F473512
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 662 | 325 | 658 | 257 |
Family's Representative Sequence
| Representative Sequence | 3300049741|Ga0501079_0044291|Ga0501079_0044291_624_1520 |
| Length | 298 |
| Sequence | MNADVVFRALADPTRRGLLDALFRRDGQSLSQLGGRLRMTRFGVMKHLRVLEEAGLVVTRRRGREKLHFLNPVPIRRIHDRWIDKYTEPWAAMLSGLKDDLEGERMEKVFEIYIKTTPERLWQAITEPAMRAKYTFGVGVYSDWTPGSSYQSRTTELNGTAGMPIGEGENLEVDPPRRLVQTFRALWSDEVKGEGFSRVTWEIEPVADSCRLTVTHDQLRAGANDELYGGWPMVLSGLKTLLETGETLTTPGSLMYLAPQPAARRGCRLVTLSAAKGAMSALAPFTSFSGDHEQSGDP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 3 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 95 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 96 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 97 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 154 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 155 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 157 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 168 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 169 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 185 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 186 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 187 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 188 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 189 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 191 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 192 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 193 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 194 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 195 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 196 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 197 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 198 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 199 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 200 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 201 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 202 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 203 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 204 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 205 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 257 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 258 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 259 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 260 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 304 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 305 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 308 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 325 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.22 |
| Metatranscriptomes | 3.17 |
| Isolates | 0.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.11 |
| Nodule | 0 |
| Rhizoplane | 4.68 |
| Rhizosphere | 90.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25154J39366_1000359 | 3300002738 | Bacteria | 25837 |
| 2 | JGI25152J39213_1000382 | 3300002773 | Bacteria | 27117 |
| 3 | rootH2_10001322 | 3300003320 | Bacteria | 5897 |
| 4 | rootH1_10026887 | 3300003323 | Bacteria | 2982 |
| 5 | Ga0065707_10137443 | 3300005295 | Bacteria | 1820 |
| 6 | Ga0070683_100008203 | 3300005329 | Bacteria | 8871 |
| 7 | Ga0070683_100121625 | 3300005329 | Bacteria | 2466 |
| 8 | Ga0070680_100053941 | 3300005336 | Bacteria | 3282 |
| 9 | Ga0070682_100000102 | 3300005337 | Bacteria | 76457 |
| 10 | Ga0070682_100053250 | 3300005337 | Bacteria | 2536 |
| 11 | Ga0068868_100480151 | 3300005338 | Bacteria | 1085 |
| 12 | Ga0070692_10206871 | 3300005345 | Bacteria | 1153 |
| 13 | Ga0070668_100019331 | 3300005347 | Bacteria | 5127 |
| 14 | Ga0070669_100004092 | 3300005353 | Bacteria | 10567 |
| 15 | Ga0070675_100004821 | 3300005354 | Bacteria | 10290 |
| 16 | Ga0070675_100044230 | 3300005354 | Bacteria | 3642 |
| 17 | Ga0070675_100376558 | 3300005354 | Bacteria | 1263 |
| 18 | Ga0070673_100421442 | 3300005364 | Bacteria | 1197 |
| 19 | Ga0070659_100063726 | 3300005366 | Bacteria | 2916 |
| 20 | Ga0070714_100000036 | 3300005435 | Bacteria | 126916 |
| 21 | Ga0070714_100000603 | 3300005435 | Bacteria | 25692 |
| 22 | Ga0070714_100190398 | 3300005435 | Bacteria | 1872 |
| 23 | Ga0070714_100475281 | 3300005435 | Bacteria | 1189 |
| 24 | Ga0070713_100021009 | 3300005436 | Bacteria | 5012 |
| 25 | Ga0070713_100231567 | 3300005436 | Bacteria | 1679 |
| 26 | Ga0070713_100367587 | 3300005436 | Bacteria | 1337 |
| 27 | Ga0070710_10011130 | 3300005437 | Bacteria | 4437 |
| 28 | Ga0070701_10215201 | 3300005438 | Bacteria | 1143 |
| 29 | Ga0070711_100010804 | 3300005439 | Bacteria | 5662 |
| 30 | Ga0070711_100017660 | 3300005439 | Bacteria | 4545 |
| 31 | Ga0070711_100061287 | 3300005439 | Bacteria | 2618 |
| 32 | Ga0070711_100126795 | 3300005439 | Bacteria | 1896 |
| 33 | Ga0070705_100002225 | 3300005440 | Bacteria | 9855 |
| 34 | Ga0070705_100476761 | 3300005440 | Bacteria | 942 |
| 35 | Ga0070700_100146364 | 3300005441 | Bacteria | 1611 |
| 36 | Ga0070694_100051461 | 3300005444 | Bacteria | 2780 |
| 37 | Ga0070708_100000432 | 3300005445 | Bacteria | 31219 |
| 38 | Ga0070708_100072392 | 3300005445 | Bacteria | 3105 |
| 39 | Ga0070708_100117158 | 3300005445 | Bacteria | 2453 |
| 40 | Ga0070708_100520803 | 3300005445 | Bacteria | 1122 |
| 41 | Ga0070678_100040753 | 3300005456 | Bacteria | 3288 |
| 42 | Ga0070678_100251233 | 3300005456 | Bacteria | 1483 |
| 43 | Ga0070662_100337106 | 3300005457 | Bacteria | 1233 |
| 44 | Ga0070681_10013783 | 3300005458 | Bacteria | 8047 |
| 45 | Ga0070681_10014858 | 3300005458 | Bacteria | 7741 |
| 46 | Ga0070681_10019064 | 3300005458 | Bacteria | 6866 |
| 47 | Ga0068867_100115694 | 3300005459 | Bacteria | 2066 |
| 48 | Ga0070685_10176207 | 3300005466 | Bacteria | 1373 |
| 49 | Ga0070706_100000637 | 3300005467 | Bacteria | 40194 |
| 50 | Ga0070706_100111320 | 3300005467 | Bacteria | 2548 |
| 51 | Ga0070706_100113674 | 3300005467 | Bacteria | 2521 |
| 52 | Ga0070706_100199875 | 3300005467 | Bacteria | 1867 |
| 53 | Ga0070706_100349498 | 3300005467 | Bacteria | 1378 |
| 54 | Ga0070706_100424266 | 3300005467 | Bacteria | 1238 |
| 55 | Ga0070706_100425837 | 3300005467 | Unclassified | 1235 |
| 56 | Ga0070707_100009328 | 3300005468 | Bacteria | 9108 |
| 57 | Ga0070707_100021602 | 3300005468 | Bacteria | 6085 |
| 58 | Ga0070707_100127244 | 3300005468 | Bacteria | 2475 |
| 59 | Ga0070707_100383151 | 3300005468 | Bacteria | 1366 |
| 60 | Ga0070698_100001223 | 3300005471 | Bacteria | 28541 |
| 61 | Ga0070698_100017096 | 3300005471 | Bacteria | 7646 |
| 62 | Ga0070698_100065938 | 3300005471 | Bacteria | 3645 |
| 63 | Ga0070698_100067092 | 3300005471 | Bacteria | 3609 |
| 64 | Ga0070699_100035593 | 3300005518 | Bacteria | 4304 |
| 65 | Ga0070699_100206218 | 3300005518 | Bacteria | 1749 |
| 66 | Ga0070699_100619927 | 3300005518 | Bacteria | 987 |
| 67 | Ga0070679_100159924 | 3300005530 | Bacteria | 2227 |
| 68 | Ga0070684_100009587 | 3300005535 | Bacteria | 7631 |
| 69 | Ga0070684_100034149 | 3300005535 | Bacteria | 4347 |
| 70 | Ga0070684_100079113 | 3300005535 | Bacteria | 2906 |
| 71 | Ga0070684_100108785 | 3300005535 | Bacteria | 2484 |
| 72 | Ga0070684_100323837 | 3300005535 | Bacteria | 1416 |
| 73 | Ga0070697_100020931 | 3300005536 | Bacteria | 5178 |
| 74 | Ga0070697_100033855 | 3300005536 | Bacteria | 4117 |
| 75 | Ga0070697_100109851 | 3300005536 | Bacteria | 2297 |
| 76 | Ga0070697_100249073 | 3300005536 | Bacteria | 1519 |
| 77 | Ga0070697_100518258 | 3300005536 | Bacteria | 1044 |
| 78 | Ga0070697_100680958 | 3300005536 | Bacteria | 907 |
| 79 | Ga0068853_100706057 | 3300005539 | Bacteria | 962 |
| 80 | Ga0070672_100004568 | 3300005543 | Bacteria | 9060 |
| 81 | Ga0070672_100277926 | 3300005543 | Bacteria | 1415 |
| 82 | Ga0070695_100289147 | 3300005545 | Bacteria | 1207 |
| 83 | Ga0070695_100445968 | 3300005545 | Bacteria | 991 |
| 84 | Ga0070696_100005405 | 3300005546 | Bacteria | 8516 |
| 85 | Ga0070696_100166444 | 3300005546 | Bacteria | 1627 |
| 86 | Ga0070696_100380862 | 3300005546 | Bacteria | 1099 |
| 87 | Ga0070696_100455198 | 3300005546 | Bacteria | 1010 |
| 88 | Ga0070696_100608303 | 3300005546 | Bacteria | 882 |
| 89 | Ga0070693_100012950 | 3300005547 | Bacteria | 4236 |
| 90 | Ga0070665_100024828 | 3300005548 | Bacteria | 6039 |
| 91 | Ga0070704_100192219 | 3300005549 | Bacteria | 1641 |
| 92 | Ga0070704_100472003 | 3300005549 | Bacteria | 1084 |
| 93 | Ga0068855_100141009 | 3300005563 | Bacteria | 2748 |
| 94 | Ga0068857_100284388 | 3300005577 | Bacteria | 1522 |
| 95 | Ga0068854_100186168 | 3300005578 | Bacteria | 1625 |
| 96 | Ga0068856_100113585 | 3300005614 | Bacteria | 2706 |
| 97 | Ga0068856_100179898 | 3300005614 | Bacteria | 2127 |
| 98 | Ga0068864_100000054 | 3300005618 | Bacteria | 129210 |
| 99 | Ga0068864_100109513 | 3300005618 | Bacteria | 2459 |
| 100 | Ga0068864_100685724 | 3300005618 | Bacteria | 1000 |
| 101 | Ga0068861_100129227 | 3300005719 | Bacteria | 2049 |
| 102 | Ga0068858_100001029 | 3300005842 | Bacteria | 28784 |
| 103 | Ga0068860_100779101 | 3300005843 | Bacteria | 969 |
| 104 | Ga0068862_100283228 | 3300005844 | Bacteria | 1520 |
| 105 | Ga0081455_10000308 | 3300005937 | Bacteria | 64439 |
| 106 | Ga0081538_10003657 | 3300005981 | Bacteria | 14448 |
| 107 | Ga0081538_10025024 | 3300005981 | Bacteria | 4230 |
| 108 | Ga0081538_10112930 | 3300005981 | Bacteria | 1328 |
| 109 | Ga0081539_10007281 | 3300005985 | Bacteria | 10156 |
| 110 | Ga0075365_10014932 | 3300006038 | Bacteria | 4683 |
| 111 | Ga0075365_10078922 | 3300006038 | Bacteria | 2227 |
| 112 | Ga0075365_10194837 | 3300006038 | Bacteria | 1418 |
| 113 | Ga0075365_10222185 | 3300006038 | Bacteria | 1325 |
| 114 | Ga0070716_100126228 | 3300006173 | Bacteria | 1610 |
| 115 | Ga0070712_100000005 | 3300006175 | Bacteria | 177449 |
| 116 | Ga0070712_100075449 | 3300006175 | Bacteria | 2424 |
| 117 | Ga0075366_10121788 | 3300006195 | Bacteria | 1572 |
| 118 | Ga0097621_100122017 | 3300006237 | Bacteria | 2211 |
| 119 | Ga0068871_100205470 | 3300006358 | Bacteria | 1702 |
| 120 | Ga0075428_100000018 | 3300006844 | Bacteria | 147246 |
| 121 | Ga0075428_100004380 | 3300006844 | Bacteria | 15583 |
| 122 | Ga0075430_100004543 | 3300006846 | Bacteria | 11687 |
| 123 | Ga0075430_100105653 | 3300006846 | Bacteria | 2350 |
| 124 | Ga0075431_100069197 | 3300006847 | Bacteria | 3642 |
| 125 | Ga0075431_100509143 | 3300006847 | Bacteria | 1194 |
| 126 | Ga0075431_100669242 | 3300006847 | Bacteria | 1017 |
| 127 | Ga0075431_100712296 | 3300006847 | Bacteria | 981 |
| 128 | Ga0075431_100714955 | 3300006847 | Bacteria | 979 |
| 129 | Ga0075433_10157527 | 3300006852 | Bacteria | 2020 |
| 130 | Ga0075433_10312622 | 3300006852 | Bacteria | 1390 |
| 131 | Ga0075434_100038041 | 3300006871 | Bacteria | 4765 |
| 132 | Ga0075434_100062149 | 3300006871 | Bacteria | 3717 |
| 133 | Ga0075434_100271272 | 3300006871 | Bacteria | 1716 |
| 134 | Ga0075434_100431379 | 3300006871 | Bacteria | 1339 |
| 135 | Ga0075429_100023708 | 3300006880 | Bacteria | 5325 |
| 136 | Ga0075429_100031945 | 3300006880 | Bacteria | 4577 |
| 137 | Ga0075436_100001888 | 3300006914 | Bacteria | 14395 |
| 138 | Ga0075436_100043529 | 3300006914 | Bacteria | 3095 |
| 139 | Ga0075436_100425426 | 3300006914 | Bacteria | 965 |
| 140 | Ga0075435_100098975 | 3300007076 | Bacteria | 2414 |
| 141 | Ga0075435_100654650 | 3300007076 | Bacteria | 912 |
| 142 | Ga0099794_10002520 | 3300007265 | Bacteria | 6768 |
| 143 | Ga0099794_10028213 | 3300007265 | Bacteria | 2609 |
| 144 | Ga0099794_10037531 | 3300007265 | Bacteria | 2294 |
| 145 | Ga0105240_10000060 | 3300009093 | Bacteria | 219839 |
| 146 | Ga0111539_10000011 | 3300009094 | Bacteria | 356900 |
| 147 | Ga0111539_10095793 | 3300009094 | Bacteria | 3486 |
| 148 | Ga0111539_10198009 | 3300009094 | Bacteria | 2343 |
| 149 | Ga0111539_10204770 | 3300009094 | Bacteria | 2300 |
| 150 | Ga0105245_10000290 | 3300009098 | Bacteria | 47991 |
| 151 | Ga0105245_10014396 | 3300009098 | Bacteria | 6890 |
| 152 | Ga0105245_10050155 | 3300009098 | Bacteria | 3739 |
| 153 | Ga0105245_10056261 | 3300009098 | Bacteria | 3535 |
| 154 | Ga0105245_10082862 | 3300009098 | Bacteria | 2935 |
| 155 | Ga0105245_10198626 | 3300009098 | Bacteria | 1925 |
| 156 | Ga0105245_10427623 | 3300009098 | Bacteria | 1328 |
| 157 | Ga0114129_10001531 | 3300009147 | Bacteria | 31348 |
| 158 | Ga0114129_10006962 | 3300009147 | Bacteria | 16087 |
| 159 | Ga0114129_10007716 | 3300009147 | Bacteria | 15306 |
| 160 | Ga0114129_10098758 | 3300009147 | Bacteria | 4041 |
| 161 | Ga0114129_10276085 | 3300009147 | Bacteria | 2247 |
| 162 | Ga0114129_10745805 | 3300009147 | Bacteria | 1254 |
| 163 | Ga0105243_10026317 | 3300009148 | Bacteria | 4453 |
| 164 | Ga0105243_10038475 | 3300009148 | Bacteria | 3725 |
| 165 | Ga0105241_10054300 | 3300009174 | Bacteria | 3066 |
| 166 | Ga0105241_10225867 | 3300009174 | Bacteria | 1576 |
| 167 | Ga0105237_10000091 | 3300009545 | Bacteria | 122477 |
| 168 | Ga0105238_10093026 | 3300009551 | Bacteria | 3003 |
| 169 | Ga0105249_10000245 | 3300009553 | Bacteria | 60260 |
| 170 | Ga0105249_10137966 | 3300009553 | Bacteria | 2336 |
| 171 | Ga0105249_10455701 | 3300009553 | Bacteria | 1318 |
| 172 | Ga0105239_10016609 | 3300010375 | Bacteria | 8137 |
| 173 | Ga0105246_10054794 | 3300011119 | Bacteria | 2749 |
| 174 | Ga0105246_10134996 | 3300011119 | Bacteria | 1848 |
| 175 | Ga0157373_10437783 | 3300013100 | Bacteria | 940 |
| 176 | Ga0157369_10129597 | 3300013105 | Bacteria | 2673 |
| 177 | Ga0157374_10302916 | 3300013296 | Bacteria | 1581 |
| 178 | Ga0163162_10465563 | 3300013306 | Bacteria | 1396 |
| 179 | Ga0163162_10607073 | 3300013306 | Bacteria | 1220 |
| 180 | Ga0157375_10000018 | 3300013308 | Bacteria | 285123 |
| 181 | Ga0157380_10000313 | 3300014326 | Bacteria | 29351 |
| 182 | Ga0157380_10009617 | 3300014326 | Bacteria | 6933 |
| 183 | Ga0157380_10874229 | 3300014326 | Unclassified | 923 |
| 184 | Ga0157377_10043297 | 3300014745 | Bacteria | 2505 |
| 185 | Ga0157377_10049076 | 3300014745 | Bacteria | 2371 |
| 186 | Ga0157376_10037100 | 3300014969 | Bacteria | 3953 |
| 187 | Ga0163161_10000058 | 3300017792 | Bacteria | 114035 |
| 188 | Ga0163161_10134451 | 3300017792 | Bacteria | 1868 |
| 189 | Ga0213872_10025369 | 3300021361 | Bacteria | 2725 |
| 190 | Ga0213874_10060482 | 3300021377 | Bacteria | 1185 |
| 191 | Ga0213875_10028692 | 3300021388 | Bacteria | 2641 |
| 192 | Ga0224712_10000993 | 3300022467 | Bacteria | 6184 |
| 193 | Ga0209437_109976 | 3300025233 | Bacteria | 1465 |
| 194 | Ga0209646_1000007 | 3300025246 | Bacteria | 670994 |
| 195 | Ga0209129_1000411 | 3300025258 | Bacteria | 33656 |
| 196 | Ga0209025_1001516 | 3300025294 | Bacteria | 29813 |
| 197 | Ga0207682_10000052 | 3300025893 | Bacteria | 49191 |
| 198 | Ga0207688_10024477 | 3300025901 | Bacteria | 3311 |
| 199 | Ga0207699_10047882 | 3300025906 | Bacteria | 2508 |
| 200 | Ga0207645_10033469 | 3300025907 | Bacteria | 3303 |
| 201 | Ga0207705_10135975 | 3300025909 | Bacteria | 1832 |
| 202 | Ga0207684_10000345 | 3300025910 | Bacteria | 64212 |
| 203 | Ga0207684_10027719 | 3300025910 | Bacteria | 4825 |
| 204 | Ga0207684_10096801 | 3300025910 | Bacteria | 2519 |
| 205 | Ga0207684_10182629 | 3300025910 | Bacteria | 1809 |
| 206 | Ga0207684_10400659 | 3300025910 | Bacteria | 1180 |
| 207 | Ga0207684_10615305 | 3300025910 | Bacteria | 927 |
| 208 | Ga0207707_10059064 | 3300025912 | Bacteria | 3336 |
| 209 | Ga0207707_10225301 | 3300025912 | Bacteria | 1632 |
| 210 | Ga0207695_10000025 | 3300025913 | Bacteria | 627211 |
| 211 | Ga0207671_10000834 | 3300025914 | Bacteria | 39135 |
| 212 | Ga0207693_10000023 | 3300025915 | Bacteria | 127876 |
| 213 | Ga0207693_10002083 | 3300025915 | Bacteria | 17484 |
| 214 | Ga0207693_10014840 | 3300025915 | Bacteria | 6258 |
| 215 | Ga0207693_10410335 | 3300025915 | Bacteria | 1059 |
| 216 | Ga0207663_10007435 | 3300025916 | Bacteria | 5679 |
| 217 | Ga0207663_10085383 | 3300025916 | Bacteria | 2078 |
| 218 | Ga0207663_10169555 | 3300025916 | Bacteria | 1549 |
| 219 | Ga0207660_10045298 | 3300025917 | Bacteria | 3098 |
| 220 | Ga0207662_10108670 | 3300025918 | Bacteria | 1727 |
| 221 | Ga0207657_10004692 | 3300025919 | Bacteria | 14422 |
| 222 | Ga0207646_10079619 | 3300025922 | Bacteria | 2929 |
| 223 | Ga0207646_10186769 | 3300025922 | Bacteria | 1872 |
| 224 | Ga0207646_10198396 | 3300025922 | Bacteria | 1812 |
| 225 | Ga0207681_10005966 | 3300025923 | Bacteria | 7474 |
| 226 | Ga0207681_10351092 | 3300025923 | Bacteria | 1181 |
| 227 | Ga0207659_10088635 | 3300025926 | Bacteria | 2305 |
| 228 | Ga0207659_10092224 | 3300025926 | Bacteria | 2264 |
| 229 | Ga0207687_10000012 | 3300025927 | Bacteria | 370729 |
| 230 | Ga0207687_10001014 | 3300025927 | Bacteria | 19081 |
| 231 | Ga0207687_10014401 | 3300025927 | Bacteria | 5174 |
| 232 | Ga0207687_10099995 | 3300025927 | Bacteria | 2132 |
| 233 | Ga0207687_10132626 | 3300025927 | Bacteria | 1880 |
| 234 | Ga0207687_10310159 | 3300025927 | Bacteria | 1274 |
| 235 | Ga0207700_10021136 | 3300025928 | Bacteria | 4436 |
| 236 | Ga0207664_10000025 | 3300025929 | Bacteria | 196804 |
| 237 | Ga0207664_10007176 | 3300025929 | Bacteria | 7723 |
| 238 | Ga0207664_10011344 | 3300025929 | Bacteria | 6327 |
| 239 | Ga0207664_10115911 | 3300025929 | Bacteria | 2234 |
| 240 | Ga0207664_10128127 | 3300025929 | Bacteria | 2133 |
| 241 | Ga0207664_10157129 | 3300025929 | Bacteria | 1937 |
| 242 | Ga0207664_10169567 | 3300025929 | Bacteria | 1867 |
| 243 | Ga0207706_10101254 | 3300025933 | Bacteria | 2534 |
| 244 | Ga0207686_10480654 | 3300025934 | Bacteria | 961 |
| 245 | Ga0207704_10407376 | 3300025938 | Bacteria | 1075 |
| 246 | Ga0207665_10003333 | 3300025939 | Bacteria | 10764 |
| 247 | Ga0207665_10390617 | 3300025939 | Bacteria | 1058 |
| 248 | Ga0207691_10001294 | 3300025940 | Bacteria | 24967 |
| 249 | Ga0207691_10287043 | 3300025940 | Bacteria | 1415 |
| 250 | Ga0207661_10007703 | 3300025944 | Bacteria | 7663 |
| 251 | Ga0207661_10013885 | 3300025944 | Bacteria | 5887 |
| 252 | Ga0207661_10098561 | 3300025944 | Bacteria | 2449 |
| 253 | Ga0207679_10076756 | 3300025945 | Bacteria | 2540 |
| 254 | Ga0207667_10262010 | 3300025949 | Bacteria | 1768 |
| 255 | Ga0207667_10713197 | 3300025949 | Bacteria | 1005 |
| 256 | Ga0207712_10000086 | 3300025961 | Bacteria | 107484 |
| 257 | Ga0207668_10016834 | 3300025972 | Bacteria | 4571 |
| 258 | Ga0207658_10650491 | 3300025986 | Bacteria | 950 |
| 259 | Ga0207677_10106584 | 3300026023 | Bacteria | 2077 |
| 260 | Ga0207677_10264297 | 3300026023 | Bacteria | 1404 |
| 261 | Ga0207677_10287502 | 3300026023 | Bacteria | 1352 |
| 262 | Ga0207703_10000008 | 3300026035 | Bacteria | 373718 |
| 263 | Ga0207708_10085252 | 3300026075 | Bacteria | 2430 |
| 264 | Ga0207708_10156010 | 3300026075 | Bacteria | 1800 |
| 265 | Ga0207708_10194053 | 3300026075 | Bacteria | 1618 |
| 266 | Ga0207702_10011951 | 3300026078 | Bacteria | 7222 |
| 267 | Ga0207702_10053276 | 3300026078 | Bacteria | 3425 |
| 268 | Ga0207648_10032468 | 3300026089 | Bacteria | 4609 |
| 269 | Ga0207676_10000028 | 3300026095 | Bacteria | 237195 |
| 270 | Ga0207676_10018963 | 3300026095 | Bacteria | 5011 |
| 271 | Ga0207674_10322895 | 3300026116 | Bacteria | 1493 |
| 272 | Ga0207675_100011334 | 3300026118 | Bacteria | 8343 |
| 273 | Ga0207675_100029085 | 3300026118 | Bacteria | 5149 |
| 274 | Ga0207675_100080712 | 3300026118 | Bacteria | 3050 |
| 275 | Ga0207683_10012451 | 3300026121 | Bacteria | 7260 |
| 276 | Ga0209588_1019632 | 3300027671 | Bacteria | 2111 |
| 277 | Ga0209588_1040685 | 3300027671 | Bacteria | 1500 |
| 278 | Ga0209588_1053589 | 3300027671 | Bacteria | 1305 |
| 279 | Ga0207428_10000023 | 3300027907 | Bacteria | 272062 |
| 280 | Ga0268266_10000255 | 3300028379 | Bacteria | 89930 |
| 281 | Ga0268265_10148830 | 3300028380 | Bacteria | 1972 |
| 282 | Ga0268264_10475479 | 3300028381 | Bacteria | 1215 |
| 283 | Ga0265326_10000005 | 3300028558 | Bacteria | 257124 |
| 284 | Ga0265334_10000024 | 3300028573 | Bacteria | 118525 |
| 285 | Ga0265322_10015429 | 3300028654 | Bacteria | 2208 |
| 286 | Ga0265322_10031122 | 3300028654 | Bacteria | 1523 |
| 287 | Ga0265336_10017322 | 3300028666 | Bacteria | 2347 |
| 288 | Ga0265338_10002712 | 3300028800 | Bacteria | 25982 |
| 289 | Ga0265338_10146720 | 3300028800 | Bacteria | 1839 |
| 290 | Ga0265324_10002813 | 3300029957 | Bacteria | 8585 |
| 291 | Ga0265340_10153700 | 3300031247 | Bacteria | 1048 |
| 292 | Ga0265327_10164329 | 3300031251 | Bacteria | 1023 |
| 293 | Ga0265316_10068062 | 3300031344 | Bacteria | 2752 |
| 294 | Ga0307408_100262507 | 3300031548 | Bacteria | 1430 |
| 295 | Ga0316575_10088583 | 3300031665 | Bacteria | 1252 |
| 296 | Ga0307405_10360279 | 3300031731 | Bacteria | 1125 |
| 297 | Ga0307413_10277458 | 3300031824 | Bacteria | 1258 |
| 298 | Ga0307410_10135271 | 3300031852 | Bacteria | 1816 |
| 299 | Ga0307410_10277296 | 3300031852 | Bacteria | 1314 |
| 300 | Ga0307406_10073881 | 3300031901 | Bacteria | 2243 |
| 301 | Ga0307407_10049087 | 3300031903 | Bacteria | 2407 |
| 302 | Ga0307407_10176745 | 3300031903 | Bacteria | 1411 |
| 303 | Ga0307407_10197494 | 3300031903 | Bacteria | 1345 |
| 304 | Ga0307409_100018828 | 3300031995 | Bacteria | 4657 |
| 305 | Ga0307409_100023420 | 3300031995 | Bacteria | 4279 |
| 306 | Ga0307409_100077675 | 3300031995 | Bacteria | 2668 |
| 307 | Ga0307409_100131301 | 3300031995 | Bacteria | 2141 |
| 308 | Ga0307409_100198410 | 3300031995 | Bacteria | 1793 |
| 309 | Ga0307409_100245993 | 3300031995 | Bacteria | 1632 |
| 310 | Ga0307409_100325375 | 3300031995 | Bacteria | 1440 |
| 311 | Ga0307416_100068182 | 3300032002 | Bacteria | 2938 |
| 312 | Ga0307416_100112172 | 3300032002 | Bacteria | 2406 |
| 313 | Ga0307416_100130461 | 3300032002 | Bacteria | 2261 |
| 314 | Ga0307416_100331833 | 3300032002 | Bacteria | 1529 |
| 315 | Ga0307416_100417986 | 3300032002 | Bacteria | 1384 |
| 316 | Ga0307416_101345268 | 3300032002 | Bacteria | 820 |
| 317 | Ga0307414_10017237 | 3300032004 | Bacteria | 4414 |
| 318 | Ga0307414_10074782 | 3300032004 | Bacteria | 2456 |
| 319 | Ga0307411_10054261 | 3300032005 | Bacteria | 2630 |
| 320 | Ga0307411_10156712 | 3300032005 | Bacteria | 1700 |
| 321 | Ga0307415_100000192 | 3300032126 | Bacteria | 27217 |
| 322 | Ga0307415_100042956 | 3300032126 | Bacteria | 3012 |
| 323 | Ga0307415_100287670 | 3300032126 | Bacteria | 1355 |
| 324 | Ga0307507_10037296 | 3300033179 | Bacteria | 4949 |
| 325 | Ga0373953_0010641 | 3300035117 | Bacteria | 3209 |
| 326 | Ga0373954_0159547 | 3300035118 | Bacteria | 1103 |
| 327 | Ga0373946_0135982 | 3300035171 | Bacteria | 1135 |
| 328 | Ga0373924_0089775 | 3300035410 | Bacteria | 1314 |
| 329 | Ga0373935_0396958 | 3300035692 | Bacteria | 990 |
| 330 | Ga0373927_0000103 | 3300035695 | Bacteria | 64324 |
| 331 | Ga0373933_0095294 | 3300035724 | Bacteria | 1841 |
| 332 | Ga0373937_0179371 | 3300036401 | Bacteria | 1988 |
| 333 | Ga0373937_0699043 | 3300036401 | Bacteria | 960 |
| 334 | Ga0373925_0000189 | 3300037068 | Bacteria | 67044 |
| 335 | Ga0373925_0038619 | 3300037068 | Bacteria | 3530 |
| 336 | Ga0395899_0002389 | 3300037312 | Bacteria | 15244 |
| 337 | Ga0395899_0006629 | 3300037312 | Bacteria | 8974 |
| 338 | Ga0395899_0035886 | 3300037312 | Bacteria | 3720 |
| 339 | Ga0395899_0184937 | 3300037312 | Bacteria | 1461 |
| 340 | Ga0395899_0379779 | 3300037312 | Bacteria | 939 |
| 341 | Ga0395900_0001337 | 3300037418 | Bacteria | 29786 |
| 342 | Ga0395900_0009229 | 3300037418 | Bacteria | 10114 |
| 343 | Ga0395900_0010103 | 3300037418 | Bacteria | 9653 |
| 344 | Ga0395900_0044122 | 3300037418 | Bacteria | 4595 |
| 345 | Ga0395900_0080249 | 3300037418 | Bacteria | 3353 |
| 346 | Ga0395900_0288563 | 3300037418 | Bacteria | 1630 |
| 347 | Ga0395900_0630934 | 3300037418 | Bacteria | 1010 |
| 348 | Ga0395898_0009520 | 3300037466 | Bacteria | 10200 |
| 349 | Ga0395898_0053883 | 3300037466 | Bacteria | 3927 |
| 350 | Ga0395898_0075241 | 3300037466 | Bacteria | 3262 |
| 351 | Ga0395898_0084041 | 3300037466 | Bacteria | 3068 |
| 352 | Ga0395898_0156957 | 3300037466 | Bacteria | 2176 |
| 353 | Ga0395898_0210912 | 3300037466 | Bacteria | 1853 |
| 354 | Ga0395898_0362231 | 3300037466 | Bacteria | 1382 |
| 355 | Ga0395898_0657835 | 3300037466 | Bacteria | 990 |
| 356 | Ga0395898_0802437 | 3300037466 | Bacteria | 881 |
| 357 | Ga0395905_0002146 | 3300037471 | Bacteria | 22374 |
| 358 | Ga0395905_0059446 | 3300037471 | Bacteria | 3573 |
| 359 | Ga0395905_0089298 | 3300037471 | Bacteria | 2888 |
| 360 | Ga0395905_0190871 | 3300037471 | Bacteria | 1922 |
| 361 | Ga0395905_0197276 | 3300037471 | Bacteria | 1887 |
| 362 | Ga0436364_0631327 | 3300037853 | Bacteria | 4713 |
| 363 | Ga0395901_0004872 | 3300038443 | Bacteria | 13549 |
| 364 | Ga0395901_0019380 | 3300038443 | Bacteria | 6956 |
| 365 | Ga0395901_0021273 | 3300038443 | Bacteria | 6644 |
| 366 | Ga0395901_0075799 | 3300038443 | Bacteria | 3509 |
| 367 | Ga0395901_0128148 | 3300038443 | Bacteria | 2667 |
| 368 | Ga0395901_0182454 | 3300038443 | Bacteria | 2201 |
| 369 | Ga0395901_0203162 | 3300038443 | Bacteria | 2077 |
| 370 | Ga0395901_0220521 | 3300038443 | Bacteria | 1982 |
| 371 | Ga0395901_0360309 | 3300038443 | Bacteria | 1499 |
| 372 | Ga0395901_0376943 | 3300038443 | Bacteria | 1461 |
| 373 | Ga0242420_015509 | 3300038996 | Bacteria | 1318 |
| 374 | Ga0400483_021893 | 3300039062 | Bacteria | 7026 |
| 375 | Ga0400483_208345 | 3300039062 | Bacteria | 3493 |
| 376 | Ga0436361_0844713 | 3300039447 | Bacteria | 12707 |
| 377 | Ga0436363_0173701 | 3300039450 | Bacteria | 1595 |
| 378 | Ga0439465_0047967 | 3300041413 | Bacteria | 1393 |
| 379 | Ga0451802_0557563 | 3300041460 | Bacteria | 828 |
| 380 | Ga0451853_1119736 | 3300041512 | Bacteria | 2433 |
| 381 | Ga0450923_039893 | 3300042125 | Bacteria | 984 |
| 382 | Ga0466969_0029913 | 3300044656 | Bacteria | 2778 |
| 383 | Ga0466972_0101530 | 3300044658 | Bacteria | 1361 |
| 384 | Ga0453683_0007472 | 3300044673 | Bacteria | 7410 |
| 385 | Ga0453683_0012508 | 3300044673 | Bacteria | 5562 |
| 386 | Ga0453683_0013146 | 3300044673 | Bacteria | 5412 |
| 387 | Ga0453683_0026109 | 3300044673 | Unclassified | 3710 |
| 388 | Ga0466965_0041608 | 3300044683 | Bacteria | 2264 |
| 389 | Ga0466961_0242917 | 3300044693 | Bacteria | 1106 |
| 390 | Ga0466961_0290833 | 3300044693 | Bacteria | 999 |
| 391 | Ga0466968_0125363 | 3300044735 | Bacteria | 1165 |
| 392 | Ga0466970_0033719 | 3300044765 | Bacteria | 2707 |
| 393 | Ga0466957_0360466 | 3300044842 | Unclassified | 988 |
| 394 | Ga0466960_0001117 | 3300044901 | Bacteria | 9644 |
| 395 | Ga0466960_0162255 | 3300044901 | Bacteria | 1201 |
| 396 | Ga0466959_0028049 | 3300045049 | Bacteria | 4175 |
| 397 | Ga0451576_0501226 | 3300045051 | Bacteria | 1276 |
| 398 | Ga0466958_0334004 | 3300045836 | Bacteria | 975 |
| 399 | Ga0466958_0400604 | 3300045836 | Bacteria | 886 |
| 400 | Ga0466967_0032329 | 3300045976 | Bacteria | 4417 |
| 401 | Ga0466967_0087031 | 3300045976 | Bacteria | 2832 |
| 402 | Ga0466967_0427369 | 3300045976 | Bacteria | 1292 |
| 403 | Ga0466967_0546922 | 3300045976 | Bacteria | 1139 |
| 404 | Ga0466967_0851189 | 3300045976 | Bacteria | 906 |
| 405 | Ga0495592_0000621 | 3300046454 | Bacteria | 24971 |
| 406 | Ga0495651_0129888 | 3300046462 | Bacteria | 1840 |
| 407 | Ga0495651_0350706 | 3300046462 | Bacteria | 975 |
| 408 | Ga0495653_0038045 | 3300046463 | Bacteria | 3777 |
| 409 | Ga0495580_0333428 | 3300046472 | Bacteria | 1030 |
| 410 | Ga0495582_0187898 | 3300046473 | Bacteria | 1178 |
| 411 | Ga0495582_0305518 | 3300046473 | Bacteria | 915 |
| 412 | Ga0495605_0009386 | 3300046474 | Bacteria | 5496 |
| 413 | Ga0495664_0071725 | 3300046477 | Bacteria | 2069 |
| 414 | Ga0495608_0000406 | 3300046511 | Bacteria | 30178 |
| 415 | Ga0495616_0003806 | 3300046513 | Bacteria | 9616 |
| 416 | Ga0495618_0000068 | 3300046514 | Bacteria | 74614 |
| 417 | Ga0495620_0000315 | 3300046515 | Bacteria | 34463 |
| 418 | Ga0495628_0005324 | 3300046516 | Bacteria | 11286 |
| 419 | Ga0495628_0169083 | 3300046516 | Bacteria | 1658 |
| 420 | Ga0495628_0489227 | 3300046516 | Bacteria | 890 |
| 421 | Ga0495630_0001197 | 3300046517 | Bacteria | 17900 |
| 422 | Ga0495644_0000954 | 3300046523 | Bacteria | 11954 |
| 423 | Ga0495644_0108839 | 3300046523 | Bacteria | 1051 |
| 424 | Ga0495652_0425109 | 3300046529 | Bacteria | 935 |
| 425 | Ga0495640_0021376 | 3300046533 | Bacteria | 4750 |
| 426 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 427 | Ga0495667_0019918 | 3300046559 | Bacteria | 4526 |
| 428 | Ga0495668_0143676 | 3300046616 | Bacteria | 1306 |
| 429 | Ga0495634_0192731 | 3300046642 | Bacteria | 1270 |
| 430 | Ga0495635_0000009 | 3300046663 | Bacteria | 259024 |
| 431 | Ga0495635_0021925 | 3300046663 | Bacteria | 4451 |
| 432 | Ga0495661_0000281 | 3300046665 | Bacteria | 57922 |
| 433 | Ga0495657_0037476 | 3300046675 | Bacteria | 3342 |
| 434 | Ga0495599_0231041 | 3300046678 | Bacteria | 1129 |
| 435 | Ga0495658_0301734 | 3300046683 | Bacteria | 1013 |
| 436 | Ga0495613_0000249 | 3300046689 | Bacteria | 50975 |
| 437 | Ga0495613_0121706 | 3300046689 | Bacteria | 1874 |
| 438 | Ga0495624_0010426 | 3300046690 | Bacteria | 6407 |
| 439 | Ga0495589_0000230 | 3300046794 | Bacteria | 47199 |
| 440 | Ga0495600_0154022 | 3300046809 | Bacteria | 1487 |
| 441 | Ga0495604_0141683 | 3300047317 | Bacteria | 1717 |
| 442 | Ga0495676_0544181 | 3300047321 | Bacteria | 759 |
| 443 | Ga0495680_0000023 | 3300047322 | Bacteria | 116444 |
| 444 | Ga0495680_0016552 | 3300047322 | Bacteria | 6330 |
| 445 | Ga0495680_0344796 | 3300047322 | Bacteria | 1038 |
| 446 | Ga0495680_0441766 | 3300047322 | Bacteria | 892 |
| 447 | Ga0495683_0221163 | 3300047323 | Bacteria | 844 |
| 448 | Ga0495687_000013 | 3300047443 | Bacteria | 371058 |
| 449 | Ga0495677_0000041 | 3300047445 | Bacteria | 75366 |
| 450 | Ga0495684_0281190 | 3300047471 | Bacteria | 1200 |
| 451 | Ga0495684_0436473 | 3300047471 | Bacteria | 913 |
| 452 | Ga0495626_0000383 | 3300048091 | Bacteria | 45903 |
| 453 | Ga0496100_0000016 | 3300048903 | Bacteria | 166058 |
| 454 | Ga0496100_0220710 | 3300048903 | Bacteria | 1391 |
| 455 | Ga0496101_0000038 | 3300048904 | Bacteria | 166058 |
| 456 | Ga0496101_0039180 | 3300048904 | Bacteria | 3369 |
| 457 | Ga0496102_0004878 | 3300048905 | Bacteria | 11355 |
| 458 | Ga0496102_0042030 | 3300048905 | Bacteria | 4142 |
| 459 | Ga0496102_0082310 | 3300048905 | Bacteria | 2968 |
| 460 | Ga0496103_0004524 | 3300048906 | Bacteria | 8424 |
| 461 | Ga0496104_0004192 | 3300048907 | Bacteria | 12522 |
| 462 | Ga0496104_0075882 | 3300048907 | Bacteria | 3201 |
| 463 | Ga0496104_0550614 | 3300048907 | Bacteria | 1064 |
| 464 | Ga0496105_0005312 | 3300048908 | Bacteria | 9765 |
| 465 | Ga0496105_0015556 | 3300048908 | Bacteria | 6066 |
| 466 | Ga0496106_0000027 | 3300048909 | Bacteria | 149560 |
| 467 | Ga0496107_0000003 | 3300048910 | Bacteria | 304038 |
| 468 | Ga0496107_0146109 | 3300048910 | Bacteria | 1749 |
| 469 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 470 | Ga0496108_0054249 | 3300048911 | Bacteria | 3364 |
| 471 | Ga0496108_0222032 | 3300048911 | Bacteria | 1642 |
| 472 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 473 | Ga0496109_0043704 | 3300048912 | Bacteria | 4062 |
| 474 | Ga0496109_0187341 | 3300048912 | Bacteria | 1944 |
| 475 | Ga0496111_0302283 | 3300048914 | Bacteria | 1186 |
| 476 | Ga0496112_0000865 | 3300048915 | Bacteria | 21683 |
| 477 | Ga0496112_0105281 | 3300048915 | Bacteria | 2791 |
| 478 | Ga0496112_0112407 | 3300048915 | Bacteria | 2694 |
| 479 | Ga0496112_0243873 | 3300048915 | Bacteria | 1749 |
| 480 | Ga0496112_0305973 | 3300048915 | Bacteria | 1535 |
| 481 | Ga0496113_0003035 | 3300048916 | Bacteria | 9939 |
| 482 | Ga0496114_0009726 | 3300048917 | Bacteria | 7639 |
| 483 | Ga0496121_0017804 | 3300048924 | Bacteria | 7217 |
| 484 | Ga0496121_0211530 | 3300048924 | Bacteria | 1373 |
| 485 | Ga0496122_0007704 | 3300048925 | Bacteria | 11865 |
| 486 | Ga0496123_0048992 | 3300048926 | Bacteria | 2837 |
| 487 | Ga0496124_0035218 | 3300048927 | Bacteria | 4382 |
| 488 | Ga0501031_0020801 | 3300049568 | Bacteria | 4278 |
| 489 | Ga0501031_0050009 | 3300049568 | Bacteria | 2724 |
| 490 | Ga0501031_0126379 | 3300049568 | Bacteria | 1670 |
| 491 | Ga0501031_0129180 | 3300049568 | Bacteria | 1650 |
| 492 | Ga0501031_0137008 | 3300049568 | Bacteria | 1599 |
| 493 | Ga0501032_0038454 | 3300049569 | Bacteria | 3259 |
| 494 | Ga0501032_0146400 | 3300049569 | Bacteria | 1555 |
| 495 | Ga0501032_0190051 | 3300049569 | Bacteria | 1342 |
| 496 | Ga0501033_0154130 | 3300049570 | Bacteria | 1656 |
| 497 | Ga0501033_0193866 | 3300049570 | Bacteria | 1453 |
| 498 | Ga0501033_0408664 | 3300049570 | Bacteria | 946 |
| 499 | Ga0501034_0004370 | 3300049571 | Bacteria | 15752 |
| 500 | Ga0501034_0032768 | 3300049571 | Bacteria | 5276 |
| 501 | Ga0501034_0091981 | 3300049571 | Bacteria | 3031 |
| 502 | Ga0501034_0315504 | 3300049571 | Bacteria | 1497 |
| 503 | Ga0501034_0375683 | 3300049571 | Bacteria | 1347 |
| 504 | Ga0501034_0392963 | 3300049571 | Bacteria | 1311 |
| 505 | Ga0501034_0437014 | 3300049571 | Bacteria | 1228 |
| 506 | Ga0501034_0464813 | 3300049571 | Bacteria | 1182 |
| 507 | Ga0501034_0829253 | 3300049571 | Bacteria | 816 |
| 508 | Ga0501036_0001738 | 3300049572 | Bacteria | 16914 |
| 509 | Ga0501036_0020590 | 3300049572 | Bacteria | 5540 |
| 510 | Ga0501036_0404721 | 3300049572 | Bacteria | 1138 |
| 511 | Ga0501037_0068237 | 3300049573 | Bacteria | 2589 |
| 512 | Ga0501038_0217408 | 3300049574 | Bacteria | 1526 |
| 513 | Ga0501038_0274569 | 3300049574 | Bacteria | 1328 |
| 514 | Ga0501038_0277988 | 3300049574 | Bacteria | 1319 |
| 515 | Ga0501038_0450616 | 3300049574 | Bacteria | 989 |
| 516 | Ga0501039_0045845 | 3300049575 | Bacteria | 3378 |
| 517 | Ga0501039_0048602 | 3300049575 | Bacteria | 3279 |
| 518 | Ga0501039_0262560 | 3300049575 | Bacteria | 1357 |
| 519 | Ga0501039_0346725 | 3300049575 | Bacteria | 1167 |
| 520 | Ga0501039_0382561 | 3300049575 | Bacteria | 1105 |
| 521 | Ga0501039_0510185 | 3300049575 | Bacteria | 944 |
| 522 | Ga0501040_0002511 | 3300049576 | Bacteria | 11815 |
| 523 | Ga0501040_0042838 | 3300049576 | Bacteria | 3084 |
| 524 | Ga0501040_0088595 | 3300049576 | Bacteria | 2149 |
| 525 | Ga0501041_0001860 | 3300049577 | Bacteria | 11813 |
| 526 | Ga0501041_0045642 | 3300049577 | Bacteria | 2664 |
| 527 | Ga0501041_0145441 | 3300049577 | Bacteria | 1479 |
| 528 | Ga0501041_0190116 | 3300049577 | Bacteria | 1286 |
| 529 | Ga0501042_0016718 | 3300049578 | Bacteria | 5043 |
| 530 | Ga0501042_0110376 | 3300049578 | Bacteria | 1981 |
| 531 | Ga0501042_0206628 | 3300049578 | Bacteria | 1416 |
| 532 | Ga0501042_0252502 | 3300049578 | Bacteria | 1272 |
| 533 | Ga0501042_0258736 | 3300049578 | Bacteria | 1256 |
| 534 | Ga0501046_0007642 | 3300049580 | Bacteria | 9484 |
| 535 | Ga0501047_0670830 | 3300049581 | Bacteria | 855 |
| 536 | Ga0501048_0006497 | 3300049582 | Bacteria | 8886 |
| 537 | Ga0501048_0018852 | 3300049582 | Bacteria | 5072 |
| 538 | Ga0501048_0044915 | 3300049582 | Bacteria | 3157 |
| 539 | Ga0501068_0018481 | 3300049584 | Bacteria | 4036 |
| 540 | Ga0501069_0002990 | 3300049585 | Bacteria | 8709 |
| 541 | Ga0501070_0024213 | 3300049586 | Bacteria | 5091 |
| 542 | Ga0501070_0142423 | 3300049586 | Bacteria | 1979 |
| 543 | Ga0501070_0369583 | 3300049586 | Bacteria | 1162 |
| 544 | Ga0501070_0441524 | 3300049586 | Bacteria | 1050 |
| 545 | Ga0501070_0605217 | 3300049586 | Bacteria | 873 |
| 546 | Ga0501071_0000625 | 3300049587 | Bacteria | 18359 |
| 547 | Ga0501071_0001478 | 3300049587 | Bacteria | 13670 |
| 548 | Ga0501071_0170767 | 3300049587 | Bacteria | 1628 |
| 549 | Ga0501072_0000386 | 3300049588 | Bacteria | 31596 |
| 550 | Ga0501072_0002715 | 3300049588 | Bacteria | 13289 |
| 551 | Ga0501072_0003405 | 3300049588 | Bacteria | 11975 |
| 552 | Ga0501072_0032612 | 3300049588 | Bacteria | 4080 |
| 553 | Ga0501072_0067133 | 3300049588 | Bacteria | 2830 |
| 554 | Ga0501073_0016136 | 3300049589 | Bacteria | 5414 |
| 555 | Ga0501074_0003903 | 3300049590 | Bacteria | 10622 |
| 556 | Ga0501074_0047691 | 3300049590 | Bacteria | 3096 |
| 557 | Ga0501074_0338868 | 3300049590 | Bacteria | 1067 |
| 558 | Ga0501075_0002467 | 3300049591 | Bacteria | 12329 |
| 559 | Ga0501075_0082016 | 3300049591 | Bacteria | 2442 |
| 560 | Ga0501075_0144662 | 3300049591 | Bacteria | 1812 |
| 561 | Ga0501075_0161922 | 3300049591 | Bacteria | 1707 |
| 562 | Ga0501075_0197673 | 3300049591 | Bacteria | 1533 |
| 563 | Ga0501075_0282508 | 3300049591 | Bacteria | 1265 |
| 564 | Ga0501076_0001538 | 3300049592 | Bacteria | 15449 |
| 565 | Ga0501076_0004911 | 3300049592 | Bacteria | 9569 |
| 566 | Ga0501076_0022847 | 3300049592 | Bacteria | 4812 |
| 567 | Ga0501076_0054181 | 3300049592 | Bacteria | 3178 |
| 568 | Ga0501076_0128469 | 3300049592 | Bacteria | 2054 |
| 569 | Ga0501076_0242484 | 3300049592 | Bacteria | 1475 |
| 570 | Ga0501076_0412852 | 3300049592 | Bacteria | 1110 |
| 571 | Ga0501077_0001046 | 3300049593 | Bacteria | 16700 |
| 572 | Ga0501077_0014506 | 3300049593 | Bacteria | 4952 |
| 573 | Ga0501077_0250064 | 3300049593 | Bacteria | 1127 |
| 574 | Ga0501079_0001142 | 3300049741 | Bacteria | 18543 |
| 575 | Ga0501079_0044291 | 3300049741 | Bacteria | 3434 |
| 576 | Ga0501079_0231157 | 3300049741 | Bacteria | 1444 |
| 577 | Ga0501079_0295867 | 3300049741 | Bacteria | 1266 |
| 578 | Ga0501080_0000913 | 3300049742 | Bacteria | 24164 |
| 579 | Ga0501080_0059538 | 3300049742 | Bacteria | 3554 |
| 580 | Ga0501080_0134152 | 3300049742 | Bacteria | 2292 |
| 581 | Ga0501081_0004652 | 3300049743 | Bacteria | 8823 |
| 582 | Ga0501081_0032354 | 3300049743 | Bacteria | 3548 |
| 583 | Ga0501081_0037058 | 3300049743 | Bacteria | 3327 |
| 584 | Ga0501081_0128457 | 3300049743 | Bacteria | 1809 |
| 585 | Ga0501081_0168946 | 3300049743 | Bacteria | 1578 |
| 586 | Ga0501083_0069809 | 3300049744 | Bacteria | 2338 |
| 587 | Ga0501083_0329021 | 3300049744 | Bacteria | 994 |
| 588 | Ga0501268_041896 | 3300049765 | Bacteria | 864 |
| 589 | Ga0501035_0028544 | 3300049822 | Bacteria | 5093 |
| 590 | Ga0501035_0092270 | 3300049822 | Bacteria | 2665 |
| 591 | Ga0501035_0121332 | 3300049822 | Bacteria | 2284 |
| 592 | Ga0501035_0340064 | 3300049822 | Bacteria | 1258 |
| 593 | Ga0501045_0001817 | 3300049824 | Bacteria | 14417 |
| 594 | Ga0501045_0043638 | 3300049824 | Bacteria | 3266 |
| 595 | Ga0501045_0077048 | 3300049824 | Bacteria | 2457 |
| 596 | Ga0501045_0160457 | 3300049824 | Bacteria | 1673 |
| 597 | nmdc:mga0yw44_10101_c1 | 3300050492 | Bacteria | 4806 |
| 598 | nmdc:mga0yw44_150642_c1 | 3300050492 | Bacteria | 1517 |
| 599 | nmdc:mga05p37_15530_c1 | 3300050507 | Bacteria | 9153 |
| 600 | nmdc:mga05p37_221961_c1 | 3300050507 | Bacteria | 2280 |
| 601 | nmdc:mga05p37_26018_c1 | 3300050507 | Bacteria | 7114 |
| 602 | nmdc:mga05p37_301741_c1 | 3300050507 | Bacteria | 1902 |
| 603 | nmdc:mga05p37_309164_c1 | 3300050507 | Bacteria | 1874 |
| 604 | nmdc:mga05p37_425_c1 | 3300050507 | Bacteria | 45660 |
| 605 | nmdc:mga05p37_860988_c1 | 3300050507 | Bacteria | 983 |
| 606 | nmdc:mga09592_109993_c1 | 3300050508 | Bacteria | 2364 |
| 607 | nmdc:mga09592_222728_c1 | 3300050508 | Bacteria | 1634 |
| 608 | nmdc:mga09592_5791_c1 | 3300050508 | Bacteria | 10077 |
| 609 | nmdc:mga0qj67_456876_c1 | 3300050509 | Bacteria | 1028 |
| 610 | nmdc:mga0qj67_72633_c1 | 3300050509 | Bacteria | 2747 |
| 611 | nmdc:mga0qj67_82225_c1 | 3300050509 | Bacteria | 2583 |
| 612 | nmdc:mga06r32_225329_c1 | 3300050510 | Bacteria | 1863 |
| 613 | nmdc:mga06r32_340846_c1 | 3300050510 | Bacteria | 1484 |
| 614 | nmdc:mga06r32_754462_c1 | 3300050510 | Bacteria | 936 |
| 615 | nmdc:mga08y16_12_c1 | 3300050511 | Bacteria | 438455 |
| 616 | nmdc:mga08y16_77303_c1 | 3300050511 | Bacteria | 3470 |
| 617 | nmdc:mga0n895_343776_c1 | 3300050512 | Bacteria | 1511 |
| 618 | nmdc:mga0n895_79740_c1 | 3300050512 | Bacteria | 3261 |
| 619 | nmdc:mga08x19_271_c1 | 3300050514 | Bacteria | 39236 |
| 620 | nmdc:mga0a205_104623_c1 | 3300050515 | Bacteria | 2730 |
| 621 | Ga0495601_0007009 | 3300053077 | Bacteria | 6604 |
| 622 | Ga0495595_0000109 | 3300053084 | Bacteria | 37617 |
| 623 | Ga0495619_0000507 | 3300053085 | Bacteria | 25923 |
| 624 | Ga0495619_0006443 | 3300053085 | Bacteria | 7431 |
| 625 | Ga0495619_0366658 | 3300053085 | Bacteria | 996 |
| 626 | Ga0500566_0000485 | 3300053094 | Bacteria | 22158 |
| 627 | Ga0500568_0000023 | 3300053139 | Bacteria | 176763 |
| 628 | Ga0500616_0012886 | 3300053153 | Bacteria | 4874 |
| 629 | Ga0501084_0010731 | 3300054114 | Bacteria | 7584 |
| 630 | Ga0501084_0018018 | 3300054114 | Bacteria | 5880 |
| 631 | Ga0501084_0055867 | 3300054114 | Bacteria | 3304 |
| 632 | Ga0590075_010220 | 3300059424 | Bacteria | 2258 |
| 633 | Ga0587066_003568 | 3300059490 | Bacteria | 1841 |
| 634 | Ga0587066_039218 | 3300059490 | Bacteria | 885 |
| 635 | Ga0587073_0006032 | 3300059492 | Bacteria | 1842 |
| 636 | Ga0587083_0030674 | 3300059505 | Bacteria | 1068 |
| 637 | Ga0587088_006433 | 3300059508 | Bacteria | 1585 |
| 638 | Ga0587090_003437 | 3300059510 | Bacteria | 1840 |
| 639 | Ga0587091_006150 | 3300059511 | Bacteria | 1673 |
| 640 | Ga0587094_002452 | 3300059513 | Bacteria | 1924 |
| 641 | Ga0587113_004512 | 3300059625 | Bacteria | 1111 |
| 642 | Ga0587115_002426 | 3300059626 | Bacteria | 1853 |
| 643 | Ga0587067_003434 | 3300059640 | Bacteria | 1979 |
| 644 | Ga0587072_028080 | 3300059643 | Bacteria | 1036 |
| 645 | Ga0587075_002953 | 3300059644 | Bacteria | 1852 |
| 646 | Ga0587076_006926 | 3300059645 | Bacteria | 1530 |
| 647 | Ga0587079_004079 | 3300059647 | Bacteria | 1959 |
| 648 | Ga0587079_012111 | 3300059647 | Bacteria | 1402 |
| 649 | Ga0587079_028100 | 3300059647 | Bacteria | 1063 |
| 650 | Ga0587079_032495 | 3300059647 | Bacteria | 1011 |
| 651 | Ga0587071_005131 | 3300060344 | Bacteria | 1989 |
| 652 | Ga0587071_053299 | 3300060344 | Bacteria | 842 |
| 653 | Ga0501082_0011025 | 3300060353 | Bacteria | 7773 |
| 654 | Ga0501082_0034466 | 3300060353 | Bacteria | 4364 |
| 655 | Ga0501082_0206629 | 3300060353 | Bacteria | 1708 |
| 656 | Ga0530510_0028327 | 3300061734 | Bacteria | 4016 |
| 657 | Ga0530510_0302652 | 3300061734 | Bacteria | 1196 |
| 658 | Ga0530510_0416483 | 3300061734 | Bacteria | 1014 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048905 | Ga0496102_0042030 | Ga0496102_0042030_21_650 | 192 |
| 2 | 3300047321 | Ga0495676_0544181 | Ga0495676_0544181_103_747 | 198 |
| 3 | 3300037312 | Ga0395899_0379779 | Ga0395899_0379779_25_690 | 200 |
| 4 | 3300049743 | Ga0501081_0037058 | Ga0501081_0037058_2615_3280 | 204 |
| 5 | 3300049744 | Ga0501083_0329021 | Ga0501083_0329021_40_705 | 204 |
| 6 | 3300047323 | Ga0495683_0221163 | Ga0495683_0221163_11_637 | 207 |
| 7 | 3300059644 | Ga0587075_002953 | Ga0587075_002953_556_1242 | 207 |
| 8 | 3300005618 | Ga0068864_100109513 | Ga0068864_1001095133 | 212 |
| 9 | 3300026095 | Ga0207676_10018963 | Ga0207676_100189633 | 212 |
| 10 | 3300005354 | Ga0070675_100004821 | Ga0070675_1000048214 | 214 |
| 11 | 3300005543 | Ga0070672_100277926 | Ga0070672_1002779263 | 214 |
| 12 | 3300025926 | Ga0207659_10092224 | Ga0207659_100922242 | 214 |
| 13 | 3300025940 | Ga0207691_10287043 | Ga0207691_102870432 | 214 |
| 14 | 3300006358 | Ga0068871_100205470 | Ga0068871_1002054702 | 215 |
| 15 | 3300014326 | Ga0157380_10874229 | Ga0157380_108742291 | 218 |
| 16 | 3300005445 | Ga0070708_100520803 | Ga0070708_1005208031 | 220 |
| 17 | 3300035117 | Ga0373953_0010641 | Ga0373953_0010641_344_1072 | 220 |
| 18 | 3300049765 | Ga0501268_041896 | Ga0501268_041896_99_842 | 220 |
| 19 | 3300053085 | Ga0495619_0366658 | Ga0495619_0366658_252_983 | 220 |
| 20 | 3300005466 | Ga0070685_10176207 | Ga0070685_101762072 | 221 |
| 21 | 3300048908 | Ga0496105_0015556 | Ga0496105_0015556_3342_4064 | 221 |
| 22 | 3300005435 | Ga0070714_100190398 | Ga0070714_1001903982 | 223 |
| 23 | 3300005436 | Ga0070713_100367587 | Ga0070713_1003675872 | 223 |
| 24 | 3300005439 | Ga0070711_100061287 | Ga0070711_1000612872 | 223 |
| 25 | 3300005471 | Ga0070698_100017096 | Ga0070698_1000170964 | 223 |
| 26 | 3300005536 | Ga0070697_100109851 | Ga0070697_1001098512 | 223 |
| 27 | 3300005546 | Ga0070696_100166444 | Ga0070696_1001664442 | 223 |
| 28 | 3300025915 | Ga0207693_10014840 | Ga0207693_100148407 | 223 |
| 29 | 3300025916 | Ga0207663_10169555 | Ga0207663_101695552 | 223 |
| 30 | 3300025922 | Ga0207646_10198396 | Ga0207646_101983962 | 223 |
| 31 | 3300025929 | Ga0207664_10115911 | Ga0207664_101159112 | 223 |
| 32 | 3300025939 | Ga0207665_10003333 | Ga0207665_1000333315 | 223 |
| 33 | 3300046517 | Ga0495630_0001197 | Ga0495630_0001197_12370_13098 | 223 |
| 34 | 3300046642 | Ga0495634_0192731 | Ga0495634_0192731_466_1194 | 223 |
| 35 | 3300046675 | Ga0495657_0037476 | Ga0495657_0037476_1494_2222 | 223 |
| 36 | 3300046689 | Ga0495613_0121706 | Ga0495613_0121706_717_1445 | 223 |
| 37 | 3300048911 | Ga0496108_0054249 | Ga0496108_0054249_2405_3151 | 223 |
| 38 | 3300048912 | Ga0496109_0187341 | Ga0496109_0187341_270_1016 | 223 |
| 39 | 3300048914 | Ga0496111_0302283 | Ga0496111_0302283_178_924 | 223 |
| 40 | 3300053077 | Ga0495601_0007009 | Ga0495601_0007009_1508_2236 | 223 |
| 41 | 3300053085 | Ga0495619_0000507 | Ga0495619_0000507_14894_15622 | 223 |
| 42 | 3300005338 | Ga0068868_100480151 | Ga0068868_1004801511 | 224 |
| 43 | 3300005354 | Ga0070675_100376558 | Ga0070675_1003765581 | 224 |
| 44 | 3300005468 | Ga0070707_100127244 | Ga0070707_1001272442 | 224 |
| 45 | 3300005536 | Ga0070697_100249073 | Ga0070697_1002490732 | 224 |
| 46 | 3300005536 | Ga0070697_100518258 | Ga0070697_1005182581 | 224 |
| 47 | 3300005545 | Ga0070695_100445968 | Ga0070695_1004459681 | 224 |
| 48 | 3300006173 | Ga0070716_100126228 | Ga0070716_1001262282 | 224 |
| 49 | 3300006175 | Ga0070712_100075449 | Ga0070712_1000754494 | 224 |
| 50 | 3300009098 | Ga0105245_10198626 | Ga0105245_101986262 | 224 |
| 51 | 3300013296 | Ga0157374_10302916 | Ga0157374_103029162 | 224 |
| 52 | 3300014745 | Ga0157377_10049076 | Ga0157377_100490763 | 224 |
| 53 | 3300017792 | Ga0163161_10134451 | Ga0163161_101344512 | 224 |
| 54 | 3300025915 | Ga0207693_10410335 | Ga0207693_104103352 | 224 |
| 55 | 3300025922 | Ga0207646_10186769 | Ga0207646_101867692 | 224 |
| 56 | 3300025927 | Ga0207687_10310159 | Ga0207687_103101591 | 224 |
| 57 | 3300026023 | Ga0207677_10106584 | Ga0207677_101065842 | 224 |
| 58 | 3300026118 | Ga0207675_100011334 | Ga0207675_1000113344 | 224 |
| 59 | 3300037312 | Ga0395899_0006629 | Ga0395899_0006629_1602_2357 | 224 |
| 60 | 3300037418 | Ga0395900_0044122 | Ga0395900_0044122_3567_4322 | 224 |
| 61 | 3300037466 | Ga0395898_0009520 | Ga0395898_0009520_9044_9799 | 224 |
| 62 | 3300037471 | Ga0395905_0089298 | Ga0395905_0089298_1180_1935 | 224 |
| 63 | 3300038443 | Ga0395901_0075799 | Ga0395901_0075799_664_1407 | 224 |
| 64 | 3300038443 | Ga0395901_0220521 | Ga0395901_0220521_274_1029 | 224 |
| 65 | 3300045976 | Ga0466967_0087031 | Ga0466967_0087031_359_1105 | 225 |
| 66 | 3300025912 | Ga0207707_10225301 | Ga0207707_102253012 | 230 |
| 67 | 3300049571 | Ga0501034_0392963 | Ga0501034_0392963_125_877 | 230 |
| 68 | 3300049571 | Ga0501034_0032768 | Ga0501034_0032768_1604_2353 | 231 |
| 69 | 3300006038 | Ga0075365_10222185 | Ga0075365_102221852 | 232 |
| 70 | 3300049571 | Ga0501034_0375683 | Ga0501034_0375683_327_1088 | 232 |
| 71 | 3300049574 | Ga0501038_0217408 | Ga0501038_0217408_176_937 | 232 |
| 72 | 3300049581 | Ga0501047_0670830 | Ga0501047_0670830_62_823 | 232 |
| 73 | 3300049742 | Ga0501080_0134152 | Ga0501080_0134152_583_1344 | 232 |
| 74 | 3300050492 | nmdc:mga0yw44_150642_c1 | nmdc:mga0yw44_150642_c1_655_1482 | 232 |
| 75 | 3300006880 | Ga0075429_100031945 | Ga0075429_1000319453 | 233 |
| 76 | 3300021388 | Ga0213875_10028692 | Ga0213875_100286923 | 233 |
| 77 | 3300028654 | Ga0265322_10031122 | Ga0265322_100311222 | 233 |
| 78 | 3300031251 | Ga0265327_10164329 | Ga0265327_101643291 | 233 |
| 79 | 3300031901 | Ga0307406_10073881 | Ga0307406_100738812 | 233 |
| 80 | 3300031903 | Ga0307407_10197494 | Ga0307407_101974942 | 233 |
| 81 | 3300031995 | Ga0307409_100325375 | Ga0307409_1003253752 | 233 |
| 82 | 3300032002 | Ga0307416_100068182 | Ga0307416_1000681823 | 233 |
| 83 | 3300032004 | Ga0307414_10074782 | Ga0307414_100747823 | 233 |
| 84 | 3300032005 | Ga0307411_10054261 | Ga0307411_100542613 | 233 |
| 85 | 3300032126 | Ga0307415_100042956 | Ga0307415_1000429563 | 233 |
| 86 | 3300039450 | Ga0436363_0173701 | Ga0436363_0173701_96_890 | 233 |
| 87 | 3300041460 | Ga0451802_0557563 | Ga0451802_0557563_33_809 | 233 |
| 88 | 3300050508 | nmdc:mga09592_222728_c1 | nmdc:mga09592_222728_c1_340_1098 | 233 |
| 89 | 3300053094 | Ga0500566_0000485 | Ga0500566_0000485_19066_19812 | 233 |
| 90 | 3300002773 | JGI25152J39213_1000382 | JGI25152J39213_100038222 | 234 |
| 91 | 3300025258 | Ga0209129_1000411 | Ga0209129_10004111 | 234 |
| 92 | 3300025294 | Ga0209025_1001516 | Ga0209025_100151620 | 234 |
| 93 | 3300044901 | Ga0466960_0162255 | Ga0466960_0162255_176_934 | 234 |
| 94 | 3300048924 | Ga0496121_0017804 | Ga0496121_0017804_2120_2875 | 234 |
| 95 | 3300049568 | Ga0501031_0050009 | Ga0501031_0050009_282_1058 | 234 |
| 96 | 3300049569 | Ga0501032_0190051 | Ga0501032_0190051_508_1284 | 234 |
| 97 | 3300049570 | Ga0501033_0408664 | Ga0501033_0408664_139_915 | 234 |
| 98 | 3300049572 | Ga0501036_0020590 | Ga0501036_0020590_1880_2656 | 234 |
| 99 | 3300049574 | Ga0501038_0274569 | Ga0501038_0274569_373_1149 | 234 |
| 100 | 3300049575 | Ga0501039_0382561 | Ga0501039_0382561_153_929 | 234 |
| 101 | 3300049576 | Ga0501040_0042838 | Ga0501040_0042838_44_820 | 234 |
| 102 | 3300049582 | Ga0501048_0044915 | Ga0501048_0044915_1761_2537 | 234 |
| 103 | 3300049586 | Ga0501070_0441524 | Ga0501070_0441524_242_1009 | 234 |
| 104 | 3300049587 | Ga0501071_0000625 | Ga0501071_0000625_4799_5575 | 234 |
| 105 | 3300049588 | Ga0501072_0002715 | Ga0501072_0002715_10384_11160 | 234 |
| 106 | 3300049590 | Ga0501074_0047691 | Ga0501074_0047691_1471_2247 | 234 |
| 107 | 3300049591 | Ga0501075_0082016 | Ga0501075_0082016_1507_2283 | 234 |
| 108 | 3300049592 | Ga0501076_0022847 | Ga0501076_0022847_699_1475 | 234 |
| 109 | 3300049822 | Ga0501035_0092270 | Ga0501035_0092270_1121_1897 | 234 |
| 110 | 3300053139 | Ga0500568_0000023 | Ga0500568_0000023_141568_142323 | 234 |
| 111 | 3300060353 | Ga0501082_0034466 | Ga0501082_0034466_3014_3790 | 234 |
| 112 | 3300005295 | Ga0065707_10137443 | Ga0065707_101374432 | 235 |
| 113 | 3300005354 | Ga0070675_100044230 | Ga0070675_1000442304 | 235 |
| 114 | 3300005438 | Ga0070701_10215201 | Ga0070701_102152011 | 235 |
| 115 | 3300005440 | Ga0070705_100002225 | Ga0070705_1000022258 | 235 |
| 116 | 3300005440 | Ga0070705_100476761 | Ga0070705_1004767611 | 235 |
| 117 | 3300005445 | Ga0070708_100117158 | Ga0070708_1001171582 | 235 |
| 118 | 3300005458 | Ga0070681_10019064 | Ga0070681_100190648 | 235 |
| 119 | 3300005468 | Ga0070707_100383151 | Ga0070707_1003831511 | 235 |
| 120 | 3300005471 | Ga0070698_100001223 | Ga0070698_10000122325 | 235 |
| 121 | 3300005471 | Ga0070698_100065938 | Ga0070698_1000659387 | 235 |
| 122 | 3300005536 | Ga0070697_100680958 | Ga0070697_1006809581 | 235 |
| 123 | 3300005546 | Ga0070696_100005405 | Ga0070696_1000054058 | 235 |
| 124 | 3300005549 | Ga0070704_100472003 | Ga0070704_1004720031 | 235 |
| 125 | 3300005614 | Ga0068856_100113585 | Ga0068856_1001135852 | 235 |
| 126 | 3300005844 | Ga0068862_100283228 | Ga0068862_1002832282 | 235 |
| 127 | 3300005981 | Ga0081538_10003657 | Ga0081538_1000365712 | 235 |
| 128 | 3300005981 | Ga0081538_10025024 | Ga0081538_100250244 | 235 |
| 129 | 3300006844 | Ga0075428_100000018 | Ga0075428_10000001823 | 235 |
| 130 | 3300006846 | Ga0075430_100105653 | Ga0075430_1001056534 | 235 |
| 131 | 3300006847 | Ga0075431_100069197 | Ga0075431_1000691974 | 235 |
| 132 | 3300006847 | Ga0075431_100509143 | Ga0075431_1005091431 | 235 |
| 133 | 3300006852 | Ga0075433_10157527 | Ga0075433_101575272 | 235 |
| 134 | 3300006871 | Ga0075434_100062149 | Ga0075434_1000621493 | 235 |
| 135 | 3300006871 | Ga0075434_100271272 | Ga0075434_1002712722 | 235 |
| 136 | 3300009094 | Ga0111539_10000011 | Ga0111539_10000011302 | 235 |
| 137 | 3300009147 | Ga0114129_10001531 | Ga0114129_1000153114 | 235 |
| 138 | 3300021361 | Ga0213872_10025369 | Ga0213872_100253691 | 235 |
| 139 | 3300025926 | Ga0207659_10088635 | Ga0207659_100886354 | 235 |
| 140 | 3300025927 | Ga0207687_10099995 | Ga0207687_100999952 | 235 |
| 141 | 3300026023 | Ga0207677_10287502 | Ga0207677_102875022 | 235 |
| 142 | 3300026078 | Ga0207702_10053276 | Ga0207702_100532763 | 235 |
| 143 | 3300027907 | Ga0207428_10000023 | Ga0207428_1000002321 | 235 |
| 144 | 3300028654 | Ga0265322_10015429 | Ga0265322_100154292 | 235 |
| 145 | 3300031344 | Ga0265316_10068062 | Ga0265316_100680622 | 235 |
| 146 | 3300035118 | Ga0373954_0159547 | Ga0373954_0159547_245_1021 | 235 |
| 147 | 3300035410 | Ga0373924_0089775 | Ga0373924_0089775_416_1192 | 235 |
| 148 | 3300036401 | Ga0373937_0699043 | Ga0373937_0699043_12_788 | 235 |
| 149 | 3300037853 | Ga0436364_0631327 | Ga0436364_0631327_3537_4343 | 235 |
| 150 | 3300038443 | Ga0395901_0376943 | Ga0395901_0376943_336_1103 | 235 |
| 151 | 3300042125 | Ga0450923_039893 | Ga0450923_039893_34_819 | 235 |
| 152 | 3300044673 | Ga0453683_0012508 | Ga0453683_0012508_4764_5549 | 235 |
| 153 | 3300044673 | Ga0453683_0013146 | Ga0453683_0013146_2326_3114 | 235 |
| 154 | 3300045836 | Ga0466958_0334004 | Ga0466958_0334004_47_823 | 235 |
| 155 | 3300045836 | Ga0466958_0400604 | Ga0466958_0400604_75_851 | 235 |
| 156 | 3300045976 | Ga0466967_0851189 | Ga0466967_0851189_95_862 | 235 |
| 157 | 3300047322 | Ga0495680_0344796 | Ga0495680_0344796_82_858 | 235 |
| 158 | 3300048915 | Ga0496112_0243873 | Ga0496112_0243873_576_1343 | 235 |
| 159 | 3300049568 | Ga0501031_0129180 | Ga0501031_0129180_297_1064 | 235 |
| 160 | 3300049570 | Ga0501033_0193866 | Ga0501033_0193866_85_891 | 235 |
| 161 | 3300049571 | Ga0501034_0004370 | Ga0501034_0004370_8914_9681 | 235 |
| 162 | 3300049571 | Ga0501034_0829253 | Ga0501034_0829253_33_800 | 235 |
| 163 | 3300049573 | Ga0501037_0068237 | Ga0501037_0068237_52_819 | 235 |
| 164 | 3300049575 | Ga0501039_0048602 | Ga0501039_0048602_2494_3261 | 235 |
| 165 | 3300049576 | Ga0501040_0088595 | Ga0501040_0088595_1358_2125 | 235 |
| 166 | 3300049577 | Ga0501041_0045642 | Ga0501041_0045642_1211_1978 | 235 |
| 167 | 3300049577 | Ga0501041_0190116 | Ga0501041_0190116_315_1100 | 235 |
| 168 | 3300049578 | Ga0501042_0252502 | Ga0501042_0252502_451_1218 | 235 |
| 169 | 3300049582 | Ga0501048_0018852 | Ga0501048_0018852_3321_4088 | 235 |
| 170 | 3300049586 | Ga0501070_0142423 | Ga0501070_0142423_1200_1961 | 235 |
| 171 | 3300049586 | Ga0501070_0605217 | Ga0501070_0605217_18_785 | 235 |
| 172 | 3300049588 | Ga0501072_0003405 | Ga0501072_0003405_44_811 | 235 |
| 173 | 3300049588 | Ga0501072_0032612 | Ga0501072_0032612_510_1316 | 235 |
| 174 | 3300049591 | Ga0501075_0144662 | Ga0501075_0144662_191_976 | 235 |
| 175 | 3300049591 | Ga0501075_0197673 | Ga0501075_0197673_35_802 | 235 |
| 176 | 3300049591 | Ga0501075_0282508 | Ga0501075_0282508_213_998 | 235 |
| 177 | 3300049592 | Ga0501076_0004911 | Ga0501076_0004911_2621_3388 | 235 |
| 178 | 3300049592 | Ga0501076_0242484 | Ga0501076_0242484_321_1106 | 235 |
| 179 | 3300049593 | Ga0501077_0250064 | Ga0501077_0250064_70_876 | 235 |
| 180 | 3300049741 | Ga0501079_0231157 | Ga0501079_0231157_52_819 | 235 |
| 181 | 3300049743 | Ga0501081_0032354 | Ga0501081_0032354_2606_3391 | 235 |
| 182 | 3300049743 | Ga0501081_0128457 | Ga0501081_0128457_871_1677 | 235 |
| 183 | 3300049743 | Ga0501081_0168946 | Ga0501081_0168946_42_809 | 235 |
| 184 | 3300049744 | Ga0501083_0069809 | Ga0501083_0069809_1436_2242 | 235 |
| 185 | 3300049822 | Ga0501035_0340064 | Ga0501035_0340064_385_1170 | 235 |
| 186 | 3300049824 | Ga0501045_0043638 | Ga0501045_0043638_2459_3226 | 235 |
| 187 | 3300049824 | Ga0501045_0160457 | Ga0501045_0160457_655_1461 | 235 |
| 188 | 3300050507 | nmdc:mga05p37_425_c1 | nmdc:mga05p37_425_c1_30153_30938 | 235 |
| 189 | 3300050509 | nmdc:mga0qj67_72633_c1 | nmdc:mga0qj67_72633_c1_1616_2401 | 235 |
| 190 | 3300050510 | nmdc:mga06r32_225329_c1 | nmdc:mga06r32_225329_c1_838_1623 | 235 |
| 191 | 3300050511 | nmdc:mga08y16_12_c1 | nmdc:mga08y16_12_c1_338064_338849 | 235 |
| 192 | 3300061734 | Ga0530510_0302652 | Ga0530510_0302652_69_836 | 235 |
| 193 | 3300003323 | rootH1_10026887 | rootH1_100268872 | 236 |
| 194 | 3300005329 | Ga0070683_100008203 | Ga0070683_1000082036 | 236 |
| 195 | 3300005329 | Ga0070683_100121625 | Ga0070683_1001216252 | 236 |
| 196 | 3300005336 | Ga0070680_100053941 | Ga0070680_1000539411 | 236 |
| 197 | 3300005337 | Ga0070682_100000102 | Ga0070682_10000010257 | 236 |
| 198 | 3300005337 | Ga0070682_100053250 | Ga0070682_1000532502 | 236 |
| 199 | 3300005347 | Ga0070668_100019331 | Ga0070668_1000193311 | 236 |
| 200 | 3300005353 | Ga0070669_100004092 | Ga0070669_1000040924 | 236 |
| 201 | 3300005435 | Ga0070714_100000036 | Ga0070714_100000036121 | 236 |
| 202 | 3300005435 | Ga0070714_100475281 | Ga0070714_1004752812 | 236 |
| 203 | 3300005436 | Ga0070713_100021009 | Ga0070713_1000210092 | 236 |
| 204 | 3300005436 | Ga0070713_100231567 | Ga0070713_1002315672 | 236 |
| 205 | 3300005437 | Ga0070710_10011130 | Ga0070710_100111302 | 236 |
| 206 | 3300005439 | Ga0070711_100010804 | Ga0070711_1000108042 | 236 |
| 207 | 3300005439 | Ga0070711_100017660 | Ga0070711_1000176605 | 236 |
| 208 | 3300005439 | Ga0070711_100126795 | Ga0070711_1001267952 | 236 |
| 209 | 3300005445 | Ga0070708_100000432 | Ga0070708_1000004326 | 236 |
| 210 | 3300005456 | Ga0070678_100040753 | Ga0070678_1000407532 | 236 |
| 211 | 3300005457 | Ga0070662_100337106 | Ga0070662_1003371062 | 236 |
| 212 | 3300005458 | Ga0070681_10013783 | Ga0070681_100137832 | 236 |
| 213 | 3300005458 | Ga0070681_10014858 | Ga0070681_1001485812 | 236 |
| 214 | 3300005467 | Ga0070706_100111320 | Ga0070706_1001113203 | 236 |
| 215 | 3300005467 | Ga0070706_100424266 | Ga0070706_1004242662 | 236 |
| 216 | 3300005518 | Ga0070699_100035593 | Ga0070699_1000355935 | 236 |
| 217 | 3300005518 | Ga0070699_100619927 | Ga0070699_1006199271 | 236 |
| 218 | 3300005530 | Ga0070679_100159924 | Ga0070679_1001599244 | 236 |
| 219 | 3300005535 | Ga0070684_100009587 | Ga0070684_1000095876 | 236 |
| 220 | 3300005535 | Ga0070684_100034149 | Ga0070684_1000341493 | 236 |
| 221 | 3300005535 | Ga0070684_100079113 | Ga0070684_1000791132 | 236 |
| 222 | 3300005535 | Ga0070684_100323837 | Ga0070684_1003238371 | 236 |
| 223 | 3300005536 | Ga0070697_100020931 | Ga0070697_1000209313 | 236 |
| 224 | 3300005536 | Ga0070697_100033855 | Ga0070697_1000338554 | 236 |
| 225 | 3300005546 | Ga0070696_100608303 | Ga0070696_1006083031 | 236 |
| 226 | 3300005547 | Ga0070693_100012950 | Ga0070693_1000129505 | 236 |
| 227 | 3300005614 | Ga0068856_100179898 | Ga0068856_1001798982 | 236 |
| 228 | 3300006038 | Ga0075365_10078922 | Ga0075365_100789224 | 236 |
| 229 | 3300006038 | Ga0075365_10194837 | Ga0075365_101948372 | 236 |
| 230 | 3300006237 | Ga0097621_100122017 | Ga0097621_1001220172 | 236 |
| 231 | 3300006844 | Ga0075428_100004380 | Ga0075428_10000438013 | 236 |
| 232 | 3300006846 | Ga0075430_100004543 | Ga0075430_1000045433 | 236 |
| 233 | 3300006847 | Ga0075431_100669242 | Ga0075431_1006692421 | 236 |
| 234 | 3300006847 | Ga0075431_100712296 | Ga0075431_1007122962 | 236 |
| 235 | 3300006914 | Ga0075436_100043529 | Ga0075436_1000435294 | 236 |
| 236 | 3300007076 | Ga0075435_100654650 | Ga0075435_1006546501 | 236 |
| 237 | 3300007265 | Ga0099794_10028213 | Ga0099794_100282131 | 236 |
| 238 | 3300007265 | Ga0099794_10037531 | Ga0099794_100375312 | 236 |
| 239 | 3300009093 | Ga0105240_10000060 | Ga0105240_1000006050 | 236 |
| 240 | 3300009094 | Ga0111539_10204770 | Ga0111539_102047703 | 236 |
| 241 | 3300009098 | Ga0105245_10000290 | Ga0105245_1000029030 | 236 |
| 242 | 3300009098 | Ga0105245_10050155 | Ga0105245_100501554 | 236 |
| 243 | 3300009098 | Ga0105245_10082862 | Ga0105245_100828622 | 236 |
| 244 | 3300009098 | Ga0105245_10427623 | Ga0105245_104276232 | 236 |
| 245 | 3300009147 | Ga0114129_10745805 | Ga0114129_107458051 | 236 |
| 246 | 3300009174 | Ga0105241_10054300 | Ga0105241_100543004 | 236 |
| 247 | 3300009174 | Ga0105241_10225867 | Ga0105241_102258671 | 236 |
| 248 | 3300009553 | Ga0105249_10000245 | Ga0105249_1000024513 | 236 |
| 249 | 3300011119 | Ga0105246_10054794 | Ga0105246_100547943 | 236 |
| 250 | 3300011119 | Ga0105246_10134996 | Ga0105246_101349963 | 236 |
| 251 | 3300013306 | Ga0163162_10607073 | Ga0163162_106070732 | 236 |
| 252 | 3300014326 | Ga0157380_10000313 | Ga0157380_1000031334 | 236 |
| 253 | 3300014969 | Ga0157376_10037100 | Ga0157376_100371002 | 236 |
| 254 | 3300017792 | Ga0163161_10000058 | Ga0163161_1000005838 | 236 |
| 255 | 3300021377 | Ga0213874_10060482 | Ga0213874_100604821 | 236 |
| 256 | 3300025893 | Ga0207682_10000052 | Ga0207682_1000005251 | 236 |
| 257 | 3300025906 | Ga0207699_10047882 | Ga0207699_100478823 | 236 |
| 258 | 3300025909 | Ga0207705_10135975 | Ga0207705_101359752 | 236 |
| 259 | 3300025910 | Ga0207684_10400659 | Ga0207684_104006592 | 236 |
| 260 | 3300025910 | Ga0207684_10615305 | Ga0207684_106153051 | 236 |
| 261 | 3300025912 | Ga0207707_10059064 | Ga0207707_100590643 | 236 |
| 262 | 3300025913 | Ga0207695_10000025 | Ga0207695_10000025151 | 236 |
| 263 | 3300025915 | Ga0207693_10002083 | Ga0207693_1000208314 | 236 |
| 264 | 3300025916 | Ga0207663_10007435 | Ga0207663_100074358 | 236 |
| 265 | 3300025916 | Ga0207663_10085383 | Ga0207663_100853832 | 236 |
| 266 | 3300025917 | Ga0207660_10045298 | Ga0207660_100452985 | 236 |
| 267 | 3300025923 | Ga0207681_10005966 | Ga0207681_100059666 | 236 |
| 268 | 3300025927 | Ga0207687_10000012 | Ga0207687_1000001235 | 236 |
| 269 | 3300025927 | Ga0207687_10014401 | Ga0207687_100144014 | 236 |
| 270 | 3300025927 | Ga0207687_10132626 | Ga0207687_101326262 | 236 |
| 271 | 3300025928 | Ga0207700_10021136 | Ga0207700_100211364 | 236 |
| 272 | 3300025929 | Ga0207664_10000025 | Ga0207664_10000025178 | 236 |
| 273 | 3300025929 | Ga0207664_10011344 | Ga0207664_100113442 | 236 |
| 274 | 3300025929 | Ga0207664_10128127 | Ga0207664_101281272 | 236 |
| 275 | 3300025929 | Ga0207664_10157129 | Ga0207664_101571292 | 236 |
| 276 | 3300025929 | Ga0207664_10169567 | Ga0207664_101695672 | 236 |
| 277 | 3300025933 | Ga0207706_10101254 | Ga0207706_101012542 | 236 |
| 278 | 3300025938 | Ga0207704_10407376 | Ga0207704_104073761 | 236 |
| 279 | 3300025944 | Ga0207661_10007703 | Ga0207661_100077032 | 236 |
| 280 | 3300025944 | Ga0207661_10013885 | Ga0207661_100138857 | 236 |
| 281 | 3300025944 | Ga0207661_10098561 | Ga0207661_100985613 | 236 |
| 282 | 3300025945 | Ga0207679_10076756 | Ga0207679_100767562 | 236 |
| 283 | 3300025961 | Ga0207712_10000086 | Ga0207712_1000008645 | 236 |
| 284 | 3300025972 | Ga0207668_10016834 | Ga0207668_100168344 | 236 |
| 285 | 3300026078 | Ga0207702_10011951 | Ga0207702_100119513 | 236 |
| 286 | 3300026121 | Ga0207683_10012451 | Ga0207683_100124514 | 236 |
| 287 | 3300027671 | Ga0209588_1019632 | Ga0209588_10196322 | 236 |
| 288 | 3300027671 | Ga0209588_1053589 | Ga0209588_10535892 | 236 |
| 289 | 3300028558 | Ga0265326_10000005 | Ga0265326_10000005151 | 236 |
| 290 | 3300028573 | Ga0265334_10000024 | Ga0265334_100000241 | 236 |
| 291 | 3300028666 | Ga0265336_10017322 | Ga0265336_100173222 | 236 |
| 292 | 3300028800 | Ga0265338_10002712 | Ga0265338_1000271221 | 236 |
| 293 | 3300028800 | Ga0265338_10146720 | Ga0265338_101467202 | 236 |
| 294 | 3300029957 | Ga0265324_10002813 | Ga0265324_100028132 | 236 |
| 295 | 3300031247 | Ga0265340_10153700 | Ga0265340_101537002 | 236 |
| 296 | 3300031852 | Ga0307410_10135271 | Ga0307410_101352711 | 236 |
| 297 | 3300031995 | Ga0307409_100018828 | Ga0307409_1000188282 | 236 |
| 298 | 3300031995 | Ga0307409_100245993 | Ga0307409_1002459932 | 236 |
| 299 | 3300032002 | Ga0307416_100130461 | Ga0307416_1001304612 | 236 |
| 300 | 3300032002 | Ga0307416_101345268 | Ga0307416_1013452681 | 236 |
| 301 | 3300032126 | Ga0307415_100000192 | Ga0307415_10000019228 | 236 |
| 302 | 3300035171 | Ga0373946_0135982 | Ga0373946_0135982_322_1110 | 236 |
| 303 | 3300035692 | Ga0373935_0396958 | Ga0373935_0396958_62_829 | 236 |
| 304 | 3300035695 | Ga0373927_0000103 | Ga0373927_0000103_14128_14895 | 236 |
| 305 | 3300035724 | Ga0373933_0095294 | Ga0373933_0095294_613_1392 | 236 |
| 306 | 3300037068 | Ga0373925_0038619 | Ga0373925_0038619_2342_3109 | 236 |
| 307 | 3300037418 | Ga0395900_0080249 | Ga0395900_0080249_883_1644 | 236 |
| 308 | 3300037418 | Ga0395900_0288563 | Ga0395900_0288563_814_1584 | 236 |
| 309 | 3300037418 | Ga0395900_0630934 | Ga0395900_0630934_43_813 | 236 |
| 310 | 3300037466 | Ga0395898_0053883 | Ga0395898_0053883_2478_3251 | 236 |
| 311 | 3300037466 | Ga0395898_0075241 | Ga0395898_0075241_151_924 | 236 |
| 312 | 3300037466 | Ga0395898_0210912 | Ga0395898_0210912_155_925 | 236 |
| 313 | 3300037466 | Ga0395898_0802437 | Ga0395898_0802437_22_807 | 236 |
| 314 | 3300038443 | Ga0395901_0004872 | Ga0395901_0004872_6144_6917 | 236 |
| 315 | 3300038443 | Ga0395901_0203162 | Ga0395901_0203162_1159_1920 | 236 |
| 316 | 3300041512 | Ga0451853_1119736 | Ga0451853_1119736_521_1285 | 236 |
| 317 | 3300044673 | Ga0453683_0007472 | Ga0453683_0007472_5931_6695 | 236 |
| 318 | 3300045976 | Ga0466967_0032329 | Ga0466967_0032329_2797_3558 | 236 |
| 319 | 3300045976 | Ga0466967_0546922 | Ga0466967_0546922_181_942 | 236 |
| 320 | 3300046454 | Ga0495592_0000621 | Ga0495592_0000621_8054_8818 | 236 |
| 321 | 3300046462 | Ga0495651_0129888 | Ga0495651_0129888_530_1309 | 236 |
| 322 | 3300046462 | Ga0495651_0350706 | Ga0495651_0350706_46_801 | 236 |
| 323 | 3300046463 | Ga0495653_0038045 | Ga0495653_0038045_883_1662 | 236 |
| 324 | 3300046472 | Ga0495580_0333428 | Ga0495580_0333428_93_848 | 236 |
| 325 | 3300046473 | Ga0495582_0187898 | Ga0495582_0187898_57_839 | 236 |
| 326 | 3300046473 | Ga0495582_0305518 | Ga0495582_0305518_117_896 | 236 |
| 327 | 3300046477 | Ga0495664_0071725 | Ga0495664_0071725_1105_1887 | 236 |
| 328 | 3300046511 | Ga0495608_0000406 | Ga0495608_0000406_18933_19697 | 236 |
| 329 | 3300046514 | Ga0495618_0000068 | Ga0495618_0000068_73799_74563 | 236 |
| 330 | 3300046515 | Ga0495620_0000315 | Ga0495620_0000315_16736_17521 | 236 |
| 331 | 3300046516 | Ga0495628_0005324 | Ga0495628_0005324_4798_5553 | 236 |
| 332 | 3300046516 | Ga0495628_0169083 | Ga0495628_0169083_19_798 | 236 |
| 333 | 3300046516 | Ga0495628_0489227 | Ga0495628_0489227_60_839 | 236 |
| 334 | 3300046523 | Ga0495644_0000954 | Ga0495644_0000954_6349_7113 | 236 |
| 335 | 3300046523 | Ga0495644_0108839 | Ga0495644_0108839_213_986 | 236 |
| 336 | 3300046529 | Ga0495652_0425109 | Ga0495652_0425109_128_907 | 236 |
| 337 | 3300046533 | Ga0495640_0021376 | Ga0495640_0021376_2048_2812 | 236 |
| 338 | 3300046559 | Ga0495667_0019918 | Ga0495667_0019918_841_1620 | 236 |
| 339 | 3300046663 | Ga0495635_0000009 | Ga0495635_0000009_236507_237271 | 236 |
| 340 | 3300046663 | Ga0495635_0021925 | Ga0495635_0021925_3483_4262 | 236 |
| 341 | 3300046678 | Ga0495599_0231041 | Ga0495599_0231041_49_828 | 236 |
| 342 | 3300046683 | Ga0495658_0301734 | Ga0495658_0301734_72_854 | 236 |
| 343 | 3300046689 | Ga0495613_0000249 | Ga0495613_0000249_12915_13679 | 236 |
| 344 | 3300046690 | Ga0495624_0010426 | Ga0495624_0010426_2179_2943 | 236 |
| 345 | 3300046809 | Ga0495600_0154022 | Ga0495600_0154022_61_825 | 236 |
| 346 | 3300047317 | Ga0495604_0141683 | Ga0495604_0141683_28_807 | 236 |
| 347 | 3300047322 | Ga0495680_0000023 | Ga0495680_0000023_28037_28792 | 236 |
| 348 | 3300047322 | Ga0495680_0016552 | Ga0495680_0016552_3880_4659 | 236 |
| 349 | 3300047471 | Ga0495684_0281190 | Ga0495684_0281190_33_812 | 236 |
| 350 | 3300047471 | Ga0495684_0436473 | Ga0495684_0436473_112_891 | 236 |
| 351 | 3300048903 | Ga0496100_0000016 | Ga0496100_0000016_28088_28873 | 236 |
| 352 | 3300048903 | Ga0496100_0220710 | Ga0496100_0220710_346_1116 | 236 |
| 353 | 3300048904 | Ga0496101_0000038 | Ga0496101_0000038_137186_137971 | 236 |
| 354 | 3300048904 | Ga0496101_0039180 | Ga0496101_0039180_2351_3136 | 236 |
| 355 | 3300048905 | Ga0496102_0004878 | Ga0496102_0004878_825_1598 | 236 |
| 356 | 3300048906 | Ga0496103_0004524 | Ga0496103_0004524_7622_8395 | 236 |
| 357 | 3300048907 | Ga0496104_0004192 | Ga0496104_0004192_6665_7438 | 236 |
| 358 | 3300048907 | Ga0496104_0075882 | Ga0496104_0075882_1432_2217 | 236 |
| 359 | 3300048907 | Ga0496104_0550614 | Ga0496104_0550614_48_827 | 236 |
| 360 | 3300048908 | Ga0496105_0005312 | Ga0496105_0005312_941_1726 | 236 |
| 361 | 3300048909 | Ga0496106_0000027 | Ga0496106_0000027_120700_121485 | 236 |
| 362 | 3300048910 | Ga0496107_0000003 | Ga0496107_0000003_275166_275951 | 236 |
| 363 | 3300048910 | Ga0496107_0146109 | Ga0496107_0146109_26_793 | 236 |
| 364 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_282276_283061 | 236 |
| 365 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_282238_283023 | 236 |
| 366 | 3300048912 | Ga0496109_0043704 | Ga0496109_0043704_3137_3925 | 236 |
| 367 | 3300048915 | Ga0496112_0000865 | Ga0496112_0000865_16434_17204 | 236 |
| 368 | 3300048915 | Ga0496112_0105281 | Ga0496112_0105281_449_1228 | 236 |
| 369 | 3300048915 | Ga0496112_0112407 | Ga0496112_0112407_561_1328 | 236 |
| 370 | 3300048917 | Ga0496114_0009726 | Ga0496114_0009726_4106_4879 | 236 |
| 371 | 3300049578 | Ga0501042_0206628 | Ga0501042_0206628_348_1127 | 236 |
| 372 | 3300049587 | Ga0501071_0170767 | Ga0501071_0170767_532_1311 | 236 |
| 373 | 3300049741 | Ga0501079_0295867 | Ga0501079_0295867_311_1090 | 236 |
| 374 | 3300050507 | nmdc:mga05p37_221961_c1 | nmdc:mga05p37_221961_c1_981_1751 | 236 |
| 375 | 3300050507 | nmdc:mga05p37_860988_c1 | nmdc:mga05p37_860988_c1_45_809 | 236 |
| 376 | 3300050508 | nmdc:mga09592_5791_c1 | nmdc:mga09592_5791_c1_2668_3438 | 236 |
| 377 | 3300050509 | nmdc:mga0qj67_82225_c1 | nmdc:mga0qj67_82225_c1_1711_2481 | 236 |
| 378 | 3300050510 | nmdc:mga06r32_340846_c1 | nmdc:mga06r32_340846_c1_183_953 | 236 |
| 379 | 3300050512 | nmdc:mga0n895_79740_c1 | nmdc:mga0n895_79740_c1_2462_3217 | 236 |
| 380 | 3300053084 | Ga0495595_0000109 | Ga0495595_0000109_35050_35814 | 236 |
| 381 | 3300005445 | Ga0070708_100072392 | Ga0070708_1000723925 | 237 |
| 382 | 3300005468 | Ga0070707_100009328 | Ga0070707_10000932810 | 237 |
| 383 | 3300006847 | Ga0075431_100714955 | Ga0075431_1007149551 | 237 |
| 384 | 3300006852 | Ga0075433_10312622 | Ga0075433_103126221 | 237 |
| 385 | 3300006871 | Ga0075434_100038041 | Ga0075434_1000380414 | 237 |
| 386 | 3300006871 | Ga0075434_100431379 | Ga0075434_1004313792 | 237 |
| 387 | 3300007076 | Ga0075435_100098975 | Ga0075435_1000989753 | 237 |
| 388 | 3300009094 | Ga0111539_10198009 | Ga0111539_101980092 | 237 |
| 389 | 3300009147 | Ga0114129_10007716 | Ga0114129_100077167 | 237 |
| 390 | 3300009147 | Ga0114129_10098758 | Ga0114129_100987582 | 237 |
| 391 | 3300009551 | Ga0105238_10093026 | Ga0105238_100930263 | 237 |
| 392 | 3300013306 | Ga0163162_10465563 | Ga0163162_104655631 | 237 |
| 393 | 3300025910 | Ga0207684_10027719 | Ga0207684_100277195 | 237 |
| 394 | 3300025922 | Ga0207646_10079619 | Ga0207646_100796192 | 237 |
| 395 | 3300025934 | Ga0207686_10480654 | Ga0207686_104806542 | 237 |
| 396 | 3300025939 | Ga0207665_10390617 | Ga0207665_103906172 | 237 |
| 397 | 3300025986 | Ga0207658_10650491 | Ga0207658_106504911 | 237 |
| 398 | 3300026116 | Ga0207674_10322895 | Ga0207674_103228952 | 237 |
| 399 | 3300027671 | Ga0209588_1040685 | Ga0209588_10406851 | 237 |
| 400 | 3300028380 | Ga0268265_10148830 | Ga0268265_101488302 | 237 |
| 401 | 3300031548 | Ga0307408_100262507 | Ga0307408_1002625072 | 237 |
| 402 | 3300031731 | Ga0307405_10360279 | Ga0307405_103602791 | 237 |
| 403 | 3300031824 | Ga0307413_10277458 | Ga0307413_102774581 | 237 |
| 404 | 3300031995 | Ga0307409_100077675 | Ga0307409_1000776752 | 237 |
| 405 | 3300031995 | Ga0307409_100198410 | Ga0307409_1001984101 | 237 |
| 406 | 3300032002 | Ga0307416_100112172 | Ga0307416_1001121723 | 237 |
| 407 | 3300032004 | Ga0307414_10017237 | Ga0307414_100172375 | 237 |
| 408 | 3300032126 | Ga0307415_100287670 | Ga0307415_1002876702 | 237 |
| 409 | 3300037068 | Ga0373925_0000189 | Ga0373925_0000189_2966_3751 | 237 |
| 410 | 3300037312 | Ga0395899_0002389 | Ga0395899_0002389_4620_5396 | 237 |
| 411 | 3300037418 | Ga0395900_0010103 | Ga0395900_0010103_6149_6925 | 237 |
| 412 | 3300037466 | Ga0395898_0156957 | Ga0395898_0156957_1124_1900 | 237 |
| 413 | 3300037471 | Ga0395905_0002146 | Ga0395905_0002146_612_1388 | 237 |
| 414 | 3300038443 | Ga0395901_0360309 | Ga0395901_0360309_401_1177 | 237 |
| 415 | 3300038996 | Ga0242420_015509 | Ga0242420_015509_357_1148 | 237 |
| 416 | 3300039447 | Ga0436361_0844713 | Ga0436361_0844713_7157_7951 | 237 |
| 417 | 3300044673 | Ga0453683_0026109 | Ga0453683_0026109_2452_3234 | 237 |
| 418 | 3300044735 | Ga0466968_0125363 | Ga0466968_0125363_318_1091 | 237 |
| 419 | 3300049574 | Ga0501038_0277988 | Ga0501038_0277988_423_1217 | 237 |
| 420 | 3300049575 | Ga0501039_0510185 | Ga0501039_0510185_88_882 | 237 |
| 421 | 3300049577 | Ga0501041_0145441 | Ga0501041_0145441_569_1363 | 237 |
| 422 | 3300049590 | Ga0501074_0338868 | Ga0501074_0338868_117_911 | 237 |
| 423 | 3300049592 | Ga0501076_0054181 | Ga0501076_0054181_2325_3119 | 237 |
| 424 | 3300049593 | Ga0501077_0001046 | Ga0501077_0001046_7033_7827 | 237 |
| 425 | 3300049741 | Ga0501079_0044291 | Ga0501079_0044291_624_1520 | 237 |
| 426 | 3300050507 | nmdc:mga05p37_26018_c1 | nmdc:mga05p37_26018_c1_4479_5237 | 237 |
| 427 | 3300050507 | nmdc:mga05p37_309164_c1 | nmdc:mga05p37_309164_c1_204_998 | 237 |
| 428 | 3300050509 | nmdc:mga0qj67_456876_c1 | nmdc:mga0qj67_456876_c1_178_951 | 237 |
| 429 | 3300050512 | nmdc:mga0n895_343776_c1 | nmdc:mga0n895_343776_c1_372_1130 | 237 |
| 430 | 3300050515 | nmdc:mga0a205_104623_c1 | nmdc:mga0a205_104623_c1_721_1512 | 237 |
| 431 | 3300053085 | Ga0495619_0006443 | Ga0495619_0006443_56_841 | 237 |
| 432 | 3300054114 | Ga0501084_0010731 | Ga0501084_0010731_4424_5218 | 237 |
| 433 | 3300059424 | Ga0590075_010220 | Ga0590075_010220_1155_1949 | 237 |
| 434 | 3300059647 | Ga0587079_032495 | Ga0587079_032495_92_865 | 237 |
| 435 | 3300060353 | Ga0501082_0206629 | Ga0501082_0206629_400_1194 | 237 |
| 436 | 3300061734 | Ga0530510_0416483 | Ga0530510_0416483_41_835 | 237 |
| 437 | 3300005345 | Ga0070692_10206871 | Ga0070692_102068712 | 238 |
| 438 | 3300005364 | Ga0070673_100421442 | Ga0070673_1004214422 | 238 |
| 439 | 3300005366 | Ga0070659_100063726 | Ga0070659_1000637262 | 238 |
| 440 | 3300005435 | Ga0070714_100000603 | Ga0070714_10000060315 | 238 |
| 441 | 3300005441 | Ga0070700_100146364 | Ga0070700_1001463642 | 238 |
| 442 | 3300005444 | Ga0070694_100051461 | Ga0070694_1000514612 | 238 |
| 443 | 3300005459 | Ga0068867_100115694 | Ga0068867_1001156942 | 238 |
| 444 | 3300005467 | Ga0070706_100113674 | Ga0070706_1001136743 | 238 |
| 445 | 3300005467 | Ga0070706_100199875 | Ga0070706_1001998753 | 238 |
| 446 | 3300005467 | Ga0070706_100425837 | Ga0070706_1004258372 | 238 |
| 447 | 3300005468 | Ga0070707_100021602 | Ga0070707_1000216023 | 238 |
| 448 | 3300005518 | Ga0070699_100206218 | Ga0070699_1002062182 | 238 |
| 449 | 3300005535 | Ga0070684_100108785 | Ga0070684_1001087852 | 238 |
| 450 | 3300005545 | Ga0070695_100289147 | Ga0070695_1002891472 | 238 |
| 451 | 3300005546 | Ga0070696_100380862 | Ga0070696_1003808621 | 238 |
| 452 | 3300005546 | Ga0070696_100455198 | Ga0070696_1004551981 | 238 |
| 453 | 3300005549 | Ga0070704_100192219 | Ga0070704_1001922192 | 238 |
| 454 | 3300005577 | Ga0068857_100284388 | Ga0068857_1002843882 | 238 |
| 455 | 3300005578 | Ga0068854_100186168 | Ga0068854_1001861682 | 238 |
| 456 | 3300005618 | Ga0068864_100685724 | Ga0068864_1006857242 | 238 |
| 457 | 3300005719 | Ga0068861_100129227 | Ga0068861_1001292272 | 238 |
| 458 | 3300005843 | Ga0068860_100779101 | Ga0068860_1007791011 | 238 |
| 459 | 3300005981 | Ga0081538_10112930 | Ga0081538_101129301 | 238 |
| 460 | 3300009098 | Ga0105245_10056261 | Ga0105245_100562612 | 238 |
| 461 | 3300009147 | Ga0114129_10276085 | Ga0114129_102760852 | 238 |
| 462 | 3300009148 | Ga0105243_10026317 | Ga0105243_100263173 | 238 |
| 463 | 3300009148 | Ga0105243_10038475 | Ga0105243_100384754 | 238 |
| 464 | 3300009553 | Ga0105249_10455701 | Ga0105249_104557012 | 238 |
| 465 | 3300014745 | Ga0157377_10043297 | Ga0157377_100432973 | 238 |
| 466 | 3300025901 | Ga0207688_10024477 | Ga0207688_100244771 | 238 |
| 467 | 3300025907 | Ga0207645_10033469 | Ga0207645_100334692 | 238 |
| 468 | 3300025910 | Ga0207684_10096801 | Ga0207684_100968013 | 238 |
| 469 | 3300025910 | Ga0207684_10182629 | Ga0207684_101826292 | 238 |
| 470 | 3300025918 | Ga0207662_10108670 | Ga0207662_101086701 | 238 |
| 471 | 3300025919 | Ga0207657_10004692 | Ga0207657_1000469210 | 238 |
| 472 | 3300025923 | Ga0207681_10351092 | Ga0207681_103510922 | 238 |
| 473 | 3300025929 | Ga0207664_10007176 | Ga0207664_100071768 | 238 |
| 474 | 3300025949 | Ga0207667_10713197 | Ga0207667_107131972 | 238 |
| 475 | 3300026023 | Ga0207677_10264297 | Ga0207677_102642972 | 238 |
| 476 | 3300026075 | Ga0207708_10085252 | Ga0207708_100852522 | 238 |
| 477 | 3300026075 | Ga0207708_10156010 | Ga0207708_101560102 | 238 |
| 478 | 3300026089 | Ga0207648_10032468 | Ga0207648_100324685 | 238 |
| 479 | 3300026118 | Ga0207675_100029085 | Ga0207675_1000290852 | 238 |
| 480 | 3300026118 | Ga0207675_100080712 | Ga0207675_1000807123 | 238 |
| 481 | 3300028381 | Ga0268264_10475479 | Ga0268264_104754792 | 238 |
| 482 | 3300031903 | Ga0307407_10049087 | Ga0307407_100490874 | 238 |
| 483 | 3300031995 | Ga0307409_100023420 | Ga0307409_1000234202 | 238 |
| 484 | 3300032002 | Ga0307416_100417986 | Ga0307416_1004179862 | 238 |
| 485 | 3300032005 | Ga0307411_10156712 | Ga0307411_101567122 | 238 |
| 486 | 3300037466 | Ga0395898_0362231 | Ga0395898_0362231_26_832 | 238 |
| 487 | 3300037471 | Ga0395905_0059446 | Ga0395905_0059446_348_1154 | 238 |
| 488 | 3300038443 | Ga0395901_0019380 | Ga0395901_0019380_137_943 | 238 |
| 489 | 3300044658 | Ga0466972_0101530 | Ga0466972_0101530_373_1182 | 238 |
| 490 | 3300045051 | Ga0451576_0501226 | Ga0451576_0501226_221_991 | 238 |
| 491 | 3300047322 | Ga0495680_0441766 | Ga0495680_0441766_28_852 | 238 |
| 492 | 3300048911 | Ga0496108_0222032 | Ga0496108_0222032_552_1379 | 238 |
| 493 | 3300048915 | Ga0496112_0305973 | Ga0496112_0305973_582_1412 | 238 |
| 494 | 3300049568 | Ga0501031_0020801 | Ga0501031_0020801_3417_4199 | 238 |
| 495 | 3300049568 | Ga0501031_0126379 | Ga0501031_0126379_103_909 | 238 |
| 496 | 3300049569 | Ga0501032_0038454 | Ga0501032_0038454_556_1338 | 238 |
| 497 | 3300049569 | Ga0501032_0146400 | Ga0501032_0146400_566_1372 | 238 |
| 498 | 3300049570 | Ga0501033_0154130 | Ga0501033_0154130_791_1573 | 238 |
| 499 | 3300049571 | Ga0501034_0091981 | Ga0501034_0091981_661_1437 | 238 |
| 500 | 3300049572 | Ga0501036_0001738 | Ga0501036_0001738_198_980 | 238 |
| 501 | 3300049572 | Ga0501036_0404721 | Ga0501036_0404721_261_1067 | 238 |
| 502 | 3300049574 | Ga0501038_0450616 | Ga0501038_0450616_152_934 | 238 |
| 503 | 3300049575 | Ga0501039_0045845 | Ga0501039_0045845_2423_3205 | 238 |
| 504 | 3300049576 | Ga0501040_0002511 | Ga0501040_0002511_8600_9382 | 238 |
| 505 | 3300049577 | Ga0501041_0001860 | Ga0501041_0001860_7850_8632 | 238 |
| 506 | 3300049578 | Ga0501042_0016718 | Ga0501042_0016718_1764_2546 | 238 |
| 507 | 3300049578 | Ga0501042_0258736 | Ga0501042_0258736_136_942 | 238 |
| 508 | 3300049580 | Ga0501046_0007642 | Ga0501046_0007642_3064_3846 | 238 |
| 509 | 3300049582 | Ga0501048_0006497 | Ga0501048_0006497_8062_8844 | 238 |
| 510 | 3300049584 | Ga0501068_0018481 | Ga0501068_0018481_2310_3092 | 238 |
| 511 | 3300049585 | Ga0501069_0002990 | Ga0501069_0002990_5524_6306 | 238 |
| 512 | 3300049586 | Ga0501070_0024213 | Ga0501070_0024213_2128_2910 | 238 |
| 513 | 3300049587 | Ga0501071_0001478 | Ga0501071_0001478_3182_3964 | 238 |
| 514 | 3300049588 | Ga0501072_0000386 | Ga0501072_0000386_16381_17163 | 238 |
| 515 | 3300049589 | Ga0501073_0016136 | Ga0501073_0016136_2129_2911 | 238 |
| 516 | 3300049590 | Ga0501074_0003903 | Ga0501074_0003903_8498_9280 | 238 |
| 517 | 3300049591 | Ga0501075_0002467 | Ga0501075_0002467_9022_9804 | 238 |
| 518 | 3300049592 | Ga0501076_0001538 | Ga0501076_0001538_12263_13045 | 238 |
| 519 | 3300049593 | Ga0501077_0014506 | Ga0501077_0014506_2408_3190 | 238 |
| 520 | 3300049741 | Ga0501079_0001142 | Ga0501079_0001142_9549_10331 | 238 |
| 521 | 3300049742 | Ga0501080_0000913 | Ga0501080_0000913_16300_17082 | 238 |
| 522 | 3300049743 | Ga0501081_0004652 | Ga0501081_0004652_3290_4072 | 238 |
| 523 | 3300049822 | Ga0501035_0028544 | Ga0501035_0028544_836_1618 | 238 |
| 524 | 3300049824 | Ga0501045_0001817 | Ga0501045_0001817_8711_9493 | 238 |
| 525 | 3300049824 | Ga0501045_0077048 | Ga0501045_0077048_1342_2148 | 238 |
| 526 | 3300050507 | nmdc:mga05p37_301741_c1 | nmdc:mga05p37_301741_c1_976_1794 | 238 |
| 527 | 3300054114 | Ga0501084_0018018 | Ga0501084_0018018_5032_5814 | 238 |
| 528 | 3300060353 | Ga0501082_0011025 | Ga0501082_0011025_4461_5243 | 238 |
| 529 | 3300005467 | Ga0070706_100000637 | Ga0070706_10000063720 | 239 |
| 530 | 3300005471 | Ga0070698_100067092 | Ga0070698_1000670922 | 239 |
| 531 | 3300005539 | Ga0068853_100706057 | Ga0068853_1007060572 | 239 |
| 532 | 3300005543 | Ga0070672_100004568 | Ga0070672_1000045688 | 239 |
| 533 | 3300005842 | Ga0068858_100001029 | Ga0068858_1000010294 | 239 |
| 534 | 3300005937 | Ga0081455_10000308 | Ga0081455_1000030822 | 239 |
| 535 | 3300006038 | Ga0075365_10014932 | Ga0075365_100149326 | 239 |
| 536 | 3300006175 | Ga0070712_100000005 | Ga0070712_100000005154 | 239 |
| 537 | 3300006914 | Ga0075436_100001888 | Ga0075436_1000018886 | 239 |
| 538 | 3300006914 | Ga0075436_100425426 | Ga0075436_1004254261 | 239 |
| 539 | 3300007265 | Ga0099794_10002520 | Ga0099794_100025205 | 239 |
| 540 | 3300009098 | Ga0105245_10014396 | Ga0105245_100143964 | 239 |
| 541 | 3300009553 | Ga0105249_10137966 | Ga0105249_101379664 | 239 |
| 542 | 3300013100 | Ga0157373_10437783 | Ga0157373_104377831 | 239 |
| 543 | 3300013308 | Ga0157375_10000018 | Ga0157375_10000018154 | 239 |
| 544 | 3300014326 | Ga0157380_10009617 | Ga0157380_100096174 | 239 |
| 545 | 3300022467 | Ga0224712_10000993 | Ga0224712_1000099311 | 239 |
| 546 | 3300025910 | Ga0207684_10000345 | Ga0207684_1000034521 | 239 |
| 547 | 3300025915 | Ga0207693_10000023 | Ga0207693_1000002320 | 239 |
| 548 | 3300025927 | Ga0207687_10001014 | Ga0207687_1000101413 | 239 |
| 549 | 3300025940 | Ga0207691_10001294 | Ga0207691_1000129416 | 239 |
| 550 | 3300026035 | Ga0207703_10000008 | Ga0207703_10000008268 | 239 |
| 551 | 3300026075 | Ga0207708_10194053 | Ga0207708_101940531 | 239 |
| 552 | 3300031665 | Ga0316575_10088583 | Ga0316575_100885832 | 239 |
| 553 | 3300032002 | Ga0307416_100331833 | Ga0307416_1003318332 | 239 |
| 554 | 3300033179 | Ga0307507_10037296 | Ga0307507_100372963 | 239 |
| 555 | 3300037312 | Ga0395899_0184937 | Ga0395899_0184937_473_1291 | 239 |
| 556 | 3300037418 | Ga0395900_0009229 | Ga0395900_0009229_9145_9963 | 239 |
| 557 | 3300037466 | Ga0395898_0084041 | Ga0395898_0084041_1584_2402 | 239 |
| 558 | 3300037471 | Ga0395905_0190871 | Ga0395905_0190871_404_1222 | 239 |
| 559 | 3300037471 | Ga0395905_0197276 | Ga0395905_0197276_349_1167 | 239 |
| 560 | 3300038443 | Ga0395901_0021273 | Ga0395901_0021273_747_1565 | 239 |
| 561 | 3300038443 | Ga0395901_0182454 | Ga0395901_0182454_154_972 | 239 |
| 562 | 3300045049 | Ga0466959_0028049 | Ga0466959_0028049_2844_3632 | 239 |
| 563 | 3300048924 | Ga0496121_0211530 | Ga0496121_0211530_444_1220 | 239 |
| 564 | 3300049568 | Ga0501031_0137008 | Ga0501031_0137008_42_833 | 239 |
| 565 | 3300049591 | Ga0501075_0161922 | Ga0501075_0161922_288_1073 | 239 |
| 566 | 3300049592 | Ga0501076_0412852 | Ga0501076_0412852_212_997 | 239 |
| 567 | 3300050492 | nmdc:mga0yw44_10101_c1 | nmdc:mga0yw44_10101_c1_3687_4502 | 239 |
| 568 | 3300050510 | nmdc:mga06r32_754462_c1 | nmdc:mga06r32_754462_c1_21_818 | 239 |
| 569 | 3300050514 | nmdc:mga08x19_271_c1 | nmdc:mga08x19_271_c1_2488_3285 | 239 |
| 570 | 3300059490 | Ga0587066_003568 | Ga0587066_003568_555_1334 | 239 |
| 571 | 3300059490 | Ga0587066_039218 | Ga0587066_039218_60_830 | 239 |
| 572 | 3300059492 | Ga0587073_0006032 | Ga0587073_0006032_556_1335 | 239 |
| 573 | 3300059505 | Ga0587083_0030674 | Ga0587083_0030674_133_903 | 239 |
| 574 | 3300059508 | Ga0587088_006433 | Ga0587088_006433_290_1069 | 239 |
| 575 | 3300059510 | Ga0587090_003437 | Ga0587090_003437_507_1286 | 239 |
| 576 | 3300059511 | Ga0587091_006150 | Ga0587091_006150_349_1119 | 239 |
| 577 | 3300059513 | Ga0587094_002452 | Ga0587094_002452_638_1417 | 239 |
| 578 | 3300059625 | Ga0587113_004512 | Ga0587113_004512_125_904 | 239 |
| 579 | 3300059626 | Ga0587115_002426 | Ga0587115_002426_556_1335 | 239 |
| 580 | 3300059640 | Ga0587067_003434 | Ga0587067_003434_686_1465 | 239 |
| 581 | 3300059643 | Ga0587072_028080 | Ga0587072_028080_53_832 | 239 |
| 582 | 3300059645 | Ga0587076_006926 | Ga0587076_006926_281_1060 | 239 |
| 583 | 3300059647 | Ga0587079_004079 | Ga0587079_004079_610_1389 | 239 |
| 584 | 3300059647 | Ga0587079_012111 | Ga0587079_012111_120_911 | 239 |
| 585 | 3300059647 | Ga0587079_028100 | Ga0587079_028100_104_874 | 239 |
| 586 | 3300060344 | Ga0587071_005131 | Ga0587071_005131_517_1296 | 239 |
| 587 | 3300060344 | Ga0587071_053299 | Ga0587071_053299_13_783 | 239 |
| 588 | 3300005467 | Ga0070706_100349498 | Ga0070706_1003494982 | 240 |
| 589 | 3300049575 | Ga0501039_0262560 | Ga0501039_0262560_567_1340 | 240 |
| 590 | 3300005618 | Ga0068864_100000054 | Ga0068864_10000005411 | 241 |
| 591 | 3300026095 | Ga0207676_10000028 | Ga0207676_10000028183 | 241 |
| 592 | 3300036401 | Ga0373937_0179371 | Ga0373937_0179371_759_1616 | 241 |
| 593 | 3300044693 | Ga0466961_0242917 | Ga0466961_0242917_193_960 | 241 |
| 594 | 3300005563 | Ga0068855_100141009 | Ga0068855_1001410093 | 242 |
| 595 | 3300009094 | Ga0111539_10095793 | Ga0111539_100957932 | 242 |
| 596 | 3300025949 | Ga0207667_10262010 | Ga0207667_102620103 | 242 |
| 597 | 3300031903 | Ga0307407_10176745 | Ga0307407_101767451 | 242 |
| 598 | 3300031995 | Ga0307409_100131301 | Ga0307409_1001313012 | 242 |
| 599 | 3300038443 | Ga0395901_0128148 | Ga0395901_0128148_1566_2333 | 242 |
| 600 | 3300044842 | Ga0466957_0360466 | Ga0466957_0360466_158_925 | 242 |
| 601 | 3300048916 | Ga0496113_0003035 | Ga0496113_0003035_6661_7428 | 242 |
| 602 | 3300048925 | Ga0496122_0007704 | Ga0496122_0007704_8952_9719 | 242 |
| 603 | 3300048926 | Ga0496123_0048992 | Ga0496123_0048992_679_1446 | 242 |
| 604 | 3300049571 | Ga0501034_0315504 | Ga0501034_0315504_103_843 | 242 |
| 605 | 3300049575 | Ga0501039_0346725 | Ga0501039_0346725_174_914 | 242 |
| 606 | 3300049586 | Ga0501070_0369583 | Ga0501070_0369583_293_1033 | 242 |
| 607 | 3300049742 | Ga0501080_0059538 | Ga0501080_0059538_835_1575 | 242 |
| 608 | 3300049822 | Ga0501035_0121332 | Ga0501035_0121332_1318_2058 | 242 |
| 609 | 3300050511 | nmdc:mga08y16_77303_c1 | nmdc:mga08y16_77303_c1_936_1745 | 242 |
| 610 | 3300005548 | Ga0070665_100024828 | Ga0070665_1000248285 | 243 |
| 611 | 3300009545 | Ga0105237_10000091 | Ga0105237_10000091110 | 243 |
| 612 | 3300010375 | Ga0105239_10016609 | Ga0105239_100166098 | 243 |
| 613 | 3300025914 | Ga0207671_10000834 | Ga0207671_1000083424 | 243 |
| 614 | 3300028379 | Ga0268266_10000255 | Ga0268266_1000025512 | 243 |
| 615 | 3300049578 | Ga0501042_0110376 | Ga0501042_0110376_1150_1950 | 243 |
| 616 | 3300049588 | Ga0501072_0067133 | Ga0501072_0067133_1874_2674 | 243 |
| 617 | 3300049592 | Ga0501076_0128469 | Ga0501076_0128469_855_1655 | 243 |
| 618 | 3300054114 | Ga0501084_0055867 | Ga0501084_0055867_132_932 | 243 |
| 619 | 3300061734 | Ga0530510_0028327 | Ga0530510_0028327_373_1173 | 243 |
| 620 | iso_pu_bacteria | 2643221629 | 2644166793 | 243 |
| 621 | iso_pu_bacteria | 2643221662 | 2644347633 | 243 |
| 622 | 3300003320 | rootH2_10001322 | rootH2_100013228 | 244 |
| 623 | 3300005456 | Ga0070678_100251233 | Ga0070678_1002512332 | 244 |
| 624 | 3300005985 | Ga0081539_10007281 | Ga0081539_100072817 | 244 |
| 625 | 3300031852 | Ga0307410_10277296 | Ga0307410_102772962 | 244 |
| 626 | 3300044901 | Ga0466960_0001117 | Ga0466960_0001117_148_963 | 244 |
| 627 | 3300049571 | Ga0501034_0437014 | Ga0501034_0437014_117_863 | 244 |
| 628 | 3300049571 | Ga0501034_0464813 | Ga0501034_0464813_282_1025 | 244 |
| 629 | 3300053153 | Ga0500616_0012886 | Ga0500616_0012886_4030_4776 | 244 |
| 630 | 3300006880 | Ga0075429_100023708 | Ga0075429_1000237083 | 245 |
| 631 | 3300009147 | Ga0114129_10006962 | Ga0114129_1000696211 | 245 |
| 632 | 3300044683 | Ga0466965_0041608 | Ga0466965_0041608_618_1454 | 245 |
| 633 | 3300044765 | Ga0466970_0033719 | Ga0466970_0033719_1763_2599 | 245 |
| 634 | 3300050507 | nmdc:mga05p37_15530_c1 | nmdc:mga05p37_15530_c1_1552_2379 | 245 |
| 635 | 3300050508 | nmdc:mga09592_109993_c1 | nmdc:mga09592_109993_c1_192_1019 | 245 |
| 636 | iso_pu_bacteria | 2511231003 | 2511250963 | 245 |
| 637 | iso_pu_bacteria | 8054472261 | 8054476431 | 245 |
| 638 | 3300039062 | Ga0400483_021893 | Ga0400483_021893_2793_3542 | 246 |
| 639 | 3300039062 | Ga0400483_208345 | Ga0400483_208345_2564_3313 | 246 |
| 640 | 3300041413 | Ga0439465_0047967 | Ga0439465_0047967_307_1062 | 247 |
| 641 | 3300006195 | Ga0075366_10121788 | Ga0075366_101217882 | 249 |
| 642 | 3300013105 | Ga0157369_10129597 | Ga0157369_101295974 | 249 |
| 643 | 3300037312 | Ga0395899_0035886 | Ga0395899_0035886_322_1074 | 249 |
| 644 | 3300037418 | Ga0395900_0001337 | Ga0395900_0001337_22547_23299 | 249 |
| 645 | 3300037466 | Ga0395898_0657835 | Ga0395898_0657835_61_813 | 249 |
| 646 | 3300044656 | Ga0466969_0029913 | Ga0466969_0029913_1187_1939 | 249 |
| 647 | 3300044693 | Ga0466961_0290833 | Ga0466961_0290833_51_803 | 249 |
| 648 | 3300045976 | Ga0466967_0427369 | Ga0466967_0427369_253_1005 | 249 |
| 649 | 3300046474 | Ga0495605_0009386 | Ga0495605_0009386_4485_5237 | 249 |
| 650 | 3300046513 | Ga0495616_0003806 | Ga0495616_0003806_6339_7091 | 249 |
| 651 | 3300046538 | Ga0495609_0000002 | Ga0495609_0000002_369801_370553 | 249 |
| 652 | 3300046616 | Ga0495668_0143676 | Ga0495668_0143676_541_1293 | 249 |
| 653 | 3300046665 | Ga0495661_0000281 | Ga0495661_0000281_4070_4822 | 249 |
| 654 | 3300046794 | Ga0495589_0000230 | Ga0495589_0000230_41947_42699 | 249 |
| 655 | 3300047443 | Ga0495687_000013 | Ga0495687_000013_366303_367055 | 249 |
| 656 | 3300047445 | Ga0495677_0000041 | Ga0495677_0000041_53111_53863 | 249 |
| 657 | 3300048091 | Ga0495626_0000383 | Ga0495626_0000383_3406_4158 | 249 |
| 658 | 3300048905 | Ga0496102_0082310 | Ga0496102_0082310_609_1361 | 249 |
| 659 | 3300048927 | Ga0496124_0035218 | Ga0496124_0035218_2347_3099 | 249 |
| 660 | 3300002738 | JGI25154J39366_1000359 | JGI25154J39366_100035916 | 252 |
| 661 | 3300025233 | Ga0209437_109976 | Ga0209437_1099762 | 252 |
| 662 | 3300025246 | Ga0209646_1000007 | Ga0209646_1000007406 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.9527 | 14 | 71 |
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9342 | 14 | 72 |
| 6j05-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9244 | 2 | 81 |
| 4lb5-assembly1.cif.gz_B | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.921 | 19 | 71 |
| 6j05-assembly1.cif.gz_A | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9202 | 2 | 80 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.978 | 13 | 70 | 1.10.10.10 |
| af_Q58793_245_317_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9663 | 9 | 71 | 1.10.10.10 |
| 4awxB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9627 | 16 | 72 | 1.10.10.10 |
| af_Q9C106_417_505_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9559 | 14 | 72 | 1.10.10.10 |
| 5j6xB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9527 | 14 | 71 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A659UVB0-F1-model_v4 | ArsR family transcriptional regulator | 1.001 | 5 | 76 |
GO:0003700
|
| AF-A0A370WV10-F1-model_v4 | ArsR family transcriptional regulator | 0.9965 | 5 | 86 |
GO:0003700
|
| AF-A0A3C1L3A4-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9807 | 5 | 76 |
GO:0003700
|
| AF-A0A1G2IVA2-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9716 | 1 | 75 |
GO:0003700
|
| AF-A0A1H3K9Z4-F1-model_v4 | ArsR family transcriptional regulator | 0.9671 | 2 | 80 |
GO:0003677
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar