bacteria 2453
40 Ga0070708_100520803 3300005445 Bacteria 1122
41 Ga0070678_100040753 3300005456 Bacteria 3288
42 Ga0070678_100251233 3300005456 Bacteria 1483
43 Ga0070662_100337106 3300005457 Bacteria 1233
44 Ga0070681_10013783 3300005458 Bacteria 8047
45 Ga0070681_10014858 3300005458 Bacteria 7741
46 Ga0070681_10019064 3300005458 Bacteria 6866
47 Ga0068867_100115694 3300005459 Bacteria 2066
48 Ga0070685_10176207 3300005466 Bacteria 1373
49 Ga0070706_100000637 3300005467 Bacteria 40194
50 Ga0070706_100111320 3300005467 Bacteria 2548
51 Ga0070706_100113674 3300005467 Bacteria 2521
52 Ga0070706_100199875 3300005467 Bacteria 1867
53 Ga0070706_100349498 3300005467 Bacteria 1378
54 Ga0070706_100424266 3300005467 Bacteria 1238
55 Ga0070706_100425837 3300005467 Unclassified 1235
56 Ga0070707_100009328 3300005468 Bacteria 9108
57 Ga0070707_100021602 3300005468 Bacteria 6085
58 Ga0070707_100127244 3300005468 Bacteria 2475
59 Ga0070707_100383151 3300005468 Bacteria 1366
60 Ga0070698_100001223 3300005471 Bacteria 28541
61 Ga0070698_100017096 3300005471 Bacteria 7646
62 Ga0070698_100065938 3300005471 Bacteria 3645
63 Ga0070698_100067092 3300005471 Bacteria 3609
64 Ga0070699_100035593 3300005518 Bacteria 4304
65 Ga0070699_100206218 3300005518 Bacteria 1749
66 Ga0070699_100619927 3300005518 Bacteria 987
67 Ga0070679_100159924 3300005530 Bacteria 2227
68 Ga0070684_100009587 3300005535 Bacteria 7631
69 Ga0070684_100034149 3300005535 Bacteria 4347
70 Ga0070684_100079113 3300005535 Bacteria 2906
71 Ga0070684_100108785 3300005535 Bacteria 2484
72 Ga0070684_100323837 3300005535 Bacteria 1416
73 Ga0070697_100020931 3300005536 Bacteria 5178
74 Ga0070697_100033855 3300005536 Bacteria 4117
75 Ga0070697_100109851 3300005536 Bacteria 2297
76 Ga0070697_100249073 3300005536 Bacteria 1519
77 Ga0070697_100518258 3300005536 Bacteria 1044
78 Ga0070697_100680958 3300005536 Bacteria 907
79 Ga0068853_100706057 3300005539 Bacteria 962
80 Ga0070672_100004568 3300005543 Bacteria 9060
81 Ga0070672_100277926 3300005543 Bacteria 1415
82 Ga0070695_100289147 3300005545 Bacteria 1207
83 Ga0070695_100445968 3300005545 Bacteria 991
84 Ga0070696_100005405 3300005546 Bacteria 8516
85 Ga0070696_100166444 3300005546 Bacteria 1627
86 Ga0070696_100380862 3300005546 Bacteria 1099
87 Ga0070696_100455198 3300005546 Bacteria 1010
88 Ga0070696_100608303 3300005546 Bacteria 882
89 Ga0070693_100012950 3300005547 Bacteria 4236
90 Ga0070665_100024828 3300005548 Bacteria 6039
91 Ga0070704_100192219 3300005549 Bacteria 1641
92 Ga0070704_100472003 3300005549 Bacteria 1084
93 Ga0068855_100141009 3300005563 Bacteria 2748
94 Ga0068857_100284388 3300005577 Bacteria 1522
95 Ga0068854_100186168 3300005578 Bacteria 1625
96 Ga0068856_100113585 3300005614 Bacteria 2706
97 Ga0068856_100179898 3300005614 Bacteria 2127
98 Ga0068864_100000054 3300005618 Bacteria 129210
99 Ga0068864_100109513 3300005618 Bacteria 2459
100 Ga0068864_100685724 3300005618 Bacteria 1000
101 Ga0068861_100129227 3300005719 Bacteria 2049
102 Ga0068858_100001029 3300005842 Bacteria 28784
103 Ga0068860_100779101 3300005843 Bacteria 969
104 Ga0068862_100283228 3300005844 Bacteria 1520
105 Ga0081455_10000308 3300005937 Bacteria 64439
106 Ga0081538_10003657 3300005981 Bacteria 14448
107 Ga0081538_10025024 3300005981 Bacteria 4230
108 Ga0081538_10112930 3300005981 Bacteria 1328
109 Ga0081539_10007281 3300005985 Bacteria 10156
110 Ga0075365_10014932 3300006038 Bacteria 4683
111 Ga0075365_10078922 3300006038 Bacteria 2227
112 Ga0075365_10194837 3300006038 Bacteria 1418
113 Ga0075365_10222185 3300006038 Bacteria 1325
114 Ga0070716_100126228 3300006173 Bacteria 1610
115 Ga0070712_100000005 3300006175 Bacteria 177449
116 Ga0070712_100075449 3300006175 Bacteria 2424
117 Ga0075366_10121788 3300006195 Bacteria 1572
118 Ga0097621_100122017 3300006237 Bacteria 2211
119 Ga0068871_100205470 3300006358 Bacteria 1702
120 Ga0075428_100000018 3300006844 Bacteria 147246
121 Ga0075428_100004380 3300006844 Bacteria 15583
122 Ga0075430_100004543 3300006846 Bacteria 11687
123 Ga0075430_100105653 3300006846 Bacteria 2350
124 Ga0075431_100069197 3300006847 Bacteria 3642
125 Ga0075431_100509143 3300006847 Bacteria 1194
126 Ga0075431_100669242 3300006847 Bacteria 1017
127 Ga0075431_100712296 3300006847 Bacteria 981
128 Ga0075431_100714955 3300006847 Bacteria 979
129 Ga0075433_10157527 3300006852 Bacteria 2020
130 Ga0075433_10312622 3300006852 Bacteria 1390
131 Ga0075434_100038041 3300006871 Bacteria 4765
132 Ga0075434_100062149 3300006871 Bacteria 3717
133 Ga0075434_100271272 3300006871 Bacteria 1716
134 Ga0075434_100431379 3300006871 Bacteria 1339
135 Ga0075429_100023708 3300006880 Bacteria 5325
136 Ga0075429_100031945 3300006880 Bacteria 4577
137 Ga0075436_100001888 3300006914 Bacteria 14395
138 Ga0075436_100043529 3300006914 Bacteria 3095
139 Ga0075436_100425426 3300006914 Bacteria 965
140 Ga0075435_100098975 3300007076 Bacteria 2414
141 Ga0075435_100654650 3300007076 Bacteria 912
142 Ga0099794_10002520 3300007265 Bacteria 6768
143 Ga0099794_10028213 3300007265 Bacteria 2609
144 Ga0099794_10037531 3300007265 Bacteria 2294
145 Ga0105240_10000060 3300009093 Bacteria 219839
146 Ga0111539_10000011 3300009094 Bacteria 356900
147 Ga0111539_10095793 3300009094 Bacteria 3486
148 Ga0111539_10198009 3300009094 Bacteria 2343
149 Ga0111539_10204770 3300009094 Bacteria 2300
150 Ga0105245_10000290 3300009098 Bacteria 47991
151 Ga0105245_10014396 3300009098 Bacteria 6890
152 Ga0105245_10050155 3300009098 Bacteria 3739
153 Ga0105245_10056261 3300009098 Bacteria 3535
154 Ga0105245_10082862 3300009098 Bacteria 2935
155 Ga0105245_10198626 3300009098 Bacteria 1925
156 Ga0105245_10427623 3300009098 Bacteria 1328
157 Ga0114129_10001531 3300009147 Bacteria 31348
158 Ga0114129_10006962 3300009147 Bacteria 16087
159 Ga0114129_10007716 3300009147 Bacteria 15306
160 Ga0114129_10098758 3300009147 Bacteria 4041
161 Ga0114129_10276085 3300009147 Bacteria 2247
162 Ga0114129_10745805 3300009147 Bacteria 1254
163 Ga0105243_10026317 3300009148 Bacteria 4453
164 Ga0105243_10038475 3300009148 Bacteria 3725
165 Ga0105241_10054300 3300009174 Bacteria 3066
166 Ga0105241_10225867 3300009174 Bacteria 1576
167 Ga0105237_10000091 3300009545 Bacteria 122477
168 Ga0105238_10093026 3300009551 Bacteria 3003
169 Ga0105249_10000245 3300009553 Bacteria 60260
170 Ga0105249_10137966 3300009553 Bacteria 2336
171 Ga0105249_10455701 3300009553 Bacteria 1318
172 Ga0105239_10016609 3300010375 Bacteria 8137
173 Ga0105246_10054794 3300011119 Bacteria 2749
174 Ga0105246_10134996 3300011119 Bacteria 1848
175 Ga0157373_10437783 3300013100 Bacteria 940
176 Ga0157369_10129597 3300013105 Bacteria 2673
177 Ga0157374_10302916 3300013296 Bacteria 1581
178 Ga0163162_10465563 3300013306 Bacteria 1396
179 Ga0163162_10607073 3300013306 Bacteria 1220
180 Ga0157375_10000018 3300013308 Bacteria 285123
181 Ga0157380_10000313 3300014326 Bacteria 29351
182 Ga0157380_10009617 3300014326 Bacteria 6933
183 Ga0157380_10874229 3300014326 Unclassified 923
184 Ga0157377_10043297 3300014745 Bacteria 2505
185 Ga0157377_10049076 3300014745 Bacteria 2371
186 Ga0157376_10037100 3300014969 Bacteria 3953
187 Ga0163161_10000058 3300017792 Bacteria 114035
188 Ga0163161_10134451 3300017792 Bacteria 1868
189 Ga0213872_10025369 3300021361 Bacteria 2725
190 Ga0213874_10060482 3300021377 Bacteria 1185
191 Ga0213875_10028692 3300021388 Bacteria 2641
192 Ga0224712_10000993 3300022467 Bacteria 6184
193 Ga0209437_109976 3300025233 Bacteria 1465
194 Ga0209646_1000007 3300025246 Bacteria 670994
195 Ga0209129_1000411 3300025258 Bacteria 33656
196 Ga0209025_1001516 3300025294 Bacteria 29813
197 Ga0207682_10000052 3300025893 Bacteria 49191
198 Ga0207688_10024477 3300025901 Bacteria 3311
199 Ga0207699_10047882 3300025906 Bacteria 2508
200 Ga0207645_10033469 3300025907 Bacteria 3303
201 Ga0207705_10135975 3300025909 Bacteria 1832
202 Ga0207684_10000345 3300025910 Bacteria 64212
203 Ga0207684_10027719 3300025910 Bacteria 4825
204 Ga0207684_10096801 3300025910 Bacteria 2519
205 Ga0207684_10182629 3300025910 Bacteria 1809
206 Ga0207684_10400659 3300025910 Bacteria 1180
207 Ga0207684_10615305 3300025910 Bacteria 927
208 Ga0207707_10059064 3300025912 Bacteria 3336
209 Ga0207707_10225301 3300025912 Bacteria 1632
210 Ga0207695_10000025 3300025913 Bacteria 627211
211 Ga0207671_10000834 3300025914 Bacteria 39135
212 Ga0207693_10000023 3300025915 Bacteria 127876
213 Ga0207693_10002083 3300025915 Bacteria 17484
214 Ga0207693_10014840 3300025915 Bacteria 6258
215 Ga0207693_10410335 3300025915 Bacteria 1059
216 Ga0207663_10007435 3300025916 Bacteria 5679
217 Ga0207663_10085383 3300025916 Bacteria 2078
218 Ga0207663_10169555 3300025916 Bacteria 1549
219 Ga0207660_10045298 3300025917 Bacteria 3098
220 Ga0207662_10108670 3300025918 Bacteria 1727
221 Ga0207657_10004692 3300025919 Bacteria 14422
222 Ga0207646_10079619 3300025922 Bacteria 2929
223 Ga0207646_10186769 3300025922 Bacteria 1872
224 Ga0207646_10198396 3300025922 Bacteria 1812
225 Ga0207681_10005966 3300025923 Bacteria 7474
226 Ga0207681_10351092 3300025923 Bacteria 1181
227 Ga0207659_10088635 3300025926 Bacteria 2305
228 Ga0207659_10092224 3300025926 Bacteria 2264
229 Ga0207687_10000012 3300025927 Bacteria 370729
230 Ga0207687_10001014 3300025927 Bacteria 19081
231 Ga0207687_10014401 3300025927 Bacteria 5174
232 Ga0207687_10099995 3300025927 Bacteria 2132
233 Ga0207687_10132626 3300025927 Bacteria 1880
234 Ga0207687_10310159 3300025927 Bacteria 1274
235 Ga0207700_10021136 3300025928 Bacteria 4436
236 Ga0207664_10000025 3300025929 Bacteria 196804
237 Ga0207664_10007176 3300025929 Bacteria 7723
238 Ga0207664_10011344 3300025929 Bacteria 6327
239 Ga0207664_10115911 3300025929 Bacteria 2234
240 Ga0207664_10128127 3300025929 Bacteria 2133
241 Ga0207664_10157129 3300025929 Bacteria 1937
242 Ga0207664_10169567 3300025929 Bacteria 1867
243 Ga0207706_10101254 3300025933 Bacteria 2534
244 Ga0207686_10480654 3300025934 Bacteria 961
245 Ga0207704_10407376 3300025938 Bacteria 1075
246 Ga0207665_10003333 3300025939 Bacteria 10764
247 Ga0207665_10390617 3300025939 Bacteria 1058
248 Ga0207691_10001294 3300025940 Bacteria 24967
249 Ga0207691_10287043 3300025940 Bacteria 1415
250 Ga0207661_10007703 3300025944 Bacteria 7663
251 Ga0207661_10013885 3300025944 Bacteria 5887
252 Ga0207661_10098561 3300025944 Bacteria 2449
253 Ga0207679_10076756 3300025945 Bacteria 2540
254 Ga0207667_10262010 3300025949 Bacteria 1768
255 Ga0207667_10713197 3300025949 Bacteria 1005
256 Ga0207712_10000086 3300025961 Bacteria 107484
257 Ga0207668_10016834 3300025972 Bacteria 4571
258 Ga0207658_10650491 3300025986 Bacteria 950
259 Ga0207677_10106584 3300026023 Bacteria 2077
260 Ga0207677_10264297 3300026023 Bacteria 1404
261 Ga0207677_10287502 3300026023 Bacteria 1352
262 Ga0207703_10000008 3300026035 Bacteria 373718
263 Ga0207708_10085252 3300026075 Bacteria 2430
264 Ga0207708_10156010 3300026075 Bacteria 1800
265 Ga0207708_10194053 3300026075 Bacteria 1618
266 Ga0207702_10011951 3300026078 Bacteria 7222
267 Ga0207702_10053276 3300026078 Bacteria 3425
268 Ga0207648_10032468 3300026089 Bacteria 4609
269 Ga0207676_10000028 3300026095 Bacteria 237195
270 Ga0207676_10018963 3300026095 Bacteria 5011
271 Ga0207674_10322895 3300026116 Bacteria 1493
272 Ga0207675_100011334 3300026118 Bacteria 8343
273 Ga0207675_100029085 3300026118 Bacteria 5149
274 Ga0207675_100080712 3300026118 Bacteria 3050
275 Ga0207683_10012451 3300026121 Bacteria 7260
276 Ga0209588_1019632 3300027671 Bacteria 2111
277 Ga0209588_1040685 3300027671 Bacteria 1500
278 Ga0209588_1053589 3300027671 Bacteria 1305
279 Ga0207428_10000023 3300027907 Bacteria 272062
280 Ga0268266_10000255 3300028379 Bacteria 89930
281 Ga0268265_10148830 3300028380 Bacteria 1972
282 Ga0268264_10475479 3300028381 Bacteria 1215
283 Ga0265326_10000005 3300028558 Bacteria 257124
284 Ga0265334_10000024 3300028573 Bacteria 118525
285 Ga0265322_10015429 3300028654 Bacteria 2208
286 Ga0265322_10031122 3300028654 Bacteria 1523
287 Ga0265336_10017322 3300028666 Bacteria 2347
288 Ga0265338_10002712 3300028800 Bacteria 25982
289 Ga0265338_10146720 3300028800 Bacteria 1839
290 Ga0265324_10002813 3300029957 Bacteria 8585
291 Ga0265340_10153700 3300031247 Bacteria 1048
292 Ga0265327_10164329 3300031251 Bacteria 1023
293 Ga0265316_10068062 3300031344 Bacteria 2752
294 Ga0307408_100262507 3300031548 Bacteria 1430
295 Ga0316575_10088583 3300031665 Bacteria 1252
296 Ga0307405_10360279 3300031731 Bacteria 1125
297 Ga0307413_10277458 3300031824 Bacteria 1258
298 Ga0307410_10135271 3300031852 Bacteria 1816
299 Ga0307410_10277296 3300031852 Bacteria 1314
300 Ga0307406_10073881 3300031901 Bacteria 2243
301 Ga0307407_10049087 3300031903 Bacteria 2407
302 Ga0307407_10176745 3300031903 Bacteria 1411
303 Ga0307407_10197494 3300031903 Bacteria 1345
304 Ga0307409_100018828 3300031995 Bacteria 4657
305 Ga0307409_100023420 3300031995 Bacteria 4279
306 Ga0307409_100077675 3300031995 Bacteria 2668
307 Ga0307409_100131301 3300031995 Bacteria 2141
308 Ga0307409_100198410 3300031995 Bacteria 1793
309 Ga0307409_100245993 3300031995 Bacteria 1632
310 Ga0307409_100325375 3300031995 Bacteria 1440
311 Ga0307416_100068182 3300032002 Bacteria 2938
312 Ga0307416_100112172 3300032002 Bacteria 2406
313 Ga0307416_100130461 3300032002 Bacteria 2261
314 Ga0307416_100331833 3300032002 Bacteria 1529
315 Ga0307416_100417986 3300032002 Bacteria 1384
316 Ga0307416_101345268 3300032002 Bacteria 820
317 Ga0307414_10017237 3300032004 Bacteria 4414
318 Ga0307414_10074782 3300032004 Bacteria 2456
319 Ga0307411_10054261 3300032005 Bacteria 2630
320 Ga0307411_10156712 3300032005 Bacteria 1700
321 Ga0307415_100000192 3300032126 Bacteria 27217
322 Ga0307415_100042956 3300032126 Bacteria 3012
323 Ga0307415_100287670 3300032126 Bacteria 1355
324 Ga0307507_10037296 3300033179 Bacteria 4949
325 Ga0373953_0010641 3300035117 Bacteria 3209
326 Ga0373954_0159547 3300035118 Bacteria 1103
327 Ga0373946_0135982 3300035171 Bacteria 1135
328 Ga0373924_0089775 3300035410 Bacteria 1314
329 Ga0373935_0396958 3300035692 Bacteria 990
330 Ga0373927_0000103 3300035695 Bacteria 64324
331 Ga0373933_0095294 3300035724 Bacteria 1841
332 Ga0373937_0179371 3300036401 Bacteria 1988
333 Ga0373937_0699043 3300036401 Bacteria 960
334 Ga0373925_0000189 3300037068 Bacteria 67044
335 Ga0373925_0038619 3300037068 Bacteria 3530
336 Ga0395899_0002389 3300037312 Bacteria 15244
337 Ga0395899_0006629 3300037312 Bacteria 8974
338 Ga0395899_0035886 3300037312 Bacteria 3720
339 Ga0395899_0184937 3300037312 Bacteria 1461
340 Ga0395899_0379779 3300037312 Bacteria 939
341 Ga0395900_0001337 3300037418 Bacteria 29786
342 Ga0395900_0009229 3300037418 Bacteria 10114
343 Ga0395900_0010103 3300037418 Bacteria 9653
344 Ga0395900_0044122 3300037418 Bacteria 4595
345 Ga0395900_0080249 3300037418 Bacteria 3353
346 Ga0395900_0288563 3300037418 Bacteria 1630
347 Ga0395900_0630934 3300037418 Bacteria 1010
348 Ga0395898_0009520 3300037466 Bacteria 10200
349 Ga0395898_0053883 3300037466 Bacteria 3927
350 Ga0395898_0075241 3300037466 Bacteria 3262
351 Ga0395898_0084041 3300037466 Bacteria 3068
352 Ga0395898_0156957 3300037466 Bacteria 2176
353 Ga0395898_0210912 3300037466 Bacteria 1853
354 Ga0395898_0362231 3300037466 Bacteria 1382
355 Ga0395898_0657835 3300037466 Bacteria 990
356 Ga0395898_0802437 3300037466 Bacteria 881
357 Ga0395905_0002146 3300037471 Bacteria 22374
358 Ga0395905_0059446 3300037471 Bacteria 3573
359 Ga0395905_0089298 3300037471 Bacteria 2888
360 Ga0395905_0190871 3300037471 Bacteria 1922
361 Ga0395905_0197276 3300037471 Bacteria 1887
362 Ga0436364_0631327 3300037853 Bacteria 4713
363 Ga0395901_0004872 3300038443 Bacteria 13549
364 Ga0395901_0019380 3300038443 Bacteria 6956
365 Ga0395901_0021273 3300038443 Bacteria 6644
366 Ga0395901_0075799 3300038443 Bacteria 3509
367 Ga0395901_0128148 3300038443 Bacteria 2667
368 Ga0395901_0182454 3300038443 Bacteria 2201
369 Ga0395901_0203162 3300038443 Bacteria 2077
370 Ga0395901_0220521 3300038443 Bacteria 1982
371 Ga0395901_0360309 3300038443 Bacteria 1499
372 Ga0395901_0376943 3300038443 Bacteria 1461
373 Ga0242420_015509 3300038996 Bacteria 1318
374 Ga0400483_021893 3300039062 Bacteria 7026
375 Ga0400483_208345 3300039062 Bacteria 3493
376 Ga0436361_0844713 3300039447 Bacteria 12707
377 Ga0436363_0173701 3300039450 Bacteria 1595
378 Ga0439465_0047967 3300041413 Bacteria 1393
379 Ga0451802_0557563 3300041460 Bacteria 828
380 Ga0451853_1119736 3300041512 Bacteria 2433
381 Ga0450923_039893 3300042125 Bacteria 984
382 Ga0466969_0029913 3300044656 Bacteria 2778
383 Ga0466972_0101530 3300044658 Bacteria 1361
384 Ga0453683_0007472 3300044673 Bacteria 7410
385 Ga0453683_0012508 3300044673 Bacteria 5562
386 Ga0453683_0013146 3300044673 Bacteria 5412
387 Ga0453683_0026109 3300044673 Unclassified 3710
388 Ga0466965_0041608 3300044683 Bacteria 2264
389 Ga0466961_0242917 3300044693 Bacteria 1106
390 Ga0466961_0290833 3300044693 Bacteria 999
391 Ga0466968_0125363 3300044735 Bacteria 1165
392 Ga0466970_0033719 3300044765 Bacteria 2707
393 Ga0466957_0360466 3300044842 Unclassified 988
394 Ga0466960_0001117 3300044901 Bacteria 9644
395 Ga0466960_0162255 3300044901 Bacteria 1201
396 Ga0466959_0028049 3300045049 Bacteria 4175
397 Ga0451576_0501226 3300045051 Bacteria 1276
398 Ga0466958_0334004 3300045836 Bacteria 975
399 Ga0466958_0400604 3300045836 Bacteria 886
400 Ga0466967_0032329 3300045976 Bacteria 4417
401 Ga0466967_0087031 3300045976 Bacteria 2832
402 Ga0466967_0427369 3300045976 Bacteria 1292
403 Ga0466967_0546922 3300045976 Bacteria 1139
404 Ga0466967_0851189 3300045976 Bacteria 906
405 Ga0495592_0000621 3300046454 Bacteria 24971
406 Ga0495651_0129888 3300046462 Bacteria 1840
407 Ga0495651_0350706 3300046462 Bacteria 975
408 Ga0495653_0038045 3300046463 Bacteria 3777
409 Ga0495580_0333428 3300046472 Bacteria 1030
410 Ga0495582_0187898 3300046473 Bacteria 1178
411 Ga0495582_0305518 3300046473 Bacteria 915
412 Ga0495605_0009386 3300046474 Bacteria 5496
413 Ga0495664_0071725 3300046477 Bacteria 2069
414 Ga0495608_0000406 3300046511 Bacteria 30178
415 Ga0495616_0003806 3300046513 Bacteria 9616
416 Ga0495618_0000068 3300046514 Bacteria 74614
417 Ga0495620_0000315 3300046515 Bacteria 34463
418 Ga0495628_0005324 3300046516 Bacteria 11286
419 Ga0495628_0169083 3300046516 Bacteria 1658
420 Ga0495628_0489227 3300046516 Bacteria 890
421 Ga0495630_0001197 3300046517 Bacteria 17900
422 Ga0495644_0000954 3300046523 Bacteria 11954
423 Ga0495644_0108839 3300046523 Bacteria 1051
424 Ga0495652_0425109 3300046529 Bacteria 935
425 Ga0495640_0021376 3300046533 Bacteria 4750
426 Ga0495609_0000002 3300046538 Bacteria 739816
427 Ga0495667_0019918 3300046559 Bacteria 4526
428 Ga0495668_0143676 3300046616 Bacteria 1306
429 Ga0495634_0192731 3300046642 Bacteria 1270
430 Ga0495635_0000009 3300046663 Bacteria 259024
431 Ga0495635_0021925 3300046663 Bacteria 4451
432 Ga0495661_0000281 3300046665 Bacteria 57922
433 Ga0495657_0037476 3300046675 Bacteria 3342
434 Ga0495599_0231041 3300046678 Bacteria 1129
435 Ga0495658_0301734 3300046683 Bacteria 1013
436 Ga0495613_0000249 3300046689 Bacteria 50975
437 Ga0495613_0121706 3300046689 Bacteria 1874
438 Ga0495624_0010426 3300046690 Bacteria 6407
439 Ga0495589_0000230 3300046794 Bacteria 47199
440 Ga0495600_0154022 3300046809 Bacteria 1487
441 Ga0495604_0141683 3300047317 Bacteria 1717
442 Ga0495676_0544181 3300047321 Bacteria 759
443 Ga0495680_0000023 3300047322 Bacteria 116444
444 Ga0495680_0016552 3300047322 Bacteria 6330
445 Ga0495680_0344796 3300047322 Bacteria 1038
446 Ga0495680_0441766 3300047322 Bacteria 892
447 Ga0495683_0221163 3300047323 Bacteria 844
448 Ga0495687_000013 3300047443 Bacteria 371058
449 Ga0495677_0000041 3300047445 Bacteria 75366
450 Ga0495684_0281190 3300047471 Bacteria 1200
451 Ga0495684_0436473 3300047471 Bacteria 913
452 Ga0495626_0000383 3300048091 Bacteria 45903
453 Ga0496100_0000016 3300048903 Bacteria 166058
454 Ga0496100_0220710 3300048903 Bacteria 1391
455 Ga0496101_0000038 3300048904 Bacteria 166058
456 Ga0496101_0039180 3300048904 Bacteria 3369
457 Ga0496102_0004878 3300048905 Bacteria 11355
458 Ga0496102_0042030 3300048905 Bacteria 4142
459 Ga0496102_0082310 3300048905 Bacteria 2968
460 Ga0496103_0004524 3300048906 Bacteria 8424
461 Ga0496104_0004192 3300048907 Bacteria 12522
462 Ga0496104_0075882 3300048907 Bacteria 3201
463 Ga0496104_0550614 3300048907 Bacteria 1064
464 Ga0496105_0005312 3300048908 Bacteria 9765
465 Ga0496105_0015556 3300048908 Bacteria 6066
466 Ga0496106_0000027 3300048909 Bacteria 149560
467 Ga0496107_0000003 3300048910 Bacteria 304038
468 Ga0496107_0146109 3300048910 Bacteria 1749
469 Ga0496108_0000002 3300048911 Bacteria 700890
470 Ga0496108_0054249 3300048911 Bacteria 3364
471 Ga0496108_0222032 3300048911 Bacteria 1642
472 Ga0496109_0000001 3300048912 Bacteria 700852
473 Ga0496109_0043704 3300048912 Bacteria 4062
474 Ga0496109_0187341 3300048912 Bacteria 1944
475 Ga0496111_0302283 3300048914 Bacteria 1186
476 Ga0496112_0000865 3300048915 Bacteria 21683
477 Ga0496112_0105281 3300048915 Bacteria 2791
478 Ga0496112_0112407 3300048915 Bacteria 2694
479 Ga0496112_0243873 3300048915 Bacteria 1749
480 Ga0496112_0305973 3300048915 Bacteria 1535
481 Ga0496113_0003035 3300048916 Bacteria 9939
482 Ga0496114_0009726 3300048917 Bacteria 7639
483 Ga0496121_0017804 3300048924 Bacteria 7217
484 Ga0496121_0211530 3300048924 Bacteria 1373
485 Ga0496122_0007704 3300048925 Bacteria 11865
486 Ga0496123_0048992 3300048926 Bacteria 2837
487 Ga0496124_0035218 3300048927 Bacteria 4382
488 Ga0501031_0020801 3300049568 Bacteria 4278
489 Ga0501031_0050009 3300049568 Bacteria 2724
490 Ga0501031_0126379 3300049568 Bacteria 1670
491 Ga0501031_0129180 3300049568 Bacteria 1650
492 Ga0501031_0137008 3300049568 Bacteria 1599
493 Ga0501032_0038454 3300049569 Bacteria 3259
494 Ga0501032_0146400 3300049569 Bacteria 1555
495 Ga0501032_0190051 3300049569 Bacteria 1342
496 Ga0501033_0154130 3300049570 Bacteria 1656
497 Ga0501033_0193866 3300049570 Bacteria 1453
498 Ga0501033_0408664 3300049570 Bacteria 946
499 Ga0501034_0004370 3300049571 Bacteria 15752
500 Ga0501034_0032768 3300049571 Bacteria 5276
501 Ga0501034_0091981 3300049571 Bacteria 3031
502 Ga0501034_0315504 3300049571 Bacteria 1497
503 Ga0501034_0375683 3300049571 Bacteria 1347
504 Ga0501034_0392963 3300049571 Bacteria 1311
505 Ga0501034_0437014 3300049571 Bacteria 1228
506 Ga0501034_0464813 3300049571 Bacteria 1182
507 Ga0501034_0829253 3300049571 Bacteria 816
508 Ga0501036_0001738 3300049572 Bacteria 16914
509 Ga0501036_0020590 3300049572 Bacteria 5540
510 Ga0501036_0404721 3300049572 Bacteria 1138
511 Ga0501037_0068237 3300049573 Bacteria 2589
512 Ga0501038_0217408 3300049574 Bacteria 1526
513 Ga0501038_0274569 3300049574 Bacteria 1328
514 Ga0501038_0277988 3300049574 Bacteria 1319
515 Ga0501038_0450616 3300049574 Bacteria 989
516 Ga0501039_0045845 3300049575 Bacteria 3378
517 Ga0501039_0048602 3300049575 Bacteria 3279
518 Ga0501039_0262560 3300049575 Bacteria 1357
519 Ga0501039_0346725 3300049575 Bacteria 1167
520 Ga0501039_0382561 3300049575 Bacteria 1105
521 Ga0501039_0510185 3300049575 Bacteria 944
522 Ga0501040_0002511 3300049576 Bacteria 11815
523 Ga0501040_0042838 3300049576 Bacteria 3084
524 Ga0501040_0088595 3300049576 Bacteria 2149
525 Ga0501041_0001860 3300049577 Bacteria 11813
526 Ga0501041_0045642 3300049577 Bacteria 2664
527 Ga0501041_0145441 3300049577 Bacteria 1479
528 Ga0501041_0190116 3300049577 Bacteria 1286
529 Ga0501042_0016718 3300049578 Bacteria 5043
530 Ga0501042_0110376 3300049578 Bacteria 1981
531 Ga0501042_0206628 3300049578 Bacteria 1416
532 Ga0501042_0252502 3300049578 Bacteria 1272
533 Ga0501042_0258736 3300049578 Bacteria 1256
534 Ga0501046_0007642 3300049580 Bacteria 9484
535 Ga0501047_0670830 3300049581 Bacteria 855
536 Ga0501048_0006497 3300049582 Bacteria 8886
537 Ga0501048_0018852 3300049582 Bacteria 5072
538 Ga0501048_0044915 3300049582 Bacteria 3157
539 Ga0501068_0018481 3300049584 Bacteria 4036
540 Ga0501069_0002990 3300049585 Bacteria 8709
541 Ga0501070_0024213 3300049586 Bacteria 5091
542 Ga0501070_0142423 3300049586 Bacteria 1979
543 Ga0501070_0369583 3300049586 Bacteria 1162
544 Ga0501070_0441524 3300049586 Bacteria 1050
545 Ga0501070_0605217 3300049586 Bacteria 873
546 Ga0501071_0000625 3300049587 Bacteria 18359
547 Ga0501071_0001478 3300049587 Bacteria 13670
548 Ga0501071_0170767 3300049587 Bacteria 1628
549 Ga0501072_0000386 3300049588 Bacteria 31596
550 Ga0501072_0002715 3300049588 Bacteria 13289
551 Ga0501072_0003405 3300049588 Bacteria 11975
552 Ga0501072_0032612 3300049588 Bacteria 4080
553 Ga0501072_0067133 3300049588 Bacteria 2830
554 Ga0501073_0016136 3300049589 Bacteria 5414
555 Ga0501074_0003903 3300049590 Bacteria 10622
556 Ga0501074_0047691 3300049590 Bacteria 3096
557 Ga0501074_0338868 3300049590 Bacteria 1067
558 Ga0501075_0002467 3300049591 Bacteria 12329
559 Ga0501075_0082016 3300049591 Bacteria 2442
560 Ga0501075_0144662 3300049591 Bacteria 1812
561 Ga0501075_0161922 3300049591 Bacteria 1707
562 Ga0501075_0197673 3300049591 Bacteria 1533
563 Ga0501075_0282508 3300049591 Bacteria 1265
564 Ga0501076_0001538 3300049592 Bacteria 15449
565 Ga0501076_0004911 3300049592 Bacteria 9569
566 Ga0501076_0022847 3300049592 Bacteria 4812
567 Ga0501076_0054181 3300049592 Bacteria 3178
568 Ga0501076_0128469 3300049592 Bacteria 2054
569 Ga0501076_0242484 3300049592 Bacteria 1475
570 Ga0501076_0412852 3300049592 Bacteria 1110
571 Ga0501077_0001046 3300049593 Bacteria 16700
572 Ga0501077_0014506 3300049593 Bacteria 4952
573 Ga0501077_0250064 3300049593 Bacteria 1127
574 Ga0501079_0001142 3300049741 Bacteria 18543
575 Ga0501079_0044291 3300049741 Bacteria 3434
576 Ga0501079_0231157 3300049741 Bacteria 1444
577 Ga0501079_0295867 3300049741 Bacteria 1266
578 Ga0501080_0000913 3300049742 Bacteria 24164
579 Ga0501080_0059538 3300049742 Bacteria 3554
580 Ga0501080_0134152 3300049742 Bacteria 2292
581 Ga0501081_0004652 3300049743 Bacteria 8823
582 Ga0501081_0032354 3300049743 Bacteria 3548
583 Ga0501081_0037058 3300049743 Bacteria 3327
584 Ga0501081_0128457 3300049743 Bacteria 1809
585 Ga0501081_0168946 3300049743 Bacteria 1578
586 Ga0501083_0069809 3300049744 Bacteria 2338
587 Ga0501083_0329021 3300049744 Bacteria 994
588 Ga0501268_041896 3300049765 Bacteria 864
589 Ga0501035_0028544 3300049822 Bacteria 5093
590 Ga0501035_0092270 3300049822 Bacteria 2665
591 Ga0501035_0121332 3300049822 Bacteria 2284
592 Ga0501035_0340064 3300049822 Bacteria 1258
593 Ga0501045_0001817 3300049824 Bacteria 14417
594 Ga0501045_0043638 3300049824 Bacteria 3266
595 Ga0501045_0077048 3300049824 Bacteria 2457
596 Ga0501045_0160457 3300049824 Bacteria 1673
597 nmdc:mga0yw44_10101_c1 3300050492 Bacteria 4806
598 nmdc:mga0yw44_150642_c1 3300050492 Bacteria 1517
599 nmdc:mga05p37_15530_c1 3300050507 Bacteria 9153
600 nmdc:mga05p37_221961_c1 3300050507 Bacteria 2280
601 nmdc:mga05p37_26018_c1 3300050507 Bacteria 7114
602 nmdc:mga05p37_301741_c1 3300050507 Bacteria 1902
603 nmdc:mga05p37_309164_c1 3300050507 Bacteria 1874
604 nmdc:mga05p37_425_c1 3300050507 Bacteria 45660
605 nmdc:mga05p37_860988_c1 3300050507 Bacteria 983
606 nmdc:mga09592_109993_c1 3300050508 Bacteria 2364
607 nmdc:mga09592_222728_c1 3300050508 Bacteria 1634
608 nmdc:mga09592_5791_c1 3300050508 Bacteria 10077
609 nmdc:mga0qj67_456876_c1 3300050509 Bacteria 1028
610 nmdc:mga0qj67_72633_c1 3300050509 Bacteria 2747
611 nmdc:mga0qj67_82225_c1 3300050509 Bacteria 2583
612 nmdc:mga06r32_225329_c1 3300050510 Bacteria 1863
613 nmdc:mga06r32_340846_c1 3300050510 Bacteria 1484
614 nmdc:mga06r32_754462_c1 3300050510 Bacteria 936
615 nmdc:mga08y16_12_c1 3300050511 Bacteria 438455
616 nmdc:mga08y16_77303_c1 3300050511 Bacteria 3470
617 nmdc:mga0n895_343776_c1 3300050512 Bacteria 1511
618 nmdc:mga0n895_79740_c1 3300050512 Bacteria 3261
619 nmdc:mga08x19_271_c1 3300050514 Bacteria 39236
620 nmdc:mga0a205_104623_c1 3300050515 Bacteria 2730
621 Ga0495601_0007009 3300053077 Bacteria 6604
622 Ga0495595_0000109 3300053084 Bacteria 37617
623 Ga0495619_0000507 3300053085 Bacteria 25923
624 Ga0495619_0006443 3300053085 Bacteria 7431
625 Ga0495619_0366658 3300053085 Bacteria 996
626 Ga0500566_0000485 3300053094 Bacteria 22158
627 Ga0500568_0000023 3300053139 Bacteria 176763
628 Ga0500616_0012886 3300053153 Bacteria 4874
629 Ga0501084_0010731 3300054114 Bacteria 7584
630 Ga0501084_0018018 3300054114 Bacteria 5880
631 Ga0501084_0055867 3300054114 Bacteria 3304
632 Ga0590075_010220 3300059424 Bacteria 2258
633 Ga0587066_003568 3300059490 Bacteria 1841
634 Ga0587066_039218 3300059490 Bacteria 885
635 Ga0587073_0006032 3300059492 Bacteria 1842
636 Ga0587083_0030674 3300059505 Bacteria 1068
637 Ga0587088_006433 3300059508 Bacteria 1585
638 Ga0587090_003437 3300059510 Bacteria 1840
639 Ga0587091_006150 3300059511 Bacteria 1673
640 Ga0587094_002452 3300059513 Bacteria 1924
641 Ga0587113_004512 3300059625 Bacteria 1111
642 Ga0587115_002426 3300059626 Bacteria 1853
643 Ga0587067_003434 3300059640 Bacteria 1979
644 Ga0587072_028080 3300059643 Bacteria 1036
645 Ga0587075_002953 3300059644 Bacteria 1852
646 Ga0587076_006926 3300059645 Bacteria 1530
647 Ga0587079_004079 3300059647 Bacteria 1959
648 Ga0587079_012111 3300059647 Bacteria 1402
649 Ga0587079_028100 3300059647 Bacteria 1063
650 Ga0587079_032495 3300059647 Bacteria 1011
651 Ga0587071_005131 3300060344 Bacteria 1989
652 Ga0587071_053299 3300060344 Bacteria 842
653 Ga0501082_0011025 3300060353 Bacteria 7773
654 Ga0501082_0034466 3300060353 Bacteria 4364
655 Ga0501082_0206629 3300060353 Bacteria 1708
656 Ga0530510_0028327 3300061734 Bacteria 4016
657 Ga0530510_0302652 3300061734 Bacteria 1196
658 Ga0530510_0416483 3300061734 Bacteria 1014

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0042030 Ga0496102_0042030_21_650 192
2 3300047321 Ga0495676_0544181 Ga0495676_0544181_103_747 198
3 3300037312 Ga0395899_0379779 Ga0395899_0379779_25_690 200
4 3300049743 Ga0501081_0037058 Ga0501081_0037058_2615_3280 204
5 3300049744 Ga0501083_0329021 Ga0501083_0329021_40_705 204
6 3300047323 Ga0495683_0221163 Ga0495683_0221163_11_637 207
7 3300059644 Ga0587075_002953 Ga0587075_002953_556_1242 207
8 3300005618 Ga0068864_100109513 Ga0068864_1001095133 212
9 3300026095 Ga0207676_10018963 Ga0207676_100189633 212
10 3300005354 Ga0070675_100004821 Ga0070675_1000048214 214
11 3300005543 Ga0070672_100277926 Ga0070672_1002779263 214
12 3300025926 Ga0207659_10092224 Ga0207659_100922242 214
13 3300025940 Ga0207691_10287043 Ga0207691_102870432 214
14 3300006358 Ga0068871_100205470 Ga0068871_1002054702 215
15 3300014326 Ga0157380_10874229 Ga0157380_108742291 218
16 3300005445 Ga0070708_100520803 Ga0070708_1005208031 220
17 3300035117 Ga0373953_0010641 Ga0373953_0010641_344_1072 220
18 3300049765 Ga0501268_041896 Ga0501268_041896_99_842 220
19 3300053085 Ga0495619_0366658 Ga0495619_0366658_252_983 220
20 3300005466 Ga0070685_10176207 Ga0070685_101762072 221
21 3300048908 Ga0496105_0015556 Ga0496105_0015556_3342_4064 221
22 3300005435 Ga0070714_100190398 Ga0070714_1001903982 223
23 3300005436 Ga0070713_100367587 Ga0070713_1003675872 223
24 3300005439 Ga0070711_100061287 Ga0070711_1000612872 223
25 3300005471 Ga0070698_100017096 Ga0070698_1000170964 223
26 3300005536 Ga0070697_100109851 Ga0070697_1001098512 223
27 3300005546 Ga0070696_100166444 Ga0070696_1001664442 223
28 3300025915 Ga0207693_10014840 Ga0207693_100148407 223
29 3300025916 Ga0207663_10169555 Ga0207663_101695552 223
30 3300025922 Ga0207646_10198396 Ga0207646_101983962 223
31 3300025929 Ga0207664_10115911 Ga0207664_101159112 223
32 3300025939 Ga0207665_10003333 Ga0207665_1000333315 223
33 3300046517 Ga0495630_0001197 Ga0495630_0001197_12370_13098 223
34 3300046642 Ga0495634_0192731 Ga0495634_0192731_466_1194 223
35 3300046675 Ga0495657_0037476 Ga0495657_0037476_1494_2222 223
36 3300046689 Ga0495613_0121706 Ga0495613_0121706_717_1445 223
37 3300048911 Ga0496108_0054249 Ga0496108_0054249_2405_3151 223
38 3300048912 Ga0496109_0187341 Ga0496109_0187341_270_1016 223
39 3300048914 Ga0496111_0302283 Ga0496111_0302283_178_924 223
40 3300053077 Ga0495601_0007009 Ga0495601_0007009_1508_2236 223
41 3300053085 Ga0495619_0000507 Ga0495619_0000507_14894_15622 223
42 3300005338 Ga0068868_100480151 Ga0068868_1004801511 224
43 3300005354 Ga0070675_100376558 Ga0070675_1003765581 224
44 3300005468 Ga0070707_100127244 Ga0070707_1001272442 224
45 3300005536 Ga0070697_100249073 Ga0070697_1002490732 224
46 3300005536 Ga0070697_100518258 Ga0070697_1005182581 224
47 3300005545 Ga0070695_100445968 Ga0070695_1004459681 224
48 3300006173 Ga0070716_100126228 Ga0070716_1001262282 224
49 3300006175 Ga0070712_100075449 Ga0070712_1000754494 224
50 3300009098 Ga0105245_10198626 Ga0105245_101986262 224
51 3300013296 Ga0157374_10302916 Ga0157374_103029162 224
52 3300014745 Ga0157377_10049076 Ga0157377_100490763 224
53 3300017792 Ga0163161_10134451 Ga0163161_101344512 224
54 3300025915 Ga0207693_10410335 Ga0207693_104103352 224
55 3300025922 Ga0207646_10186769 Ga0207646_101867692 224
56 3300025927 Ga0207687_10310159 Ga0207687_103101591 224
57 3300026023 Ga0207677_10106584 Ga0207677_101065842 224
58 3300026118 Ga0207675_100011334 Ga0207675_1000113344 224
59 3300037312 Ga0395899_0006629 Ga0395899_0006629_1602_2357 224
60 3300037418 Ga0395900_0044122 Ga0395900_0044122_3567_4322 224
61 3300037466 Ga0395898_0009520 Ga0395898_0009520_9044_9799 224
62 3300037471 Ga0395905_0089298 Ga0395905_0089298_1180_1935 224
63 3300038443 Ga0395901_0075799 Ga0395901_0075799_664_1407 224
64 3300038443 Ga0395901_0220521 Ga0395901_0220521_274_1029 224
65 3300045976 Ga0466967_0087031 Ga0466967_0087031_359_1105 225
66 3300025912 Ga0207707_10225301 Ga0207707_102253012 230
67 3300049571 Ga0501034_0392963 Ga0501034_0392963_125_877 230
68 3300049571 Ga0501034_0032768 Ga0501034_0032768_1604_2353 231
69 3300006038 Ga0075365_10222185 Ga0075365_102221852 232
70 3300049571 Ga0501034_0375683 Ga0501034_0375683_327_1088 232
71 3300049574 Ga0501038_0217408 Ga0501038_0217408_176_937 232
72 3300049581 Ga0501047_0670830 Ga0501047_0670830_62_823 232
73 3300049742 Ga0501080_0134152 Ga0501080_0134152_583_1344 232
74 3300050492 nmdc:mga0yw44_150642_c1 nmdc:mga0yw44_150642_c1_655_1482 232
75 3300006880 Ga0075429_100031945 Ga0075429_1000319453 233
76 3300021388 Ga0213875_10028692 Ga0213875_100286923 233
77 3300028654 Ga0265322_10031122 Ga0265322_100311222 233
78 3300031251 Ga0265327_10164329 Ga0265327_101643291 233
79 3300031901 Ga0307406_10073881 Ga0307406_100738812 233
80 3300031903 Ga0307407_10197494 Ga0307407_101974942 233
81 3300031995 Ga0307409_100325375 Ga0307409_1003253752 233
82 3300032002 Ga0307416_100068182 Ga0307416_1000681823 233
83 3300032004 Ga0307414_10074782 Ga0307414_100747823 233
84 3300032005 Ga0307411_10054261 Ga0307411_100542613 233
85 3300032126 Ga0307415_100042956 Ga0307415_1000429563 233
86 3300039450 Ga0436363_0173701 Ga0436363_0173701_96_890 233
87 3300041460 Ga0451802_0557563 Ga0451802_0557563_33_809 233
88 3300050508 nmdc:mga09592_222728_c1 nmdc:mga09592_222728_c1_340_1098 233
89 3300053094 Ga0500566_0000485 Ga0500566_0000485_19066_19812 233
90 3300002773 JGI25152J39213_1000382 JGI25152J39213_100038222 234
91 3300025258 Ga0209129_1000411 Ga0209129_10004111 234
92 3300025294 Ga0209025_1001516 Ga0209025_100151620 234
93 3300044901 Ga0466960_0162255 Ga0466960_0162255_176_934 234
94 3300048924 Ga0496121_0017804 Ga0496121_0017804_2120_2875 234
95 3300049568 Ga0501031_0050009 Ga0501031_0050009_282_1058 234
96 3300049569 Ga0501032_0190051 Ga0501032_0190051_508_1284 234
97 3300049570 Ga0501033_0408664 Ga0501033_0408664_139_915 234
98 3300049572 Ga0501036_0020590 Ga0501036_0020590_1880_2656 234
99 3300049574 Ga0501038_0274569 Ga0501038_0274569_373_1149 234
100 3300049575 Ga0501039_0382561 Ga0501039_0382561_153_929 234
101 3300049576 Ga0501040_0042838 Ga0501040_0042838_44_820 234
102 3300049582 Ga0501048_0044915 Ga0501048_0044915_1761_2537 234
103 3300049586 Ga0501070_0441524 Ga0501070_0441524_242_1009 234
104 3300049587 Ga0501071_0000625 Ga0501071_0000625_4799_5575 234
105 3300049588 Ga0501072_0002715 Ga0501072_0002715_10384_11160 234
106 3300049590 Ga0501074_0047691 Ga0501074_0047691_1471_2247 234
107 3300049591 Ga0501075_0082016 Ga0501075_0082016_1507_2283 234
108 3300049592 Ga0501076_0022847 Ga0501076_0022847_699_1475 234
109 3300049822 Ga0501035_0092270 Ga0501035_0092270_1121_1897 234
110 3300053139 Ga0500568_0000023 Ga0500568_0000023_141568_142323 234
111 3300060353 Ga0501082_0034466 Ga0501082_0034466_3014_3790 234
112 3300005295 Ga0065707_10137443 Ga0065707_101374432 235
113 3300005354 Ga0070675_100044230 Ga0070675_1000442304 235
114 3300005438 Ga0070701_10215201 Ga0070701_102152011 235
115 3300005440 Ga0070705_100002225 Ga0070705_1000022258 235
116 3300005440 Ga0070705_100476761 Ga0070705_1004767611 235
117 3300005445 Ga0070708_100117158 Ga0070708_1001171582 235
118 3300005458 Ga0070681_10019064 Ga0070681_100190648 235
119 3300005468 Ga0070707_100383151 Ga0070707_1003831511 235
120 3300005471 Ga0070698_100001223 Ga0070698_10000122325 235
121 3300005471 Ga0070698_100065938 Ga0070698_1000659387 235
122 3300005536 Ga0070697_100680958 Ga0070697_1006809581 235
123 3300005546 Ga0070696_100005405 Ga0070696_1000054058 235
124 3300005549 Ga0070704_100472003 Ga0070704_1004720031 235
125 3300005614 Ga0068856_100113585 Ga0068856_1001135852 235
126 3300005844 Ga0068862_100283228 Ga0068862_1002832282 235
127 3300005981 Ga0081538_10003657 Ga0081538_1000365712 235
128 3300005981 Ga0081538_10025024 Ga0081538_100250244 235
129 3300006844 Ga0075428_100000018 Ga0075428_10000001823 235
130 3300006846 Ga0075430_100105653 Ga0075430_1001056534 235
131 3300006847 Ga0075431_100069197 Ga0075431_1000691974 235
132 3300006847 Ga0075431_100509143 Ga0075431_1005091431 235
133 3300006852 Ga0075433_10157527 Ga0075433_101575272 235
134 3300006871 Ga0075434_100062149 Ga0075434_1000621493 235
135 3300006871 Ga0075434_100271272 Ga0075434_1002712722 235
136 3300009094 Ga0111539_10000011 Ga0111539_10000011302 235
137 3300009147 Ga0114129_10001531 Ga0114129_1000153114 235
138 3300021361 Ga0213872_10025369 Ga0213872_100253691 235
139 3300025926 Ga0207659_10088635 Ga0207659_100886354 235
140 3300025927 Ga0207687_10099995 Ga0207687_100999952 235
141 3300026023 Ga0207677_10287502 Ga0207677_102875022 235
142 3300026078 Ga0207702_10053276 Ga0207702_100532763 235
143 3300027907 Ga0207428_10000023 Ga0207428_1000002321 235
144 3300028654 Ga0265322_10015429 Ga0265322_100154292 235
145 3300031344 Ga0265316_10068062 Ga0265316_100680622 235
146 3300035118 Ga0373954_0159547 Ga0373954_0159547_245_1021 235
147 3300035410 Ga0373924_0089775 Ga0373924_0089775_416_1192 235
148 3300036401 Ga0373937_0699043 Ga0373937_0699043_12_788 235
149 3300037853 Ga0436364_0631327 Ga0436364_0631327_3537_4343 235
150 3300038443 Ga0395901_0376943 Ga0395901_0376943_336_1103 235
151 3300042125 Ga0450923_039893 Ga0450923_039893_34_819 235
152 3300044673 Ga0453683_0012508 Ga0453683_0012508_4764_5549 235
153 3300044673 Ga0453683_0013146 Ga0453683_0013146_2326_3114 235
154 3300045836 Ga0466958_0334004 Ga0466958_0334004_47_823 235
155 3300045836 Ga0466958_0400604 Ga0466958_0400604_75_851 235
156 3300045976 Ga0466967_0851189 Ga0466967_0851189_95_862 235
157 3300047322 Ga0495680_0344796 Ga0495680_0344796_82_858 235
158 3300048915 Ga0496112_0243873 Ga0496112_0243873_576_1343 235
159 3300049568 Ga0501031_0129180 Ga0501031_0129180_297_1064 235
160 3300049570 Ga0501033_0193866 Ga0501033_0193866_85_891 235
161 3300049571 Ga0501034_0004370 Ga0501034_0004370_8914_9681 235
162 3300049571 Ga0501034_0829253 Ga0501034_0829253_33_800 235
163 3300049573 Ga0501037_0068237 Ga0501037_0068237_52_819 235
164 3300049575 Ga0501039_0048602 Ga0501039_0048602_2494_3261 235
165 3300049576 Ga0501040_0088595 Ga0501040_0088595_1358_2125 235
166 3300049577 Ga0501041_0045642 Ga0501041_0045642_1211_1978 235
167 3300049577 Ga0501041_0190116 Ga0501041_0190116_315_1100 235
168 3300049578 Ga0501042_0252502 Ga0501042_0252502_451_1218 235
169 3300049582 Ga0501048_0018852 Ga0501048_0018852_3321_4088 235
170 3300049586 Ga0501070_0142423 Ga0501070_0142423_1200_1961 235
171 3300049586 Ga0501070_0605217 Ga0501070_0605217_18_785 235
172 3300049588 Ga0501072_0003405 Ga0501072_0003405_44_811 235
173 3300049588 Ga0501072_0032612 Ga0501072_0032612_510_1316 235
174 3300049591 Ga0501075_0144662 Ga0501075_0144662_191_976 235
175 3300049591 Ga0501075_0197673 Ga0501075_0197673_35_802 235
176 3300049591 Ga0501075_0282508 Ga0501075_0282508_213_998 235
177 3300049592 Ga0501076_0004911 Ga0501076_0004911_2621_3388 235
178 3300049592 Ga0501076_0242484 Ga0501076_0242484_321_1106 235
179 3300049593 Ga0501077_0250064 Ga0501077_0250064_70_876 235
180 3300049741 Ga0501079_0231157 Ga0501079_0231157_52_819 235
181 3300049743 Ga0501081_0032354 Ga0501081_0032354_2606_3391 235
182 3300049743 Ga0501081_0128457 Ga0501081_0128457_871_1677 235
183 3300049743 Ga0501081_0168946 Ga0501081_0168946_42_809 235
184 3300049744 Ga0501083_0069809 Ga0501083_0069809_1436_2242 235
185 3300049822 Ga0501035_0340064 Ga0501035_0340064_385_1170 235
186 3300049824 Ga0501045_0043638 Ga0501045_0043638_2459_3226 235
187 3300049824 Ga0501045_0160457 Ga0501045_0160457_655_1461 235
188 3300050507 nmdc:mga05p37_425_c1 nmdc:mga05p37_425_c1_30153_30938 235
189 3300050509 nmdc:mga0qj67_72633_c1 nmdc:mga0qj67_72633_c1_1616_2401 235
190 3300050510 nmdc:mga06r32_225329_c1 nmdc:mga06r32_225329_c1_838_1623 235
191 3300050511 nmdc:mga08y16_12_c1 nmdc:mga08y16_12_c1_338064_338849 235
192 3300061734 Ga0530510_0302652 Ga0530510_0302652_69_836 235
193 3300003323 rootH1_10026887 rootH1_100268872 236
194 3300005329 Ga0070683_100008203 Ga0070683_1000082036 236
195 3300005329 Ga0070683_100121625 Ga0070683_1001216252 236
196 3300005336 Ga0070680_100053941 Ga0070680_1000539411 236
197 3300005337 Ga0070682_100000102 Ga0070682_10000010257 236
198 3300005337 Ga0070682_100053250 Ga0070682_1000532502 236
199 3300005347 Ga0070668_100019331 Ga0070668_1000193311 236
200 3300005353 Ga0070669_100004092 Ga0070669_1000040924 236
201 3300005435 Ga0070714_100000036 Ga0070714_100000036121 236
202 3300005435 Ga0070714_100475281 Ga0070714_1004752812 236
203 3300005436 Ga0070713_100021009 Ga0070713_1000210092 236
204 3300005436 Ga0070713_100231567 Ga0070713_1002315672 236
205 3300005437 Ga0070710_10011130 Ga0070710_100111302 236
206 3300005439 Ga0070711_100010804 Ga0070711_1000108042 236
207 3300005439 Ga0070711_100017660 Ga0070711_1000176605 236
208 3300005439 Ga0070711_100126795 Ga0070711_1001267952 236
209 3300005445 Ga0070708_100000432 Ga0070708_1000004326 236
210 3300005456 Ga0070678_100040753 Ga0070678_1000407532 236
211 3300005457 Ga0070662_100337106 Ga0070662_1003371062 236
212 3300005458 Ga0070681_10013783 Ga0070681_100137832 236
213 3300005458 Ga0070681_10014858 Ga0070681_1001485812 236
214 3300005467 Ga0070706_100111320 Ga0070706_1001113203 236
215 3300005467 Ga0070706_100424266 Ga0070706_1004242662 236
216 3300005518 Ga0070699_100035593 Ga0070699_1000355935 236
217 3300005518 Ga0070699_100619927 Ga0070699_1006199271 236
218 3300005530 Ga0070679_100159924 Ga0070679_1001599244 236
219 3300005535 Ga0070684_100009587 Ga0070684_1000095876 236
220 3300005535 Ga0070684_100034149 Ga0070684_1000341493 236
221 3300005535 Ga0070684_100079113 Ga0070684_1000791132 236
222 3300005535 Ga0070684_100323837 Ga0070684_1003238371 236
223 3300005536 Ga0070697_100020931 Ga0070697_1000209313 236
224 3300005536 Ga0070697_100033855 Ga0070697_1000338554 236
225 3300005546 Ga0070696_100608303 Ga0070696_1006083031 236
226 3300005547 Ga0070693_100012950 Ga0070693_1000129505 236
227 3300005614 Ga0068856_100179898 Ga0068856_1001798982 236
228 3300006038 Ga0075365_10078922 Ga0075365_100789224 236
229 3300006038 Ga0075365_10194837 Ga0075365_101948372 236
230 3300006237 Ga0097621_100122017 Ga0097621_1001220172 236
231 3300006844 Ga0075428_100004380 Ga0075428_10000438013 236
232 3300006846 Ga0075430_100004543 Ga0075430_1000045433 236
233 3300006847 Ga0075431_100669242 Ga0075431_1006692421 236
234 3300006847 Ga0075431_100712296 Ga0075431_1007122962 236
235 3300006914 Ga0075436_100043529 Ga0075436_1000435294 236
236 3300007076 Ga0075435_100654650 Ga0075435_1006546501 236
237 3300007265 Ga0099794_10028213 Ga0099794_100282131 236
238 3300007265 Ga0099794_10037531 Ga0099794_100375312 236
239 3300009093 Ga0105240_10000060 Ga0105240_1000006050 236
240 3300009094 Ga0111539_10204770 Ga0111539_102047703 236
241 3300009098 Ga0105245_10000290 Ga0105245_1000029030 236
242 3300009098 Ga0105245_10050155 Ga0105245_100501554 236
243 3300009098 Ga0105245_10082862 Ga0105245_100828622 236
244 3300009098 Ga0105245_10427623 Ga0105245_104276232 236
245 3300009147 Ga0114129_10745805 Ga0114129_107458051 236
246 3300009174 Ga0105241_10054300 Ga0105241_100543004 236
247 3300009174 Ga0105241_10225867 Ga0105241_102258671 236
248 3300009553 Ga0105249_10000245 Ga0105249_1000024513 236
249 3300011119 Ga0105246_10054794 Ga0105246_100547943 236
250 3300011119 Ga0105246_10134996 Ga0105246_101349963 236
251 3300013306 Ga0163162_10607073 Ga0163162_106070732 236
252 3300014326 Ga0157380_10000313 Ga0157380_1000031334 236
253 3300014969 Ga0157376_10037100 Ga0157376_100371002 236
254 3300017792 Ga0163161_10000058 Ga0163161_1000005838 236
255 3300021377 Ga0213874_10060482 Ga0213874_100604821 236
256 3300025893 Ga0207682_10000052 Ga0207682_1000005251 236
257 3300025906 Ga0207699_10047882 Ga0207699_100478823 236
258 3300025909 Ga0207705_10135975 Ga0207705_101359752 236
259 3300025910 Ga0207684_10400659 Ga0207684_104006592 236
260 3300025910 Ga0207684_10615305 Ga0207684_106153051 236
261 3300025912 Ga0207707_10059064 Ga0207707_100590643 236
262 3300025913 Ga0207695_10000025 Ga0207695_10000025151 236
263 3300025915 Ga0207693_10002083 Ga0207693_1000208314 236
264 3300025916 Ga0207663_10007435 Ga0207663_100074358 236
265 3300025916 Ga0207663_10085383 Ga0207663_100853832 236
266 3300025917 Ga0207660_10045298 Ga0207660_100452985 236
267 3300025923 Ga0207681_10005966 Ga0207681_100059666 236
268 3300025927 Ga0207687_10000012 Ga0207687_1000001235 236
269 3300025927 Ga0207687_10014401 Ga0207687_100144014 236
270 3300025927 Ga0207687_10132626 Ga0207687_101326262 236
271 3300025928 Ga0207700_10021136 Ga0207700_100211364 236
272 3300025929 Ga0207664_10000025 Ga0207664_10000025178 236
273 3300025929 Ga0207664_10011344 Ga0207664_100113442 236
274 3300025929 Ga0207664_10128127 Ga0207664_101281272 236
275 3300025929 Ga0207664_10157129 Ga0207664_101571292 236
276 3300025929 Ga0207664_10169567 Ga0207664_101695672 236
277 3300025933 Ga0207706_10101254 Ga0207706_101012542 236
278 3300025938 Ga0207704_10407376 Ga0207704_104073761 236
279 3300025944 Ga0207661_10007703 Ga0207661_100077032 236
280 3300025944 Ga0207661_10013885 Ga0207661_100138857 236
281 3300025944 Ga0207661_10098561 Ga0207661_100985613 236
282 3300025945 Ga0207679_10076756 Ga0207679_100767562 236
283 3300025961 Ga0207712_10000086 Ga0207712_1000008645 236
284 3300025972 Ga0207668_10016834 Ga0207668_100168344 236
285 3300026078 Ga0207702_10011951 Ga0207702_100119513 236
286 3300026121 Ga0207683_10012451 Ga0207683_100124514 236
287 3300027671 Ga0209588_1019632 Ga0209588_10196322 236
288 3300027671 Ga0209588_1053589 Ga0209588_10535892 236
289 3300028558 Ga0265326_10000005 Ga0265326_10000005151 236
290 3300028573 Ga0265334_10000024 Ga0265334_100000241 236
291 3300028666 Ga0265336_10017322 Ga0265336_100173222 236
292 3300028800 Ga0265338_10002712 Ga0265338_1000271221 236
293 3300028800 Ga0265338_10146720 Ga0265338_101467202 236
294 3300029957 Ga0265324_10002813 Ga0265324_100028132 236
295 3300031247 Ga0265340_10153700 Ga0265340_101537002 236
296 3300031852 Ga0307410_10135271 Ga0307410_101352711 236
297 3300031995 Ga0307409_100018828 Ga0307409_1000188282 236
298 3300031995 Ga0307409_100245993 Ga0307409_1002459932 236
299 3300032002 Ga0307416_100130461 Ga0307416_1001304612 236
300 3300032002 Ga0307416_101345268 Ga0307416_1013452681 236
301 3300032126 Ga0307415_100000192 Ga0307415_10000019228 236
302 3300035171 Ga0373946_0135982 Ga0373946_0135982_322_1110 236
303 3300035692 Ga0373935_0396958 Ga0373935_0396958_62_829 236
304 3300035695 Ga0373927_0000103 Ga0373927_0000103_14128_14895 236
305 3300035724 Ga0373933_0095294 Ga0373933_0095294_613_1392 236
306 3300037068 Ga0373925_0038619 Ga0373925_0038619_2342_3109 236
307 3300037418 Ga0395900_0080249 Ga0395900_0080249_883_1644 236
308 3300037418 Ga0395900_0288563 Ga0395900_0288563_814_1584 236
309 3300037418 Ga0395900_0630934 Ga0395900_0630934_43_813 236
310 3300037466 Ga0395898_0053883 Ga0395898_0053883_2478_3251 236
311 3300037466 Ga0395898_0075241 Ga0395898_0075241_151_924 236
312 3300037466 Ga0395898_0210912 Ga0395898_0210912_155_925 236
313 3300037466 Ga0395898_0802437 Ga0395898_0802437_22_807 236
314 3300038443 Ga0395901_0004872 Ga0395901_0004872_6144_6917 236
315 3300038443 Ga0395901_0203162 Ga0395901_0203162_1159_1920 236
316 3300041512 Ga0451853_1119736 Ga0451853_1119736_521_1285 236
317 3300044673 Ga0453683_0007472 Ga0453683_0007472_5931_6695 236
318 3300045976 Ga0466967_0032329 Ga0466967_0032329_2797_3558 236
319 3300045976 Ga0466967_0546922 Ga0466967_0546922_181_942 236
320 3300046454 Ga0495592_0000621 Ga0495592_0000621_8054_8818 236
321 3300046462 Ga0495651_0129888 Ga0495651_0129888_530_1309 236
322 3300046462 Ga0495651_0350706 Ga0495651_0350706_46_801 236
323 3300046463 Ga0495653_0038045 Ga0495653_0038045_883_1662 236
324 3300046472 Ga0495580_0333428 Ga0495580_0333428_93_848 236
325 3300046473 Ga0495582_0187898 Ga0495582_0187898_57_839 236
326 3300046473 Ga0495582_0305518 Ga0495582_0305518_117_896 236
327 3300046477 Ga0495664_0071725 Ga0495664_0071725_1105_1887 236
328 3300046511 Ga0495608_0000406 Ga0495608_0000406_18933_19697 236
329 3300046514 Ga0495618_0000068 Ga0495618_0000068_73799_74563 236
330 3300046515 Ga0495620_0000315 Ga0495620_0000315_16736_17521 236
331 3300046516 Ga0495628_0005324 Ga0495628_0005324_4798_5553 236
332 3300046516 Ga0495628_0169083 Ga0495628_0169083_19_798 236
333 3300046516 Ga0495628_0489227 Ga0495628_0489227_60_839 236
334 3300046523 Ga0495644_0000954 Ga0495644_0000954_6349_7113 236
335 3300046523 Ga0495644_0108839 Ga0495644_0108839_213_986 236
336 3300046529 Ga0495652_0425109 Ga0495652_0425109_128_907 236
337 3300046533 Ga0495640_0021376 Ga0495640_0021376_2048_2812 236
338 3300046559 Ga0495667_0019918 Ga0495667_0019918_841_1620 236
339 3300046663 Ga0495635_0000009 Ga0495635_0000009_236507_237271 236
340 3300046663 Ga0495635_0021925 Ga0495635_0021925_3483_4262 236
341 3300046678 Ga0495599_0231041 Ga0495599_0231041_49_828 236
342 3300046683 Ga0495658_0301734 Ga0495658_0301734_72_854 236
343 3300046689 Ga0495613_0000249 Ga0495613_0000249_12915_13679 236
344 3300046690 Ga0495624_0010426 Ga0495624_0010426_2179_2943 236
345 3300046809 Ga0495600_0154022 Ga0495600_0154022_61_825 236
346 3300047317 Ga0495604_0141683 Ga0495604_0141683_28_807 236
347 3300047322 Ga0495680_0000023 Ga0495680_0000023_28037_28792 236
348 3300047322 Ga0495680_0016552 Ga0495680_0016552_3880_4659 236
349 3300047471 Ga0495684_0281190 Ga0495684_0281190_33_812 236
350 3300047471 Ga0495684_0436473 Ga0495684_0436473_112_891 236
351 3300048903 Ga0496100_0000016 Ga0496100_0000016_28088_28873 236
352 3300048903 Ga0496100_0220710 Ga0496100_0220710_346_1116 236
353 3300048904 Ga0496101_0000038 Ga0496101_0000038_137186_137971 236
354 3300048904 Ga0496101_0039180 Ga0496101_0039180_2351_3136 236
355 3300048905 Ga0496102_0004878 Ga0496102_0004878_825_1598 236
356 3300048906 Ga0496103_0004524 Ga0496103_0004524_7622_8395 236
357 3300048907 Ga0496104_0004192 Ga0496104_0004192_6665_7438 236
358 3300048907 Ga0496104_0075882 Ga0496104_0075882_1432_2217 236
359 3300048907 Ga0496104_0550614 Ga0496104_0550614_48_827 236
360 3300048908 Ga0496105_0005312 Ga0496105_0005312_941_1726 236
361 3300048909 Ga0496106_0000027 Ga0496106_0000027_120700_121485 236
362 3300048910 Ga0496107_0000003 Ga0496107_0000003_275166_275951 236
363 3300048910 Ga0496107_0146109 Ga0496107_0146109_26_793 236
364 3300048911 Ga0496108_0000002 Ga0496108_0000002_282276_283061 236
365 3300048912 Ga0496109_0000001 Ga0496109_0000001_282238_283023 236
366 3300048912 Ga0496109_0043704 Ga0496109_0043704_3137_3925 236
367 3300048915 Ga0496112_0000865 Ga0496112_0000865_16434_17204 236
368 3300048915 Ga0496112_0105281 Ga0496112_0105281_449_1228 236
369 3300048915 Ga0496112_0112407 Ga0496112_0112407_561_1328 236
370 3300048917 Ga0496114_0009726 Ga0496114_0009726_4106_4879 236
371 3300049578 Ga0501042_0206628 Ga0501042_0206628_348_1127 236
372 3300049587 Ga0501071_0170767 Ga0501071_0170767_532_1311 236
373 3300049741 Ga0501079_0295867 Ga0501079_0295867_311_1090 236
374 3300050507 nmdc:mga05p37_221961_c1 nmdc:mga05p37_221961_c1_981_1751 236
375 3300050507 nmdc:mga05p37_860988_c1 nmdc:mga05p37_860988_c1_45_809 236
376 3300050508 nmdc:mga09592_5791_c1 nmdc:mga09592_5791_c1_2668_3438 236
377 3300050509 nmdc:mga0qj67_82225_c1 nmdc:mga0qj67_82225_c1_1711_2481 236
378 3300050510 nmdc:mga06r32_340846_c1 nmdc:mga06r32_340846_c1_183_953 236
379 3300050512 nmdc:mga0n895_79740_c1 nmdc:mga0n895_79740_c1_2462_3217 236
380 3300053084 Ga0495595_0000109 Ga0495595_0000109_35050_35814 236
381 3300005445 Ga0070708_100072392 Ga0070708_1000723925 237
382 3300005468 Ga0070707_100009328 Ga0070707_10000932810 237
383 3300006847 Ga0075431_100714955 Ga0075431_1007149551 237
384 3300006852 Ga0075433_10312622 Ga0075433_103126221 237
385 3300006871 Ga0075434_100038041 Ga0075434_1000380414 237
386 3300006871 Ga0075434_100431379 Ga0075434_1004313792 237
387 3300007076 Ga0075435_100098975 Ga0075435_1000989753 237
388 3300009094 Ga0111539_10198009 Ga0111539_101980092 237
389 3300009147 Ga0114129_10007716 Ga0114129_100077167 237
390 3300009147 Ga0114129_10098758 Ga0114129_100987582 237
391 3300009551 Ga0105238_10093026 Ga0105238_100930263 237
392 3300013306 Ga0163162_10465563 Ga0163162_104655631 237
393 3300025910 Ga0207684_10027719 Ga0207684_100277195 237
394 3300025922 Ga0207646_10079619 Ga0207646_100796192 237
395 3300025934 Ga0207686_10480654 Ga0207686_104806542 237
396 3300025939 Ga0207665_10390617 Ga0207665_103906172 237
397 3300025986 Ga0207658_10650491 Ga0207658_106504911 237
398 3300026116 Ga0207674_10322895 Ga0207674_103228952 237
399 3300027671 Ga0209588_1040685 Ga0209588_10406851 237
400 3300028380 Ga0268265_10148830 Ga0268265_101488302 237
401 3300031548 Ga0307408_100262507 Ga0307408_1002625072 237
402 3300031731 Ga0307405_10360279 Ga0307405_103602791 237
403 3300031824 Ga0307413_10277458 Ga0307413_102774581 237
404 3300031995 Ga0307409_100077675 Ga0307409_1000776752 237
405 3300031995 Ga0307409_100198410 Ga0307409_1001984101 237
406 3300032002 Ga0307416_100112172 Ga0307416_1001121723 237
407 3300032004 Ga0307414_10017237 Ga0307414_100172375 237
408 3300032126 Ga0307415_100287670 Ga0307415_1002876702 237
409 3300037068 Ga0373925_0000189 Ga0373925_0000189_2966_3751 237
410 3300037312 Ga0395899_0002389 Ga0395899_0002389_4620_5396 237
411 3300037418 Ga0395900_0010103 Ga0395900_0010103_6149_6925 237
412 3300037466 Ga0395898_0156957 Ga0395898_0156957_1124_1900 237
413 3300037471 Ga0395905_0002146 Ga0395905_0002146_612_1388 237
414 3300038443 Ga0395901_0360309 Ga0395901_0360309_401_1177 237
415 3300038996 Ga0242420_015509 Ga0242420_015509_357_1148 237
416 3300039447 Ga0436361_0844713 Ga0436361_0844713_7157_7951 237
417 3300044673 Ga0453683_0026109 Ga0453683_0026109_2452_3234 237
418 3300044735 Ga0466968_0125363 Ga0466968_0125363_318_1091 237
419 3300049574 Ga0501038_0277988 Ga0501038_0277988_423_1217 237
420 3300049575 Ga0501039_0510185 Ga0501039_0510185_88_882 237
421 3300049577 Ga0501041_0145441 Ga0501041_0145441_569_1363 237
422 3300049590 Ga0501074_0338868 Ga0501074_0338868_117_911 237
423 3300049592 Ga0501076_0054181 Ga0501076_0054181_2325_3119 237
424 3300049593 Ga0501077_0001046 Ga0501077_0001046_7033_7827 237
425 3300049741 Ga0501079_0044291 Ga0501079_0044291_624_1520 237
426 3300050507 nmdc:mga05p37_26018_c1 nmdc:mga05p37_26018_c1_4479_5237 237
427 3300050507 nmdc:mga05p37_309164_c1 nmdc:mga05p37_309164_c1_204_998 237
428 3300050509 nmdc:mga0qj67_456876_c1 nmdc:mga0qj67_456876_c1_178_951 237
429 3300050512 nmdc:mga0n895_343776_c1 nmdc:mga0n895_343776_c1_372_1130 237
430 3300050515 nmdc:mga0a205_104623_c1 nmdc:mga0a205_104623_c1_721_1512 237
431 3300053085 Ga0495619_0006443 Ga0495619_0006443_56_841 237
432 3300054114 Ga0501084_0010731 Ga0501084_0010731_4424_5218 237
433 3300059424 Ga0590075_010220 Ga0590075_010220_1155_1949 237
434 3300059647 Ga0587079_032495 Ga0587079_032495_92_865 237
435 3300060353 Ga0501082_0206629 Ga0501082_0206629_400_1194 237
436 3300061734 Ga0530510_0416483 Ga0530510_0416483_41_835 237
437 3300005345 Ga0070692_10206871 Ga0070692_102068712 238
438 3300005364 Ga0070673_100421442 Ga0070673_1004214422 238
439 3300005366 Ga0070659_100063726 Ga0070659_1000637262 238
440 3300005435 Ga0070714_100000603 Ga0070714_10000060315 238
441 3300005441 Ga0070700_100146364 Ga0070700_1001463642 238
442 3300005444 Ga0070694_100051461 Ga0070694_1000514612 238
443 3300005459 Ga0068867_100115694 Ga0068867_1001156942 238
444 3300005467 Ga0070706_100113674 Ga0070706_1001136743 238
445 3300005467 Ga0070706_100199875 Ga0070706_1001998753 238
446 3300005467 Ga0070706_100425837 Ga0070706_1004258372 238
447 3300005468 Ga0070707_100021602 Ga0070707_1000216023 238
448 3300005518 Ga0070699_100206218 Ga0070699_1002062182 238
449 3300005535 Ga0070684_100108785 Ga0070684_1001087852 238
450 3300005545 Ga0070695_100289147 Ga0070695_1002891472 238
451 3300005546 Ga0070696_100380862 Ga0070696_1003808621 238
452 3300005546 Ga0070696_100455198 Ga0070696_1004551981 238
453 3300005549 Ga0070704_100192219 Ga0070704_1001922192 238
454 3300005577 Ga0068857_100284388 Ga0068857_1002843882 238
455 3300005578 Ga0068854_100186168 Ga0068854_1001861682 238
456 3300005618 Ga0068864_100685724 Ga0068864_1006857242 238
457 3300005719 Ga0068861_100129227 Ga0068861_1001292272 238
458 3300005843 Ga0068860_100779101 Ga0068860_1007791011 238
459 3300005981 Ga0081538_10112930 Ga0081538_101129301 238
460 3300009098 Ga0105245_10056261 Ga0105245_100562612 238
461 3300009147 Ga0114129_10276085 Ga0114129_102760852 238
462 3300009148 Ga0105243_10026317 Ga0105243_100263173 238
463 3300009148 Ga0105243_10038475 Ga0105243_100384754 238
464 3300009553 Ga0105249_10455701 Ga0105249_104557012 238
465 3300014745 Ga0157377_10043297 Ga0157377_100432973 238
466 3300025901 Ga0207688_10024477 Ga0207688_100244771 238
467 3300025907 Ga0207645_10033469 Ga0207645_100334692 238
468 3300025910 Ga0207684_10096801 Ga0207684_100968013 238
469 3300025910 Ga0207684_10182629 Ga0207684_101826292 238
470 3300025918 Ga0207662_10108670 Ga0207662_101086701 238
471 3300025919 Ga0207657_10004692 Ga0207657_1000469210 238
472 3300025923 Ga0207681_10351092 Ga0207681_103510922 238
473 3300025929 Ga0207664_10007176 Ga0207664_100071768 238
474 3300025949 Ga0207667_10713197 Ga0207667_107131972 238
475 3300026023 Ga0207677_10264297 Ga0207677_102642972 238
476 3300026075 Ga0207708_10085252 Ga0207708_100852522 238
477 3300026075 Ga0207708_10156010 Ga0207708_101560102 238
478 3300026089 Ga0207648_10032468 Ga0207648_100324685 238
479 3300026118 Ga0207675_100029085 Ga0207675_1000290852 238
480 3300026118 Ga0207675_100080712 Ga0207675_1000807123 238
481 3300028381 Ga0268264_10475479 Ga0268264_104754792 238
482 3300031903 Ga0307407_10049087 Ga0307407_100490874 238
483 3300031995 Ga0307409_100023420 Ga0307409_1000234202 238
484 3300032002 Ga0307416_100417986 Ga0307416_1004179862 238
485 3300032005 Ga0307411_10156712 Ga0307411_101567122 238
486 3300037466 Ga0395898_0362231 Ga0395898_0362231_26_832 238
487 3300037471 Ga0395905_0059446 Ga0395905_0059446_348_1154 238
488 3300038443 Ga0395901_0019380 Ga0395901_0019380_137_943 238
489 3300044658 Ga0466972_0101530 Ga0466972_0101530_373_1182 238
490 3300045051 Ga0451576_0501226 Ga0451576_0501226_221_991 238
491 3300047322 Ga0495680_0441766 Ga0495680_0441766_28_852 238
492 3300048911 Ga0496108_0222032 Ga0496108_0222032_552_1379 238
493 3300048915 Ga0496112_0305973 Ga0496112_0305973_582_1412 238
494 3300049568 Ga0501031_0020801 Ga0501031_0020801_3417_4199 238
495 3300049568 Ga0501031_0126379 Ga0501031_0126379_103_909 238
496 3300049569 Ga0501032_0038454 Ga0501032_0038454_556_1338 238
497 3300049569 Ga0501032_0146400 Ga0501032_0146400_566_1372 238
498 3300049570 Ga0501033_0154130 Ga0501033_0154130_791_1573 238
499 3300049571 Ga0501034_0091981 Ga0501034_0091981_661_1437 238
500 3300049572 Ga0501036_0001738 Ga0501036_0001738_198_980 238
501 3300049572 Ga0501036_0404721 Ga0501036_0404721_261_1067 238
502 3300049574 Ga0501038_0450616 Ga0501038_0450616_152_934 238
503 3300049575 Ga0501039_0045845 Ga0501039_0045845_2423_3205 238
504 3300049576 Ga0501040_0002511 Ga0501040_0002511_8600_9382 238
505 3300049577 Ga0501041_0001860 Ga0501041_0001860_7850_8632 238
506 3300049578 Ga0501042_0016718 Ga0501042_0016718_1764_2546 238
507 3300049578 Ga0501042_0258736 Ga0501042_0258736_136_942 238
508 3300049580 Ga0501046_0007642 Ga0501046_0007642_3064_3846 238
509 3300049582 Ga0501048_0006497 Ga0501048_0006497_8062_8844 238
510 3300049584 Ga0501068_0018481 Ga0501068_0018481_2310_3092 238
511 3300049585 Ga0501069_0002990 Ga0501069_0002990_5524_6306 238
512 3300049586 Ga0501070_0024213 Ga0501070_0024213_2128_2910 238
513 3300049587 Ga0501071_0001478 Ga0501071_0001478_3182_3964 238
514 3300049588 Ga0501072_0000386 Ga0501072_0000386_16381_17163 238
515 3300049589 Ga0501073_0016136 Ga0501073_0016136_2129_2911 238
516 3300049590 Ga0501074_0003903 Ga0501074_0003903_8498_9280 238
517 3300049591 Ga0501075_0002467 Ga0501075_0002467_9022_9804 238
518 3300049592 Ga0501076_0001538 Ga0501076_0001538_12263_13045 238
519 3300049593 Ga0501077_0014506 Ga0501077_0014506_2408_3190 238
520 3300049741 Ga0501079_0001142 Ga0501079_0001142_9549_10331 238
521 3300049742 Ga0501080_0000913 Ga0501080_0000913_16300_17082 238
522 3300049743 Ga0501081_0004652 Ga0501081_0004652_3290_4072 238
523 3300049822 Ga0501035_0028544 Ga0501035_0028544_836_1618 238
524 3300049824 Ga0501045_0001817 Ga0501045_0001817_8711_9493 238
525 3300049824 Ga0501045_0077048 Ga0501045_0077048_1342_2148 238
526 3300050507 nmdc:mga05p37_301741_c1 nmdc:mga05p37_301741_c1_976_1794 238
527 3300054114 Ga0501084_0018018 Ga0501084_0018018_5032_5814 238
528 3300060353 Ga0501082_0011025 Ga0501082_0011025_4461_5243 238
529 3300005467 Ga0070706_100000637 Ga0070706_10000063720 239
530 3300005471 Ga0070698_100067092 Ga0070698_1000670922 239
531 3300005539 Ga0068853_100706057 Ga0068853_1007060572 239
532 3300005543 Ga0070672_100004568 Ga0070672_1000045688 239
533 3300005842 Ga0068858_100001029 Ga0068858_1000010294 239
534 3300005937 Ga0081455_10000308 Ga0081455_1000030822 239
535 3300006038 Ga0075365_10014932 Ga0075365_100149326 239
536 3300006175 Ga0070712_100000005 Ga0070712_100000005154 239
537 3300006914 Ga0075436_100001888 Ga0075436_1000018886 239
538 3300006914 Ga0075436_100425426 Ga0075436_1004254261 239
539 3300007265 Ga0099794_10002520 Ga0099794_100025205 239
540 3300009098 Ga0105245_10014396 Ga0105245_100143964 239
541 3300009553 Ga0105249_10137966 Ga0105249_101379664 239
542 3300013100 Ga0157373_10437783 Ga0157373_104377831 239
543 3300013308 Ga0157375_10000018 Ga0157375_10000018154 239
544 3300014326 Ga0157380_10009617 Ga0157380_100096174 239
545 3300022467 Ga0224712_10000993 Ga0224712_1000099311 239
546 3300025910 Ga0207684_10000345 Ga0207684_1000034521 239
547 3300025915 Ga0207693_10000023 Ga0207693_1000002320 239
548 3300025927 Ga0207687_10001014 Ga0207687_1000101413 239
549 3300025940 Ga0207691_10001294 Ga0207691_1000129416 239
550 3300026035 Ga0207703_10000008 Ga0207703_10000008268 239
551 3300026075 Ga0207708_10194053 Ga0207708_101940531 239
552 3300031665 Ga0316575_10088583 Ga0316575_100885832 239
553 3300032002 Ga0307416_100331833 Ga0307416_1003318332 239
554 3300033179 Ga0307507_10037296 Ga0307507_100372963 239
555 3300037312 Ga0395899_0184937 Ga0395899_0184937_473_1291 239
556 3300037418 Ga0395900_0009229 Ga0395900_0009229_9145_9963 239
557 3300037466 Ga0395898_0084041 Ga0395898_0084041_1584_2402 239
558 3300037471 Ga0395905_0190871 Ga0395905_0190871_404_1222 239
559 3300037471 Ga0395905_0197276 Ga0395905_0197276_349_1167 239
560 3300038443 Ga0395901_0021273 Ga0395901_0021273_747_1565 239
561 3300038443 Ga0395901_0182454 Ga0395901_0182454_154_972 239
562 3300045049 Ga0466959_0028049 Ga0466959_0028049_2844_3632 239
563 3300048924 Ga0496121_0211530 Ga0496121_0211530_444_1220 239
564 3300049568 Ga0501031_0137008 Ga0501031_0137008_42_833 239
565 3300049591 Ga0501075_0161922 Ga0501075_0161922_288_1073 239
566 3300049592 Ga0501076_0412852 Ga0501076_0412852_212_997 239
567 3300050492 nmdc:mga0yw44_10101_c1 nmdc:mga0yw44_10101_c1_3687_4502 239
568 3300050510 nmdc:mga06r32_754462_c1 nmdc:mga06r32_754462_c1_21_818 239
569 3300050514 nmdc:mga08x19_271_c1 nmdc:mga08x19_271_c1_2488_3285 239
570 3300059490 Ga0587066_003568 Ga0587066_003568_555_1334 239
571 3300059490 Ga0587066_039218 Ga0587066_039218_60_830 239
572 3300059492 Ga0587073_0006032 Ga0587073_0006032_556_1335 239
573 3300059505 Ga0587083_0030674 Ga0587083_0030674_133_903 239
574 3300059508 Ga0587088_006433 Ga0587088_006433_290_1069 239
575 3300059510 Ga0587090_003437 Ga0587090_003437_507_1286 239
576 3300059511 Ga0587091_006150 Ga0587091_006150_349_1119 239
577 3300059513 Ga0587094_002452 Ga0587094_002452_638_1417 239
578 3300059625 Ga0587113_004512 Ga0587113_004512_125_904 239
579 3300059626 Ga0587115_002426 Ga0587115_002426_556_1335 239
580 3300059640 Ga0587067_003434 Ga0587067_003434_686_1465 239
581 3300059643 Ga0587072_028080 Ga0587072_028080_53_832 239
582 3300059645 Ga0587076_006926 Ga0587076_006926_281_1060 239
583 3300059647 Ga0587079_004079 Ga0587079_004079_610_1389 239
584 3300059647 Ga0587079_012111 Ga0587079_012111_120_911 239
585 3300059647 Ga0587079_028100 Ga0587079_028100_104_874 239
586 3300060344 Ga0587071_005131 Ga0587071_005131_517_1296 239
587 3300060344 Ga0587071_053299 Ga0587071_053299_13_783 239
588 3300005467 Ga0070706_100349498 Ga0070706_1003494982 240
589 3300049575 Ga0501039_0262560 Ga0501039_0262560_567_1340 240
590 3300005618 Ga0068864_100000054 Ga0068864_10000005411 241
591 3300026095 Ga0207676_10000028 Ga0207676_10000028183 241
592 3300036401 Ga0373937_0179371 Ga0373937_0179371_759_1616 241
593 3300044693 Ga0466961_0242917 Ga0466961_0242917_193_960 241
594 3300005563 Ga0068855_100141009 Ga0068855_1001410093 242
595 3300009094 Ga0111539_10095793 Ga0111539_100957932 242
596 3300025949 Ga0207667_10262010 Ga0207667_102620103 242
597 3300031903 Ga0307407_10176745 Ga0307407_101767451 242
598 3300031995 Ga0307409_100131301 Ga0307409_1001313012 242
599 3300038443 Ga0395901_0128148 Ga0395901_0128148_1566_2333 242
600 3300044842 Ga0466957_0360466 Ga0466957_0360466_158_925 242
601 3300048916 Ga0496113_0003035 Ga0496113_0003035_6661_7428 242
602 3300048925 Ga0496122_0007704 Ga0496122_0007704_8952_9719 242
603 3300048926 Ga0496123_0048992 Ga0496123_0048992_679_1446 242
604 3300049571 Ga0501034_0315504 Ga0501034_0315504_103_843 242
605 3300049575 Ga0501039_0346725 Ga0501039_0346725_174_914 242
606 3300049586 Ga0501070_0369583 Ga0501070_0369583_293_1033 242
607 3300049742 Ga0501080_0059538 Ga0501080_0059538_835_1575 242
608 3300049822 Ga0501035_0121332 Ga0501035_0121332_1318_2058 242
609 3300050511 nmdc:mga08y16_77303_c1 nmdc:mga08y16_77303_c1_936_1745 242
610 3300005548 Ga0070665_100024828 Ga0070665_1000248285 243
611 3300009545 Ga0105237_10000091 Ga0105237_10000091110 243
612 3300010375 Ga0105239_10016609 Ga0105239_100166098 243
613 3300025914 Ga0207671_10000834 Ga0207671_1000083424 243
614 3300028379 Ga0268266_10000255 Ga0268266_1000025512 243
615 3300049578 Ga0501042_0110376 Ga0501042_0110376_1150_1950 243
616 3300049588 Ga0501072_0067133 Ga0501072_0067133_1874_2674 243
617 3300049592 Ga0501076_0128469 Ga0501076_0128469_855_1655 243
618 3300054114 Ga0501084_0055867 Ga0501084_0055867_132_932 243
619 3300061734 Ga0530510_0028327 Ga0530510_0028327_373_1173 243
620 iso_pu_bacteria 2643221629 2644166793 243
621 iso_pu_bacteria 2643221662 2644347633 243
622 3300003320 rootH2_10001322 rootH2_100013228 244
623 3300005456 Ga0070678_100251233 Ga0070678_1002512332 244
624 3300005985 Ga0081539_10007281 Ga0081539_100072817 244
625 3300031852 Ga0307410_10277296 Ga0307410_102772962 244
626 3300044901 Ga0466960_0001117 Ga0466960_0001117_148_963 244
627 3300049571 Ga0501034_0437014 Ga0501034_0437014_117_863 244
628 3300049571 Ga0501034_0464813 Ga0501034_0464813_282_1025 244
629 3300053153 Ga0500616_0012886 Ga0500616_0012886_4030_4776 244
630 3300006880 Ga0075429_100023708 Ga0075429_1000237083 245
631 3300009147 Ga0114129_10006962 Ga0114129_1000696211 245
632 3300044683 Ga0466965_0041608 Ga0466965_0041608_618_1454 245
633 3300044765 Ga0466970_0033719 Ga0466970_0033719_1763_2599 245
634 3300050507 nmdc:mga05p37_15530_c1 nmdc:mga05p37_15530_c1_1552_2379 245
635 3300050508 nmdc:mga09592_109993_c1 nmdc:mga09592_109993_c1_192_1019 245
636 iso_pu_bacteria 2511231003 2511250963 245
637 iso_pu_bacteria 8054472261 8054476431 245
638 3300039062 Ga0400483_021893 Ga0400483_021893_2793_3542 246
639 3300039062 Ga0400483_208345 Ga0400483_208345_2564_3313 246
640 3300041413 Ga0439465_0047967 Ga0439465_0047967_307_1062 247
641 3300006195 Ga0075366_10121788 Ga0075366_101217882 249
642 3300013105 Ga0157369_10129597 Ga0157369_101295974 249
643 3300037312 Ga0395899_0035886 Ga0395899_0035886_322_1074 249
644 3300037418 Ga0395900_0001337 Ga0395900_0001337_22547_23299 249
645 3300037466 Ga0395898_0657835 Ga0395898_0657835_61_813 249
646 3300044656 Ga0466969_0029913 Ga0466969_0029913_1187_1939 249
647 3300044693 Ga0466961_0290833 Ga0466961_0290833_51_803 249
648 3300045976 Ga0466967_0427369 Ga0466967_0427369_253_1005 249
649 3300046474 Ga0495605_0009386 Ga0495605_0009386_4485_5237 249
650 3300046513 Ga0495616_0003806 Ga0495616_0003806_6339_7091 249
651 3300046538 Ga0495609_0000002 Ga0495609_0000002_369801_370553 249
652 3300046616 Ga0495668_0143676 Ga0495668_0143676_541_1293 249
653 3300046665 Ga0495661_0000281 Ga0495661_0000281_4070_4822 249
654 3300046794 Ga0495589_0000230 Ga0495589_0000230_41947_42699 249
655 3300047443 Ga0495687_000013 Ga0495687_000013_366303_367055 249
656 3300047445 Ga0495677_0000041 Ga0495677_0000041_53111_53863 249
657 3300048091 Ga0495626_0000383 Ga0495626_0000383_3406_4158 249
658 3300048905 Ga0496102_0082310 Ga0496102_0082310_609_1361 249
659 3300048927 Ga0496124_0035218 Ga0496124_0035218_2347_3099 249
660 3300002738 JGI25154J39366_1000359 JGI25154J39366_100035916 252
661 3300025233 Ga0209437_109976 Ga0209437_1099762 252
662 3300025246 Ga0209646_1000007 Ga0209646_1000007406 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

12

59

0.97

PF12840

HTH_20

Helix-turn-helix domain

10

60

0.97

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

115

243

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9527 14 71
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9342 14 72
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9244 2 81
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.921 19 71
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9202 2 80
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.978 13 70 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9663 9 71 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9627 16 72 1.10.10.10
af_Q9C106_417_505_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9559 14 72 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9527 14 71 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A659UVB0-F1-model_v4 ArsR family transcriptional regulator 1.001 5 76 GO:0003700
AF-A0A370WV10-F1-model_v4 ArsR family transcriptional regulator 0.9965 5 86 GO:0003700
AF-A0A3C1L3A4-F1-model_v4 HTH arsR-type domain-containing protein 0.9807 5 76 GO:0003700
AF-A0A1G2IVA2-F1-model_v4 HTH arsR-type domain-containing protein 0.9716 1 75 GO:0003700
AF-A0A1H3K9Z4-F1-model_v4 ArsR family transcriptional regulator 0.9671 2 80 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
88.4 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map