F473487

General Info

Members Datasets Scaffolds Average Seq Length
662 317 1324 114

Family's Representative Sequence

Representative Sequence 3300035114|Ga0373939_0149972|Ga0373939_0149972_116_502
Length 128
Sequence MRKLDGEQVLMRIFIGESDRWEHRPLHAALVELFRREGLAGATVLRAVAGFGADSVVHTANILRLSADLPLVIEVVDSQEHLDRVLPQVDRMMRGGLITMEKVRVLKYEHTPRASAGPSRPPAASPTP

Samples

Sample ID Description Type Environment
1 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
185 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
188 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
197 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
198 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
199 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
200 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
201 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
208 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
209 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
220 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
221 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
222 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
223 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
224 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
225 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
229 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
230 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
231 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
232 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
233 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
234 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
235 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
238 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
292 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
299 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
300 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
310 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
311 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
312 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
313 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
314 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
315 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
316 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
317 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 0.15
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.6
Rhizoplane 1.21
Rhizosphere 96.98
Stem 0
Stem Tuber 0
Unclassified 16.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373939_0149972 3300035114 Bacteria 848
2 MBSR1b_contig_6046737 2162886012 Bacteria 1956
3 JGI26145J50221_1010444 3300003371 Unclassified 817
4 Ga0065704_10103269 3300005289 Bacteria 2177
5 Ga0065715_10120556 3300005293 Bacteria 2254
6 Ga0065715_10396918 3300005293 Bacteria 886
7 Ga0070658_10044797 3300005327 Bacteria 3576
8 Ga0070676_10000761 3300005328 Bacteria 15847
9 Ga0070690_100151579 3300005330 Unclassified 1582
10 Ga0070690_100211145 3300005330 Bacteria 1355
11 Ga0070670_100001509 3300005331 Bacteria 18750
12 Ga0070677_10083087 3300005333 Bacteria 1375
13 Ga0068869_100001124 3300005334 Bacteria 15606
14 Ga0070680_100000121 3300005336 Bacteria 45965
15 Ga0070680_100877401 3300005336 Bacteria 774
16 Ga0070682_100000248 3300005337 Bacteria 39129
17 Ga0068868_100810706 3300005338 Unclassified 845
18 Ga0070660_100000324 3300005339 Bacteria 31411
19 Ga0070689_101414117 3300005340 Bacteria 629
20 Ga0070691_10002283 3300005341 Bacteria 8490
21 Ga0070691_10565391 3300005341 Bacteria 666
22 Ga0070661_100001184 3300005344 Bacteria 18418
23 Ga0070692_10002173 3300005345 Bacteria 7511
24 Ga0070669_100025534 3300005353 Bacteria 4244
25 Ga0070675_100137170 3300005354 Unclassified 2088
26 Ga0070675_100369161 3300005354 Bacteria 1275
27 Ga0070673_100019655 3300005364 Bacteria 4853
28 Ga0070688_100190001 3300005365 Unclassified 1430
29 Ga0070659_100000713 3300005366 Bacteria 24148
30 Ga0070659_102094586 3300005366 Bacteria 508
31 Ga0070703_10083245 3300005406 Bacteria 1094
32 Ga0070709_10003535 3300005434 Bacteria 8396
33 Ga0070709_10373040 3300005434 Bacteria 1059
34 Ga0070709_10919963 3300005434 Bacteria 692
35 Ga0070714_100032897 3300005435 Bacteria 4331
36 Ga0070714_100058625 3300005435 Bacteria 3299
37 Ga0070713_100008549 3300005436 Bacteria 7264
38 Ga0070713_100244522 3300005436 Bacteria 1635
39 Ga0070713_100890042 3300005436 Bacteria 856
40 Ga0070710_10001667 3300005437 Bacteria 10462
41 Ga0070710_10521948 3300005437 Bacteria 816
42 Ga0070710_10634683 3300005437 Unclassified 747
43 Ga0070701_10066012 3300005438 Bacteria 1922
44 Ga0070711_100052654 3300005439 Bacteria 2802
45 Ga0070711_100061610 3300005439 Bacteria 2612
46 Ga0070705_100000243 3300005440 Bacteria 32441
47 Ga0070705_100201793 3300005440 Bacteria 1364
48 Ga0070705_101048570 3300005440 Bacteria 664
49 Ga0070700_100204183 3300005441 Bacteria 1390
50 Ga0070694_100000083 3300005444 Bacteria 45725
51 Ga0070694_100003765 3300005444 Bacteria 9047
52 Ga0070694_100086757 3300005444 Bacteria 2188
53 Ga0070694_100167006 3300005444 Bacteria 1619
54 Ga0070694_100870087 3300005444 Bacteria 742
55 Ga0070708_100016482 3300005445 Bacteria 6134
56 Ga0070708_100209005 3300005445 Bacteria 1828
57 Ga0070708_100249186 3300005445 Bacteria 1668
58 Ga0070708_100385676 3300005445 Unclassified 1321
59 Ga0070708_100400454 3300005445 Bacteria 1294
60 Ga0070708_100574009 3300005445 Bacteria 1063
61 Ga0070663_100015870 3300005455 Bacteria 4875
62 Ga0070662_100001659 3300005457 Bacteria 13691
63 Ga0070662_100093148 3300005457 Bacteria 2266
64 Ga0070681_10006200 3300005458 Bacteria 11621
65 Ga0070681_10064415 3300005458 Bacteria 3635
66 Ga0070681_10180261 3300005458 Bacteria 2034
67 Ga0068867_100002765 3300005459 Bacteria 12355
68 Ga0068867_100910203 3300005459 Bacteria 792
69 Ga0070685_10614352 3300005466 Unclassified 784
70 Ga0070706_100006098 3300005467 Bacteria 11397
71 Ga0070706_100013155 3300005467 Bacteria 7657
72 Ga0070706_100170309 3300005467 Unclassified 2033
73 Ga0070706_100236035 3300005467 Bacteria 1707
74 Ga0070706_100298859 3300005467 Bacteria 1502
75 Ga0070706_100593283 3300005467 Bacteria 1030
76 Ga0070706_101430633 3300005467 Unclassified 632
77 Ga0070706_101669648 3300005467 Unclassified 580
78 Ga0070707_100009232 3300005468 Bacteria 9151
79 Ga0070707_100058647 3300005468 Bacteria 3691
80 Ga0070707_100087051 3300005468 Unclassified 3021
81 Ga0070707_100122001 3300005468 Unclassified 2530
82 Ga0070707_100231994 3300005468 Bacteria 1796
83 Ga0070707_100241616 3300005468 Bacteria 1757
84 Ga0070707_100265848 3300005468 Bacteria 1668
85 Ga0070707_100276384 3300005468 Bacteria 1633
86 Ga0070707_101778683 3300005468 Unclassified 583
87 Ga0070698_100025229 3300005471 Bacteria 6193
88 Ga0070698_100050088 3300005471 Bacteria 4260
89 Ga0070698_100121940 3300005471 Bacteria 2566
90 Ga0070698_100223537 3300005471 Bacteria 1816
91 Ga0070698_100717286 3300005471 Unclassified 942
92 Ga0070698_101177816 3300005471 Bacteria 715
93 Ga0070698_101360667 3300005471 Bacteria 660
94 Ga0070699_100001989 3300005518 Bacteria 18435
95 Ga0070699_100043986 3300005518 Bacteria 3865
96 Ga0070699_100079635 3300005518 Bacteria 2854
97 Ga0070699_100176942 3300005518 Bacteria 1892
98 Ga0070699_100278806 3300005518 Unclassified 1497
99 Ga0070699_101054172 3300005518 Bacteria 746
100 Ga0070699_101054926 3300005518 Unclassified 745
101 Ga0070699_101220749 3300005518 Bacteria 690
102 Ga0070679_100000556 3300005530 Bacteria 31645
103 Ga0070679_100293971 3300005530 Bacteria 1576
104 Ga0070684_100019836 3300005535 Bacteria 5570
105 Ga0070697_100006126 3300005536 Bacteria 9304
106 Ga0070697_100012788 3300005536 Bacteria 6575
107 Ga0070697_100013690 3300005536 Bacteria 6365
108 Ga0070697_100024778 3300005536 Bacteria 4778
109 Ga0070697_100066827 3300005536 Bacteria 2939
110 Ga0070697_100108151 3300005536 Bacteria 2314
111 Ga0070697_100149744 3300005536 Bacteria 1967
112 Ga0070697_100193799 3300005536 Bacteria 1725
113 Ga0070697_100671976 3300005536 Bacteria 913
114 Ga0068853_100001255 3300005539 Bacteria 18126
115 Ga0068853_101885842 3300005539 Bacteria 579
116 Ga0070672_100274848 3300005543 Unclassified 1423
117 Ga0070686_100727041 3300005544 Unclassified 794
118 Ga0070695_100000283 3300005545 Bacteria 25591
119 Ga0070695_100003538 3300005545 Bacteria 9122
120 Ga0070695_100005205 3300005545 Bacteria 7674
121 Ga0070695_100050921 3300005545 Bacteria 2655
122 Ga0070696_100002779 3300005546 Bacteria 11621
123 Ga0070696_101211580 3300005546 Bacteria 638
124 Ga0070693_100000252 3300005547 Bacteria 24938
125 Ga0070704_100001442 3300005549 Bacteria 12716
126 Ga0070704_100023100 3300005549 Bacteria 4054
127 Ga0070704_100120375 3300005549 Bacteria 2015
128 Ga0070704_100141410 3300005549 Bacteria 1880
129 Ga0070704_100509534 3300005549 Unclassified 1046
130 Ga0070704_100829310 3300005549 Bacteria 828
131 Ga0070704_101040058 3300005549 Bacteria 742
132 Ga0068855_100000113 3300005563 Bacteria 100669
133 Ga0068855_100304471 3300005563 Bacteria 1764
134 Ga0070664_100002225 3300005564 Bacteria 15603
135 Ga0068857_100257050 3300005577 Unclassified 1602
136 Ga0068854_100000382 3300005578 Bacteria 28093
137 Ga0068856_100002739 3300005614 Bacteria 18046
138 Ga0070702_100005190 3300005615 Bacteria 6033
139 Ga0070702_101763937 3300005615 Bacteria 516
140 Ga0068852_101228024 3300005616 Unclassified 771
141 Ga0068859_100003662 3300005617 Bacteria 15662
142 Ga0068859_100159690 3300005617 Unclassified 2333
143 Ga0068864_100004646 3300005618 Bacteria 11259
144 Ga0068864_101652887 3300005618 Bacteria 645
145 Ga0068861_100019543 3300005719 Bacteria 4839
146 Ga0068851_10052875 3300005834 Bacteria 2066
147 Ga0068870_10000158 3300005840 Bacteria 23830
148 Ga0068863_100012945 3300005841 Bacteria 8046
149 Ga0068863_100321682 3300005841 Bacteria 1503
150 Ga0068863_100685587 3300005841 Bacteria 1018
151 Ga0068858_100004369 3300005842 Bacteria 13871
152 Ga0068858_100031480 3300005842 Bacteria 4927
153 Ga0068858_101571310 3300005842 Bacteria 649
154 Ga0068860_100013267 3300005843 Bacteria 8086
155 Ga0068860_100270381 3300005843 Bacteria 1659
156 Ga0068860_100276362 3300005843 Bacteria 1640
157 Ga0068862_100003595 3300005844 Bacteria 13269
158 Ga0068862_100020919 3300005844 Bacteria 5466
159 Ga0068862_100404516 3300005844 Bacteria 1278
160 Ga0081455_10002422 3300005937 Bacteria 22249
161 Ga0081455_10225575 3300005937 Bacteria 1386
162 Ga0081540_1010210 3300005983 Bacteria 6378
163 Ga0081540_1039106 3300005983 Bacteria 2490
164 Ga0070717_10039533 3300006028 Bacteria 3838
165 Ga0070717_10058208 3300006028 Bacteria 3196
166 Ga0070715_10005523 3300006163 Bacteria 4223
167 Ga0070716_100072631 3300006173 Bacteria 2026
168 Ga0070716_100686426 3300006173 Unclassified 781
169 Ga0070712_100005867 3300006175 Bacteria 7603
170 Ga0070712_100655192 3300006175 Bacteria 892
171 Ga0070712_100968171 3300006175 Unclassified 735
172 Ga0097621_100391841 3300006237 Unclassified 1242
173 Ga0068871_100913710 3300006358 Bacteria 814
174 Ga0075428_100177837 3300006844 Bacteria 2304
175 Ga0075428_100344440 3300006844 Unclassified 1600
176 Ga0075428_100358252 3300006844 Bacteria 1565
177 Ga0075428_101609239 3300006844 Unclassified 679
178 Ga0075431_101269459 3300006847 Unclassified 698
179 Ga0075433_10001034 3300006852 Bacteria 19853
180 Ga0075433_10002803 3300006852 Bacteria 13353
181 Ga0075433_10009028 3300006852 Bacteria 7963
182 Ga0075433_10012544 3300006852 Bacteria 6850
183 Ga0075433_10021581 3300006852 Bacteria 5401
184 Ga0075433_10025732 3300006852 Bacteria 4976
185 Ga0075433_10079127 3300006852 Bacteria 2897
186 Ga0075433_10175769 3300006852 Unclassified 1905
187 Ga0075433_11470805 3300006852 Unclassified 589
188 Ga0075434_100026490 3300006871 Bacteria 5681
189 Ga0075434_100042262 3300006871 Bacteria 4519
190 Ga0075434_100048727 3300006871 Bacteria 4204
191 Ga0075434_100064355 3300006871 Bacteria 3651
192 Ga0075434_100122775 3300006871 Bacteria 2613
193 Ga0075434_100126738 3300006871 Bacteria 2570
194 Ga0075434_100477232 3300006871 Unclassified 1268
195 Ga0075434_100931299 3300006871 Unclassified 883
196 Ga0075434_101024061 3300006871 Bacteria 839
197 Ga0075429_100005405 3300006880 Bacteria 10993
198 Ga0068865_100328181 3300006881 Bacteria 1233
199 Ga0075436_100087252 3300006914 Bacteria 2167
200 Ga0075436_100116720 3300006914 Bacteria 1865
201 Ga0075436_100163646 3300006914 Unclassified 1569
202 Ga0075436_100207674 3300006914 Archaea 1388
203 Ga0075436_100563013 3300006914 Bacteria 837
204 Ga0097620_100003662 3300006931 Bacteria 15662
205 Ga0097620_100159697 3300006931 Unclassified 2333
206 Ga0075435_100001766 3300007076 Bacteria 14089
207 Ga0075435_100016506 3300007076 Bacteria 5567
208 Ga0075435_100096178 3300007076 Bacteria 2450
209 Ga0075435_100639290 3300007076 Bacteria 923
210 Ga0075435_100695717 3300007076 Unclassified 883
211 Ga0075435_101425806 3300007076 Bacteria 607
212 Ga0099794_10003875 3300007265 Bacteria 5790
213 Ga0105240_10033738 3300009093 Bacteria 6609
214 Ga0105240_10465115 3300009093 Bacteria 1412
215 Ga0105240_10957919 3300009093 Bacteria 917
216 Ga0111539_10000343 3300009094 Bacteria 57201
217 Ga0111539_10064514 3300009094 Bacteria 4331
218 Ga0105245_12718208 3300009098 Unclassified 548
219 Ga0114129_10001800 3300009147 Bacteria 29212
220 Ga0114129_10129380 3300009147 Bacteria 3470
221 Ga0114129_10163749 3300009147 Bacteria 3036
222 Ga0114129_10176404 3300009147 Bacteria 2911
223 Ga0114129_10441228 3300009147 Unclassified 1709
224 Ga0114129_10550612 3300009147 Bacteria 1500
225 Ga0114129_11156786 3300009147 Bacteria 966
226 Ga0114129_11235811 3300009147 Bacteria 929
227 Ga0105243_10533156 3300009148 Bacteria 1118
228 Ga0105243_12371450 3300009148 Unclassified 569
229 Ga0105241_10000922 3300009174 Bacteria 22252
230 Ga0105241_12387673 3300009174 Bacteria 528
231 Ga0105242_10678273 3300009176 Bacteria 1005
232 Ga0105248_10242990 3300009177 Bacteria 2027
233 Ga0105248_10249610 3300009177 Bacteria 1997
234 Ga0105248_11123124 3300009177 Unclassified 888
235 Ga0105237_10083463 3300009545 Bacteria 3186
236 Ga0105237_10168700 3300009545 Bacteria 2188
237 Ga0105238_10055131 3300009551 Bacteria 3991
238 Ga0105238_11382395 3300009551 Unclassified 731
239 Ga0105249_10144511 3300009553 Bacteria 2284
240 Ga0105249_10643848 3300009553 Bacteria 1117
241 Ga0105239_10168883 3300010375 Bacteria 2446
242 Ga0105239_10574981 3300010375 Bacteria 1284
243 Ga0105239_11075669 3300010375 Unclassified 926
244 Ga0105246_10025947 3300011119 Bacteria 3822
245 Ga0157373_10000610 3300013100 Bacteria 27903
246 Ga0157371_10132868 3300013102 Bacteria 1771
247 Ga0157370_10076787 3300013104 Bacteria 3147
248 Ga0157369_10017154 3300013105 Bacteria 8134
249 Ga0157378_10060797 3300013297 Bacteria 3371
250 Ga0157378_10465404 3300013297 Unclassified 1257
251 Ga0157378_10968024 3300013297 Bacteria 884
252 Ga0157378_12160097 3300013297 Unclassified 608
253 Ga0157372_10000113 3300013307 Bacteria 85757
254 Ga0157375_10489668 3300013308 Bacteria 1394
255 Ga0182008_10058560 3300014497 Bacteria 1901
256 Ga0206353_10701500 3300020082 Bacteria 2234
257 Ga0213873_10081421 3300021358 Bacteria 907
258 Ga0213872_10002508 3300021361 Bacteria 10731
259 Ga0213872_10069255 3300021361 Bacteria 1591
260 Ga0213872_10168118 3300021361 Bacteria 952
261 Ga0213874_10012457 3300021377 Bacteria 2182
262 Ga0213871_10015531 3300021441 Bacteria 1823
263 Ga0213871_10076105 3300021441 Bacteria 955
264 Ga0213871_10113672 3300021441 Bacteria 802
265 Ga0207653_10003718 3300025885 Bacteria 4799
266 Ga0207692_10001482 3300025898 Bacteria 8804
267 Ga0207692_10141507 3300025898 Bacteria 1368
268 Ga0207688_10021370 3300025901 Bacteria 3536
269 Ga0207688_10438618 3300025901 Unclassified 813
270 Ga0207647_10110593 3300025904 Bacteria 1625
271 Ga0207699_10090245 3300025906 Bacteria 1922
272 Ga0207699_10234805 3300025906 Bacteria 1257
273 Ga0207699_10526996 3300025906 Bacteria 855
274 Ga0207645_10001184 3300025907 Bacteria 21539
275 Ga0207645_10090386 3300025907 Unclassified 1969
276 Ga0207643_10000289 3300025908 Bacteria 35030
277 Ga0207705_10268220 3300025909 Unclassified 1305
278 Ga0207684_10008857 3300025910 Bacteria 8934
279 Ga0207684_10028592 3300025910 Bacteria 4750
280 Ga0207684_10036649 3300025910 Bacteria 4162
281 Ga0207684_10102322 3300025910 Bacteria 2449
282 Ga0207684_10116636 3300025910 Bacteria 2288
283 Ga0207684_10141904 3300025910 Unclassified 2065
284 Ga0207684_10377058 3300025910 Bacteria 1220
285 Ga0207684_11059664 3300025910 Unclassified 676
286 Ga0207684_11303666 3300025910 Unclassified 598
287 Ga0207654_10006301 3300025911 Bacteria 5964
288 Ga0207707_10000740 3300025912 Bacteria 32307
289 Ga0207707_10828336 3300025912 Bacteria 769
290 Ga0207695_10474187 3300025913 Bacteria 1134
291 Ga0207671_10190022 3300025914 Bacteria 1601
292 Ga0207671_10438373 3300025914 Bacteria 1040
293 Ga0207693_10001156 3300025915 Bacteria 23542
294 Ga0207693_10031072 3300025915 Bacteria 4219
295 Ga0207693_10041162 3300025915 Unclassified 3638
296 Ga0207663_10000774 3300025916 Bacteria 14300
297 Ga0207663_10016938 3300025916 Bacteria 4052
298 Ga0207660_10002444 3300025917 Bacteria 12199
299 Ga0207660_10808026 3300025917 Bacteria 765
300 Ga0207657_10000208 3300025919 Bacteria 60691
301 Ga0207649_10001664 3300025920 Bacteria 12854
302 Ga0207652_10000463 3300025921 Bacteria 41582
303 Ga0207652_10319633 3300025921 Bacteria 1401
304 Ga0207646_10003038 3300025922 Bacteria 19305
305 Ga0207646_10014253 3300025922 Bacteria 7558
306 Ga0207646_10200045 3300025922 Bacteria 1805
307 Ga0207646_10224157 3300025922 Bacteria 1698
308 Ga0207646_10537560 3300025922 Bacteria 1051
309 Ga0207681_10023291 3300025923 Bacteria 3959
310 Ga0207694_10297895 3300025924 Bacteria 1327
311 Ga0207650_10057744 3300025925 Bacteria 2887
312 Ga0207659_10076517 3300025926 Bacteria 2460
313 Ga0207700_10045351 3300025928 Bacteria 3243
314 Ga0207700_10123165 3300025928 Bacteria 2105
315 Ga0207664_10163561 3300025929 Bacteria 1900
316 Ga0207664_10667879 3300025929 Bacteria 934
317 Ga0207690_10001254 3300025932 Bacteria 16060
318 Ga0207690_11662042 3300025932 Bacteria 534
319 Ga0207706_10002799 3300025933 Bacteria 16951
320 Ga0207706_10096717 3300025933 Bacteria 2597
321 Ga0207709_10440137 3300025935 Bacteria 1005
322 Ga0207670_10291731 3300025936 Unclassified 1274
323 Ga0207704_10685288 3300025938 Unclassified 847
324 Ga0207665_10001062 3300025939 Bacteria 18496
325 Ga0207665_11089641 3300025939 Bacteria 637
326 Ga0207691_10015665 3300025940 Bacteria 7206
327 Ga0207711_10529695 3300025941 Unclassified 1099
328 Ga0207711_10703497 3300025941 Bacteria 942
329 Ga0207711_11000631 3300025941 Bacteria 775
330 Ga0207689_10002156 3300025942 Bacteria 18513
331 Ga0207679_10001910 3300025945 Bacteria 12930
332 Ga0207667_10002886 3300025949 Bacteria 21342
333 Ga0207651_11340963 3300025960 Unclassified 643
334 Ga0207712_10533220 3300025961 Bacteria 1008
335 Ga0207712_10584820 3300025961 Unclassified 964
336 Ga0207712_10789017 3300025961 Bacteria 834
337 Ga0207640_10001541 3300025981 Bacteria 12430
338 Ga0207703_10007987 3300026035 Bacteria 8361
339 Ga0207703_10128285 3300026035 Bacteria 2187
340 Ga0207703_12034389 3300026035 Unclassified 551
341 Ga0207639_10000992 3300026041 Bacteria 19332
342 Ga0207678_10019023 3300026067 Bacteria 6033
343 Ga0207708_10239894 3300026075 Bacteria 1458
344 Ga0207702_10002921 3300026078 Bacteria 15998
345 Ga0207641_10020661 3300026088 Bacteria 5410
346 Ga0207641_10067294 3300026088 Bacteria 3068
347 Ga0207641_10974116 3300026088 Bacteria 844
348 Ga0207648_10000170 3300026089 Bacteria 67608
349 Ga0207648_11293790 3300026089 Bacteria 685
350 Ga0207676_10066074 3300026095 Bacteria 2882
351 Ga0207674_10005047 3300026116 Bacteria 15752
352 Ga0207675_100020617 3300026118 Bacteria 6143
353 Ga0207698_11098936 3300026142 Unclassified 808
354 Ga0209969_1034930 3300027360 Bacteria 774
355 Ga0209981_1024740 3300027378 Bacteria 867
356 Ga0209996_1004741 3300027395 Bacteria 1735
357 Ga0210000_1011547 3300027462 Bacteria 1309
358 Ga0209995_1001389 3300027471 Bacteria 3731
359 Ga0209968_1002820 3300027526 Bacteria 2607
360 Ga0209999_1024318 3300027543 Archaea 1117
361 Ga0209982_1037829 3300027552 Bacteria 766
362 Ga0209983_1007709 3300027665 Bacteria 2204
363 Ga0209588_1096698 3300027671 Unclassified 951
364 Ga0209971_1000017 3300027682 Bacteria 65369
365 Ga0209966_1000023 3300027695 Bacteria 67589
366 Ga0209998_10000092 3300027717 Bacteria 35606
367 Ga0209998_10079224 3300027717 Unclassified 794
368 Ga0209974_10000268 3300027876 Bacteria 16908
369 Ga0209974_10212666 3300027876 Unclassified 717
370 Ga0207428_10000368 3300027907 Bacteria 57659
371 Ga0207428_10067305 3300027907 Bacteria 2820
372 Ga0268265_10008666 3300028380 Bacteria 6875
373 Ga0268265_10019934 3300028380 Bacteria 4671
374 Ga0268265_10493119 3300028380 Bacteria 1153
375 Ga0268264_10024445 3300028381 Bacteria 4932
376 Ga0268264_10285189 3300028381 Unclassified 1549
377 Ga0268264_10762739 3300028381 Bacteria 964
378 Ga0265334_10011674 3300028573 Bacteria 3694
379 Ga0265318_10148396 3300028577 Bacteria 860
380 Ga0265323_10029373 3300028653 Bacteria 2056
381 Ga0265338_10009756 3300028800 Bacteria 11387
382 Ga0265338_10091672 3300028800 Bacteria 2509
383 Ga0265338_10201895 3300028800 Bacteria 1499
384 Ga0265338_10300459 3300028800 Bacteria 1167
385 Ga0265338_10347444 3300028800 Bacteria 1067
386 Ga0265324_10046954 3300029957 Bacteria 1486
387 Ga0265330_10269344 3300031235 Bacteria 718
388 Ga0265340_10085133 3300031247 Bacteria 1484
389 Ga0265340_10425032 3300031247 Bacteria 586
390 Ga0265339_10022296 3300031249 Bacteria 3670
391 Ga0265331_10001317 3300031250 Bacteria 18398
392 Ga0265331_10108411 3300031250 Bacteria 1275
393 Ga0265316_10008917 3300031344 Bacteria 9260
394 Ga0265316_10031479 3300031344 Bacteria 4337
395 Ga0265316_10184794 3300031344 Bacteria 1551
396 Ga0265316_10207475 3300031344 Bacteria 1450
397 Ga0265316_10351199 3300031344 Unclassified 1068
398 Ga0265313_10000475 3300031595 Bacteria 41956
399 Ga0265314_10000050 3300031711 Bacteria 189257
400 Ga0265314_10081581 3300031711 Bacteria 2130
401 Ga0265314_10130482 3300031711 Bacteria 1569
402 Ga0265314_10213925 3300031711 Bacteria 1130
403 Ga0265342_10024877 3300031712 Bacteria 3773
404 Ga0265342_10442830 3300031712 Bacteria 667
405 Ga0316576_10164127 3300031727 Bacteria 1676
406 Ga0373948_0012575 3300034817 Unclassified 1514
407 Ga0373948_0027659 3300034817 Bacteria 1124
408 Ga0373959_0044783 3300034820 Unclassified 939
409 Ga0373929_0067195 3300035085 Unclassified 851
410 Ga0373949_0003374 3300035090 Bacteria 3829
411 Ga0373951_0023061 3300035091 Unclassified 1436
412 Ga0373941_0014356 3300035115 Bacteria 2114
413 Ga0373941_0045680 3300035115 Unclassified 1372
414 Ga0373953_0206214 3300035117 Bacteria 851
415 Ga0373954_0017913 3300035118 Unclassified 3185
416 Ga0373956_0057997 3300035119 Bacteria 1750
417 Ga0373956_0128672 3300035119 Unclassified 1185
418 Ga0373956_0517660 3300035119 Bacteria 569
419 Ga0373955_1040441 3300035172 Unclassified 504
420 Ga0373942_0033496 3300035207 Bacteria 1370
421 Ga0373961_0042790 3300035241 Bacteria 1314
422 Ga0373962_0114954 3300035242 Bacteria 853
423 Ga0373931_0031015 3300035691 Bacteria 2755
424 Ga0373931_0240324 3300035691 Bacteria 1098
425 Ga0373931_0667220 3300035691 Bacteria 684
426 Ga0373935_0363474 3300035692 Bacteria 1034
427 Ga0373935_0421091 3300035692 Bacteria 961
428 Ga0373933_0148991 3300035724 Bacteria 1481
429 Ga0373933_0392375 3300035724 Bacteria 905
430 Ga0373933_0456529 3300035724 Bacteria 836
431 Ga0373937_0075417 3300036401 Unclassified 3113
432 Ga0373937_0363308 3300036401 Bacteria 1372
433 Ga0373937_1213464 3300036401 Bacteria 703
434 Ga0373937_1945682 3300036401 Bacteria 534
435 Ga0316582_1224527 3300036647 Unclassified 511
436 Ga0395899_0185977 3300037312 Bacteria 1456
437 Ga0395899_0685653 3300037312 Bacteria 644
438 Ga0395900_0715673 3300037418 Bacteria 934
439 Ga0395900_0777987 3300037418 Bacteria 886
440 Ga0395905_0188879 3300037471 Bacteria 1933
441 Ga0395901_0306943 3300038443 Bacteria 1644
442 Ga0400484_32846 3300038725 Bacteria 16868
443 Ga0400490_44207 3300038726 Bacteria 1785
444 Ga0400488_56031 3300038741 Bacteria 1781
445 Ga0400486_06582 3300038742 Unclassified 1335
446 Ga0242420_102476 3300038996 Bacteria 610
447 Ga0436360_0209130 3300039438 Bacteria 1093
448 Ga0436360_0238687 3300039438 Bacteria 2010
449 Ga0436360_0902049 3300039438 Bacteria 2497
450 Ga0436361_0561838 3300039447 Bacteria 1524
451 Ga0436361_0778234 3300039447 Bacteria 5173
452 Ga0436361_0879727 3300039447 Bacteria 2422
453 Ga0436361_1051621 3300039447 Bacteria 15884
454 Ga0436361_1154221 3300039447 Unclassified 668
455 Ga0436363_1474631 3300039450 Bacteria 7338
456 Ga0436362_0081337 3300039453 Bacteria 3433
457 Ga0439441_178273 3300042001 Unclassified 510
458 Ga0439448_0033234 3300042005 Unclassified 1645
459 Ga0439448_0143766 3300042005 Unclassified 826
460 Ga0439455_0009944 3300042012 Unclassified 2077
461 Ga0439463_029776 3300042016 Bacteria 1376
462 Ga0439458_0009251 3300042157 Bacteria 2193
463 Ga0439459_0001436 3300042438 Bacteria 3510
464 Ga0439464_0038134 3300042439 Bacteria 1365
465 Ga0439460_0067707 3300042461 Unclassified 1101
466 Ga0451577_0003730 3300042876 Bacteria 16631
467 Ga0451577_0097867 3300042876 Bacteria 2620
468 Ga0451577_0230776 3300042876 Bacteria 1674
469 Ga0451577_0438082 3300042876 Unclassified 1187
470 Ga0451577_0474485 3300042876 Unclassified 1136
471 Ga0451577_0994152 3300042876 Bacteria 753
472 Ga0451577_1198360 3300042876 Bacteria 677
473 Ga0453683_0115653 3300044673 Bacteria 1687
474 Ga0453683_0167913 3300044673 Bacteria 1389
475 Ga0453683_0746416 3300044673 Bacteria 643
476 Ga0453684_0007535 3300044712 Bacteria 19955
477 Ga0453684_0173297 3300044712 Bacteria 2540
478 Ga0453684_0319084 3300044712 Bacteria 1760
479 Ga0451576_0017192 3300045051 Bacteria 7956
480 Ga0451576_0017473 3300045051 Bacteria 7885
481 Ga0451576_0017977 3300045051 Bacteria 7758
482 Ga0451576_0040248 3300045051 Bacteria 4948
483 Ga0451576_0096341 3300045051 Bacteria 3078
484 Ga0451576_0312449 3300045051 Bacteria 1644
485 Ga0466967_0015425 3300045976 Bacteria 5989
486 Ga0495629_0000053 3300046459 Bacteria 106535
487 Ga0495629_0098901 3300046459 Bacteria 2036
488 Ga0495580_0091023 3300046472 Bacteria 2123
489 Ga0495582_0045960 3300046473 Bacteria 2405
490 Ga0495594_0008360 3300046499 Bacteria 5331
491 Ga0495618_0017308 3300046514 Bacteria 4417
492 Ga0495628_0359724 3300046516 Unclassified 1069
493 Ga0495586_0000890 3300046535 Bacteria 17068
494 Ga0495645_0153719 3300046543 Bacteria 1596
495 Ga0495667_0952327 3300046559 Unclassified 525
496 Ga0495634_0001227 3300046642 Bacteria 23610
497 Ga0495634_0054070 3300046642 Bacteria 2688
498 Ga0495635_0002339 3300046663 Bacteria 12884
499 Ga0495623_0172866 3300046679 Bacteria 1261
500 Ga0495658_0000391 3300046683 Bacteria 24709
501 Ga0495613_0006135 3300046689 Bacteria 8995
502 Ga0495613_0055325 3300046689 Bacteria 2915
503 Ga0495613_0182940 3300046689 Unclassified 1484
504 Ga0495581_0000381 3300047315 Bacteria 22243
505 Ga0495674_0384112 3300047319 Bacteria 1136
506 Ga0495676_0155211 3300047321 Bacteria 1625
507 Ga0495680_0006445 3300047322 Bacteria 10902
508 Ga0495680_0040138 3300047322 Unclassified 3730
509 Ga0495675_0372854 3300047444 Unclassified 836
510 Ga0495684_0379971 3300047471 Bacteria 996
511 Ga0495602_0790425 3300048088 Bacteria 638
512 Ga0495614_0019638 3300048089 Bacteria 2924
513 Ga0496100_0034584 3300048903 Bacteria 3173
514 Ga0496102_0040658 3300048905 Bacteria 4207
515 Ga0496102_0243897 3300048905 Bacteria 1694
516 Ga0496102_1291791 3300048905 Bacteria 649
517 Ga0496103_0679050 3300048906 Unclassified 653
518 Ga0496106_0982554 3300048909 Unclassified 664
519 Ga0496110_0164987 3300048913 Unclassified 2009
520 Ga0496112_0942373 3300048915 Unclassified 784
521 Ga0501031_0265193 3300049568 Unclassified 1116
522 Ga0501032_0869393 3300049569 Unclassified 568
523 Ga0501033_0009739 3300049570 Bacteria 7384
524 Ga0501033_0090715 3300049570 Bacteria 2236
525 Ga0501033_0565053 3300049570 Unclassified 783
526 Ga0501036_0002580 3300049572 Bacteria 14248
527 Ga0501036_0136051 3300049572 Bacteria 2074
528 Ga0501037_0071438 3300049573 Bacteria 2525
529 Ga0501037_0401712 3300049573 Bacteria 940
530 Ga0501037_0508036 3300049573 Unclassified 817
531 Ga0501037_0718342 3300049573 Bacteria 664
532 Ga0501038_0000783 3300049574 Bacteria 28173
533 Ga0501038_1083365 3300049574 Bacteria 585
534 Ga0501039_0034674 3300049575 Bacteria 3893
535 Ga0501039_0040515 3300049575 Bacteria 3596
536 Ga0501039_0688584 3300049575 Bacteria 800
537 Ga0501040_0000922 3300049576 Bacteria 18444
538 Ga0501040_0002714 3300049576 Bacteria 11408
539 Ga0501040_0031160 3300049576 Bacteria 3602
540 Ga0501040_0136632 3300049576 Bacteria 1726
541 Ga0501040_0173967 3300049576 Bacteria 1525
542 Ga0501041_0000348 3300049577 Bacteria 22793
543 Ga0501041_0018562 3300049577 Bacteria 4143
544 Ga0501041_0534422 3300049577 Bacteria 747
545 Ga0501042_0000299 3300049578 Bacteria 24677
546 Ga0501043_0266736 3300049579 Bacteria 1315
547 Ga0501046_0000449 3300049580 Bacteria 41384
548 Ga0501046_0000578 3300049580 Bacteria 36123
549 Ga0501046_0062144 3300049580 Bacteria 2919
550 Ga0501046_0725065 3300049580 Unclassified 699
551 Ga0501047_0092480 3300049581 Bacteria 2903
552 Ga0501048_0000368 3300049582 Bacteria 31253
553 Ga0501048_0046443 3300049582 Bacteria 3100
554 Ga0501048_0160012 3300049582 Bacteria 1593
555 Ga0501068_0029362 3300049584 Bacteria 3255
556 Ga0501070_0545243 3300049586 Bacteria 929
557 Ga0501070_1500444 3300049586 Unclassified 510
558 Ga0501071_0000485 3300049587 Bacteria 20085
559 Ga0501071_0367946 3300049587 Bacteria 1095
560 Ga0501071_0922365 3300049587 Unclassified 674
561 Ga0501072_0002413 3300049588 Bacteria 14010
562 Ga0501072_0059850 3300049588 Bacteria 3003
563 Ga0501072_0061784 3300049588 Bacteria 2955
564 Ga0501073_0113416 3300049589 Bacteria 1880
565 Ga0501074_0002446 3300049590 Bacteria 12951
566 Ga0501074_0121485 3300049590 Bacteria 1868
567 Ga0501075_0000035 3300049591 Bacteria 55355
568 Ga0501075_0060726 3300049591 Bacteria 2848
569 Ga0501075_0123182 3300049591 Bacteria 1973
570 Ga0501075_0163351 3300049591 Unclassified 1699
571 Ga0501076_0000860 3300049592 Bacteria 19712
572 Ga0501076_0038068 3300049592 Bacteria 3775
573 Ga0501076_0340029 3300049592 Bacteria 1232
574 Ga0501076_1486060 3300049592 Unclassified 556
575 Ga0501077_0000326 3300049593 Bacteria 28556
576 Ga0501077_0037263 3300049593 Bacteria 3098
577 Ga0501077_0411936 3300049593 Bacteria 864
578 Ga0501077_0534348 3300049593 Bacteria 752
579 Ga0501077_0837524 3300049593 Unclassified 591
580 Ga0501079_0000217 3300049741 Bacteria 34005
581 Ga0501079_0061716 3300049741 Bacteria 2891
582 Ga0501079_0076958 3300049741 Bacteria 2580
583 Ga0501079_1595894 3300049741 Bacteria 513
584 Ga0501080_0005619 3300049742 Bacteria 11205
585 Ga0501080_0046345 3300049742 Bacteria 4048
586 Ga0501080_0638872 3300049742 Bacteria 942
587 Ga0501081_0000111 3300049743 Bacteria 34899
588 Ga0501081_0002416 3300049743 Bacteria 11781
589 Ga0501081_0111992 3300049743 Bacteria 1937
590 Ga0501081_0161667 3300049743 Bacteria 1614
591 Ga0501081_0225827 3300049743 Bacteria 1363
592 Ga0501081_0471244 3300049743 Bacteria 934
593 Ga0501083_0002743 3300049744 Bacteria 12170
594 Ga0501083_0013327 3300049744 Bacteria 5749
595 Ga0501083_0506209 3300049744 Bacteria 786
596 Ga0501035_0005598 3300049822 Bacteria 11864
597 Ga0501044_0543114 3300049823 Bacteria 1060
598 Ga0501045_0001426 3300049824 Bacteria 15934
599 Ga0501045_0105825 3300049824 Bacteria 2085
600 nmdc:mga05p37_151675_c1 3300050507 Bacteria 2834
601 nmdc:mga05p37_1671232_c1 3300050507 Unclassified 623
602 nmdc:mga05p37_211085_c1 3300050507 Bacteria 2347
603 nmdc:mga05p37_221888_c1 3300050507 Bacteria 2281
604 nmdc:mga05p37_228562_c1 3300050507 Bacteria 2242
605 nmdc:mga05p37_326040_c1 3300050507 Bacteria 1816
606 nmdc:mga05p37_70354_c1 3300050507 Bacteria 4304
607 nmdc:mga09592_106566_c1 3300050508 Bacteria 2404
608 nmdc:mga09592_598137_c1 3300050508 Bacteria 945
609 nmdc:mga09592_613316_c1 3300050508 Bacteria 931
610 nmdc:mga06r32_340533_c1 3300050510 Bacteria 1484
611 nmdc:mga08y16_162082_c1 3300050511 Bacteria 2324
612 nmdc:mga08y16_1841_c1 3300050511 Bacteria 21510
613 nmdc:mga0n895_118028_c1 3300050512 Unclassified 2673
614 nmdc:mga0n895_120538_c1 3300050512 Bacteria 2644
615 nmdc:mga0n895_13385_c1 3300050512 Bacteria 7398
616 nmdc:mga0n895_18087_c1 3300050512 Bacteria 6515
617 nmdc:mga0n895_30654_c1 3300050512 Bacteria 5142
618 nmdc:mga0n895_3980_c1 3300050512 Bacteria 12015
619 nmdc:mga0n895_401714_c1 3300050512 Bacteria 1386
620 nmdc:mga0n895_428576_c1 3300050512 Unclassified 1337
621 nmdc:mga0n895_454573_c1 3300050512 Unclassified 1293
622 nmdc:mga0n895_72806_c1 3300050512 Unclassified 3410
623 nmdc:mga0rr50_100815_c1 3300050513 Bacteria 2268
624 nmdc:mga0rr50_1131141_c1 3300050513 Bacteria 666
625 nmdc:mga0rr50_152299_c1 3300050513 Archaea 1870
626 nmdc:mga0rr50_187021_c1 3300050513 Bacteria 1696
627 nmdc:mga0rr50_362221_c1 3300050513 Unclassified 1221
628 nmdc:mga0rr50_434788_c1 3300050513 Unclassified 1111
629 nmdc:mga0rr50_59932_c1 3300050513 Unclassified 2861
630 nmdc:mga0rr50_75500_c1 3300050513 Bacteria 2584
631 nmdc:mga0rr50_957605_c1 3300050513 Bacteria 730
632 nmdc:mga08x19_175143_c1 3300050514 Archaea 1462
633 nmdc:mga08x19_282994_c1 3300050514 Unclassified 1149
634 nmdc:mga08x19_391764_c1 3300050514 Bacteria 974
635 nmdc:mga08x19_422357_c1 3300050514 Bacteria 937
636 nmdc:mga0a205_1114549_c1 3300050515 Unclassified 637
637 nmdc:mga0a205_16471_c1 3300050515 Bacteria 6922
638 nmdc:mga0a205_1787_c1 3300050515 Bacteria 16271
639 nmdc:mga0a205_1873_c2 3300050515 Bacteria 12699
640 nmdc:mga0a205_191005_c1 3300050515 Bacteria 1940
641 nmdc:mga0a205_1987_c1 3300050515 Bacteria 17821
642 nmdc:mga0a205_261368_c1 3300050515 Bacteria 1609
643 nmdc:mga0a205_61216_c1 3300050515 Bacteria 3636
644 nmdc:mga0a205_689_c1 3300050515 Bacteria 27003
645 nmdc:mga0a205_8468_c1 3300050515 Bacteria 9360
646 Ga0495619_0000824 3300053085 Bacteria 20315
647 Ga0501084_0000724 3300054114 Bacteria 25114
648 Ga0501084_0084316 3300054114 Bacteria 2667
649 Ga0501084_0334423 3300054114 Bacteria 1279
650 Ga0501082_0001342 3300060353 Bacteria 21602
651 Ga0501082_0004978 3300060353 Bacteria 11596
652 Ga0501082_0068992 3300060353 Bacteria 3044
653 Ga0501082_0706967 3300060353 Bacteria 882
654 Ga0530510_0000128 3300061734 Bacteria 44069
655 Ga0530510_0299138 3300061734 Bacteria 1204
656 2513722055 2513237104 Bacteria 10034502
657 2524441207 2524023205 Bacteria 8918781
658 2745078668 2744054633 Bacteria 8678936
659 2788436622 2786546940 Bacteria 6396474
660 2874128131 2874123672 Bacteria 7238285
661 2885316769 2885312484 Bacteria 6415165
662 2937845902 2937843397 Bacteria 5256375
663 Ga0373939_0149972
664 MBSR1b_contig_6046737
665 JGI26145J50221_1010444
666 Ga0065704_10103269
667 Ga0065715_10120556
668 Ga0065715_10396918
669 Ga0070658_10044797
670 Ga0070676_10000761
671 Ga0070690_100151579
672 Ga0070690_100211145
673 Ga0070670_100001509
674 Ga0070677_10083087
675 Ga0068869_100001124
676 Ga0070680_100000121
677 Ga0070680_100877401
678 Ga0070682_100000248
679 Ga0068868_100810706
680 Ga0070660_100000324
681 Ga0070689_101414117
682 Ga0070691_10002283
683 Ga0070691_10565391
684 Ga0070661_100001184
685 Ga0070692_10002173
686 Ga0070669_100025534
687 Ga0070675_100137170
688 Ga0070675_100369161
689 Ga0070673_100019655
690 Ga0070688_100190001
691 Ga0070659_100000713
692 Ga0070659_102094586
693 Ga0070703_10083245
694 Ga0070709_10003535
695 Ga0070709_10373040
696 Ga0070709_10919963
697 Ga0070714_100032897
698 Ga0070714_100058625
699 Ga0070713_100008549
700 Ga0070713_100244522
701 Ga0070713_100890042
702 Ga0070710_10001667
703 Ga0070710_10521948
704 Ga0070710_10634683
705 Ga0070701_10066012
706 Ga0070711_100052654
707 Ga0070711_100061610
708 Ga0070705_100000243
709 Ga0070705_100201793
710 Ga0070705_101048570
711 Ga0070700_100204183
712 Ga0070694_100000083
713 Ga0070694_100003765
714 Ga0070694_100086757
715 Ga0070694_100167006
716 Ga0070694_100870087
717 Ga0070708_100016482
718 Ga0070708_100209005
719 Ga0070708_100249186
720 Ga0070708_100385676
721 Ga0070708_100400454
722 Ga0070708_100574009
723 Ga0070663_100015870
724 Ga0070662_100001659
725 Ga0070662_100093148
726 Ga0070681_10006200
727 Ga0070681_10064415
728 Ga0070681_10180261
729 Ga0068867_100002765
730 Ga0068867_100910203
731 Ga0070685_10614352
732 Ga0070706_100006098
733 Ga0070706_100013155
734 Ga0070706_100170309
735 Ga0070706_100236035
736 Ga0070706_100298859
737 Ga0070706_100593283
738 Ga0070706_101430633
739 Ga0070706_101669648
740 Ga0070707_100009232
741 Ga0070707_100058647
742 Ga0070707_100087051
743 Ga0070707_100122001
744 Ga0070707_100231994
745 Ga0070707_100241616
746 Ga0070707_100265848
747 Ga0070707_100276384
748 Ga0070707_101778683
749 Ga0070698_100025229
750 Ga0070698_100050088
751 Ga0070698_100121940
752 Ga0070698_100223537
753 Ga0070698_100717286
754 Ga0070698_101177816
755 Ga0070698_101360667
756 Ga0070699_100001989
757 Ga0070699_100043986
758 Ga0070699_100079635
759 Ga0070699_100176942
760 Ga0070699_100278806
761 Ga0070699_101054172
762 Ga0070699_101054926
763 Ga0070699_101220749
764 Ga0070679_100000556
765 Ga0070679_100293971
766 Ga0070684_100019836
767 Ga0070697_100006126
768 Ga0070697_100012788
769 Ga0070697_100013690
770 Ga0070697_100024778
771 Ga0070697_100066827
772 Ga0070697_100108151
773 Ga0070697_100149744
774 Ga0070697_100193799
775 Ga0070697_100671976
776 Ga0068853_100001255
777 Ga0068853_101885842
778 Ga0070672_100274848
779 Ga0070686_100727041
780 Ga0070695_100000283
781 Ga0070695_100003538
782 Ga0070695_100005205
783 Ga0070695_100050921
784 Ga0070696_100002779
785 Ga0070696_101211580
786 Ga0070693_100000252
787 Ga0070704_100001442
788 Ga0070704_100023100
789 Ga0070704_100120375
790 Ga0070704_100141410
791 Ga0070704_100509534
792 Ga0070704_100829310
793 Ga0070704_101040058
794 Ga0068855_100000113
795 Ga0068855_100304471
796 Ga0070664_100002225
797 Ga0068857_100257050
798 Ga0068854_100000382
799 Ga0068856_100002739
800 Ga0070702_100005190
801 Ga0070702_101763937
802 Ga0068852_101228024
803 Ga0068859_100003662
804 Ga0068859_100159690
805 Ga0068864_100004646
806 Ga0068864_101652887
807 Ga0068861_100019543
808 Ga0068851_10052875
809 Ga0068870_10000158
810 Ga0068863_100012945
811 Ga0068863_100321682
812 Ga0068863_100685587
813 Ga0068858_100004369
814 Ga0068858_100031480
815 Ga0068858_101571310
816 Ga0068860_100013267
817 Ga0068860_100270381
818 Ga0068860_100276362
819 Ga0068862_100003595
820 Ga0068862_100020919
821 Ga0068862_100404516
822 Ga0081455_10002422
823 Ga0081455_10225575
824 Ga0081540_1010210
825 Ga0081540_1039106
826 Ga0070717_10039533
827 Ga0070717_10058208
828 Ga0070715_10005523
829 Ga0070716_100072631
830 Ga0070716_100686426
831 Ga0070712_100005867
832 Ga0070712_100655192
833 Ga0070712_100968171
834 Ga0097621_100391841
835 Ga0068871_100913710
836 Ga0075428_100177837
837 Ga0075428_100344440
838 Ga0075428_100358252
839 Ga0075428_101609239
840 Ga0075431_101269459
841 Ga0075433_10001034
842 Ga0075433_10002803
843 Ga0075433_10009028
844 Ga0075433_10012544
845 Ga0075433_10021581
846 Ga0075433_10025732
847 Ga0075433_10079127
848 Ga0075433_10175769
849 Ga0075433_11470805
850 Ga0075434_100026490
851 Ga0075434_100042262
852 Ga0075434_100048727
853 Ga0075434_100064355
854 Ga0075434_100122775
855 Ga0075434_100126738
856 Ga0075434_100477232
857 Ga0075434_100931299
858 Ga0075434_101024061
859 Ga0075429_100005405
860 Ga0068865_100328181
861 Ga0075436_100087252
862 Ga0075436_100116720
863 Ga0075436_100163646
864 Ga0075436_100207674
865 Ga0075436_100563013
866 Ga0097620_100003662
867 Ga0097620_100159697
868 Ga0075435_100001766
869 Ga0075435_100016506
870 Ga0075435_100096178
871 Ga0075435_100639290
872 Ga0075435_100695717
873 Ga0075435_101425806
874 Ga0099794_10003875
875 Ga0105240_10033738
876 Ga0105240_10465115
877 Ga0105240_10957919
878 Ga0111539_10000343
879 Ga0111539_10064514
880 Ga0105245_12718208
881 Ga0114129_10001800
882 Ga0114129_10129380
883 Ga0114129_10163749
884 Ga0114129_10176404
885 Ga0114129_10441228
886 Ga0114129_10550612
887 Ga0114129_11156786
888 Ga0114129_11235811
889 Ga0105243_10533156
890 Ga0105243_12371450
891 Ga0105241_10000922
892 Ga0105241_12387673
893 Ga0105242_10678273
894 Ga0105248_10242990
895 Ga0105248_10249610
896 Ga0105248_11123124
897 Ga0105237_10083463
898 Ga0105237_10168700
899 Ga0105238_10055131
900 Ga0105238_11382395
901 Ga0105249_10144511
902 Ga0105249_10643848
903 Ga0105239_10168883
904 Ga0105239_10574981
905 Ga0105239_11075669
906 Ga0105246_10025947
907 Ga0157373_10000610
908 Ga0157371_10132868
909 Ga0157370_10076787
910 Ga0157369_10017154
911 Ga0157378_10060797
912 Ga0157378_10465404
913 Ga0157378_10968024
914 Ga0157378_12160097
915 Ga0157372_10000113
916 Ga0157375_10489668
917 Ga0182008_10058560
918 Ga0206353_10701500
919 Ga0213873_10081421
920 Ga0213872_10002508
921 Ga0213872_10069255
922 Ga0213872_10168118
923 Ga0213874_10012457
924 Ga0213871_10015531
925 Ga0213871_10076105
926 Ga0213871_10113672
927 Ga0207653_10003718
928 Ga0207692_10001482
929 Ga0207692_10141507
930 Ga0207688_10021370
931 Ga0207688_10438618
932 Ga0207647_10110593
933 Ga0207699_10090245
934 Ga0207699_10234805
935 Ga0207699_10526996
936 Ga0207645_10001184
937 Ga0207645_10090386
938 Ga0207643_10000289
939 Ga0207705_10268220
940 Ga0207684_10008857
941 Ga0207684_10028592
942 Ga0207684_10036649
943 Ga0207684_10102322
944 Ga0207684_10116636
945 Ga0207684_10141904
946 Ga0207684_10377058
947 Ga0207684_11059664
948 Ga0207684_11303666
949 Ga0207654_10006301
950 Ga0207707_10000740
951 Ga0207707_10828336
952 Ga0207695_10474187
953 Ga0207671_10190022
954 Ga0207671_10438373
955 Ga0207693_10001156
956 Ga0207693_10031072
957 Ga0207693_10041162
958 Ga0207663_10000774
959 Ga0207663_10016938
960 Ga0207660_10002444
961 Ga0207660_10808026
962 Ga0207657_10000208
963 Ga0207649_10001664
964 Ga0207652_10000463
965 Ga0207652_10319633
966 Ga0207646_10003038
967 Ga0207646_10014253
968 Ga0207646_10200045
969 Ga0207646_10224157
970 Ga0207646_10537560
971 Ga0207681_10023291
972 Ga0207694_10297895
973 Ga0207650_10057744
974 Ga0207659_10076517
975 Ga0207700_10045351
976 Ga0207700_10123165
977 Ga0207664_10163561
978 Ga0207664_10667879
979 Ga0207690_10001254
980 Ga0207690_11662042
981 Ga0207706_10002799
982 Ga0207706_10096717
983 Ga0207709_10440137
984 Ga0207670_10291731
985 Ga0207704_10685288
986 Ga0207665_10001062
987 Ga0207665_11089641
988 Ga0207691_10015665
989 Ga0207711_10529695
990 Ga0207711_10703497
991 Ga0207711_11000631
992 Ga0207689_10002156
993 Ga0207679_10001910
994 Ga0207667_10002886
995 Ga0207651_11340963
996 Ga0207712_10533220
997 Ga0207712_10584820
998 Ga0207712_10789017
999 Ga0207640_10001541
1000 Ga0207703_10007987
1001 Ga0207703_10128285
1002 Ga0207703_12034389
1003 Ga0207639_10000992
1004 Ga0207678_10019023
1005 Ga0207708_10239894
1006 Ga0207702_10002921
1007 Ga0207641_10020661
1008 Ga0207641_10067294
1009 Ga0207641_10974116
1010 Ga0207648_10000170
1011 Ga0207648_11293790
1012 Ga0207676_10066074
1013 Ga0207674_10005047
1014 Ga0207675_100020617
1015 Ga0207698_11098936
1016 Ga0209969_1034930
1017 Ga0209981_1024740
1018 Ga0209996_1004741
1019 Ga0210000_1011547
1020 Ga0209995_1001389
1021 Ga0209968_1002820
1022 Ga0209999_1024318
1023 Ga0209982_1037829
1024 Ga0209983_1007709
1025 Ga0209588_1096698
1026 Ga0209971_1000017
1027 Ga0209966_1000023
1028 Ga0209998_10000092
1029 Ga0209998_10079224
1030 Ga0209974_10000268
1031 Ga0209974_10212666
1032 Ga0207428_10000368
1033 Ga0207428_10067305
1034 Ga0268265_10008666
1035 Ga0268265_10019934
1036 Ga0268265_10493119
1037 Ga0268264_10024445
1038 Ga0268264_10285189
1039 Ga0268264_10762739
1040 Ga0265334_10011674
1041 Ga0265318_10148396
1042 Ga0265323_10029373
1043 Ga0265338_10009756
1044 Ga0265338_10091672
1045 Ga0265338_10201895
1046 Ga0265338_10300459
1047 Ga0265338_10347444
1048 Ga0265324_10046954
1049 Ga0265330_10269344
1050 Ga0265340_10085133
1051 Ga0265340_10425032
1052 Ga0265339_10022296
1053 Ga0265331_10001317
1054 Ga0265331_10108411
1055 Ga0265316_10008917
1056 Ga0265316_10031479
1057 Ga0265316_10184794
1058 Ga0265316_10207475
1059 Ga0265316_10351199
1060 Ga0265313_10000475
1061 Ga0265314_10000050
1062 Ga0265314_10081581
1063 Ga0265314_10130482
1064 Ga0265314_10213925
1065 Ga0265342_10024877
1066 Ga0265342_10442830
1067 Ga0316576_10164127
1068 Ga0373948_0012575
1069 Ga0373948_0027659
1070 Ga0373959_0044783
1071 Ga0373929_0067195
1072 Ga0373949_0003374
1073 Ga0373951_0023061
1074 Ga0373941_0014356
1075 Ga0373941_0045680
1076 Ga0373953_0206214
1077 Ga0373954_0017913
1078 Ga0373956_0057997
1079 Ga0373956_0128672
1080 Ga0373956_0517660
1081 Ga0373955_1040441
1082 Ga0373942_0033496
1083 Ga0373961_0042790
1084 Ga0373962_0114954
1085 Ga0373931_0031015
1086 Ga0373931_0240324
1087 Ga0373931_0667220
1088 Ga0373935_0363474
1089 Ga0373935_0421091
1090 Ga0373933_0148991
1091 Ga0373933_0392375
1092 Ga0373933_0456529
1093 Ga0373937_0075417
1094 Ga0373937_0363308
1095 Ga0373937_1213464
1096 Ga0373937_1945682
1097 Ga0316582_1224527
1098 Ga0395899_0185977
1099 Ga0395899_0685653
1100 Ga0395900_0715673
1101 Ga0395900_0777987
1102 Ga0395905_0188879
1103 Ga0395901_0306943
1104 Ga0400484_32846
1105 Ga0400490_44207
1106 Ga0400488_56031
1107 Ga0400486_06582
1108 Ga0242420_102476
1109 Ga0436360_0209130
1110 Ga0436360_0238687
1111 Ga0436360_0902049
1112 Ga0436361_0561838
1113 Ga0436361_0778234
1114 Ga0436361_0879727
1115 Ga0436361_1051621
1116 Ga0436361_1154221
1117 Ga0436363_1474631
1118 Ga0436362_0081337
1119 Ga0439441_178273
1120 Ga0439448_0033234
1121 Ga0439448_0143766
1122 Ga0439455_0009944
1123 Ga0439463_029776
1124 Ga0439458_0009251
1125 Ga0439459_0001436
1126 Ga0439464_0038134
1127 Ga0439460_0067707
1128 Ga0451577_0003730
1129 Ga0451577_0097867
1130 Ga0451577_0230776
1131 Ga0451577_0438082
1132 Ga0451577_0474485
1133 Ga0451577_0994152
1134 Ga0451577_1198360
1135 Ga0453683_0115653
1136 Ga0453683_0167913
1137 Ga0453683_0746416
1138 Ga0453684_0007535
1139 Ga0453684_0173297
1140 Ga0453684_0319084
1141 Ga0451576_0017192
1142 Ga0451576_0017473
1143 Ga0451576_0017977
1144 Ga0451576_0040248
1145 Ga0451576_0096341
1146 Ga0451576_0312449
1147 Ga0466967_0015425
1148 Ga0495629_0000053
1149 Ga0495629_0098901
1150 Ga0495580_0091023
1151 Ga0495582_0045960
1152 Ga0495594_0008360
1153 Ga0495618_0017308
1154 Ga0495628_0359724
1155 Ga0495586_0000890
1156 Ga0495645_0153719
1157 Ga0495667_0952327
1158 Ga0495634_0001227
1159 Ga0495634_0054070
1160 Ga0495635_0002339
1161 Ga0495623_0172866
1162 Ga0495658_0000391
1163 Ga0495613_0006135
1164 Ga0495613_0055325
1165 Ga0495613_0182940
1166 Ga0495581_0000381
1167 Ga0495674_0384112
1168 Ga0495676_0155211
1169 Ga0495680_0006445
1170 Ga0495680_0040138
1171 Ga0495675_0372854
1172 Ga0495684_0379971
1173 Ga0495602_0790425
1174 Ga0495614_0019638
1175 Ga0496100_0034584
1176 Ga0496102_0040658
1177 Ga0496102_0243897
1178 Ga0496102_1291791
1179 Ga0496103_0679050
1180 Ga0496106_0982554
1181 Ga0496110_0164987
1182 Ga0496112_0942373
1183 Ga0501031_0265193
1184 Ga0501032_0869393
1185 Ga0501033_0009739
1186 Ga0501033_0090715
1187 Ga0501033_0565053
1188 Ga0501036_0002580
1189 Ga0501036_0136051
1190 Ga0501037_0071438
1191 Ga0501037_0401712
1192 Ga0501037_0508036
1193 Ga0501037_0718342
1194 Ga0501038_0000783
1195 Ga0501038_1083365
1196 Ga0501039_0034674
1197 Ga0501039_0040515
1198 Ga0501039_0688584
1199 Ga0501040_0000922
1200 Ga0501040_0002714
1201 Ga0501040_0031160
1202 Ga0501040_0136632
1203 Ga0501040_0173967
1204 Ga0501041_0000348
1205 Ga0501041_0018562
1206 Ga0501041_0534422
1207 Ga0501042_0000299
1208 Ga0501043_0266736
1209 Ga0501046_0000449
1210 Ga0501046_0000578
1211 Ga0501046_0062144
1212 Ga0501046_0725065
1213 Ga0501047_0092480
1214 Ga0501048_0000368
1215 Ga0501048_0046443
1216 Ga0501048_0160012
1217 Ga0501068_0029362
1218 Ga0501070_0545243
1219 Ga0501070_1500444
1220 Ga0501071_0000485
1221 Ga0501071_0367946
1222 Ga0501071_0922365
1223 Ga0501072_0002413
1224 Ga0501072_0059850
1225 Ga0501072_0061784
1226 Ga0501073_0113416
1227 Ga0501074_0002446
1228 Ga0501074_0121485
1229 Ga0501075_0000035
1230 Ga0501075_0060726
1231 Ga0501075_0123182
1232 Ga0501075_0163351
1233 Ga0501076_0000860
1234 Ga0501076_0038068
1235 Ga0501076_0340029
1236 Ga0501076_1486060
1237 Ga0501077_0000326
1238 Ga0501077_0037263
1239 Ga0501077_0411936
1240 Ga0501077_0534348
1241 Ga0501077_0837524
1242 Ga0501079_0000217
1243 Ga0501079_0061716
1244 Ga0501079_0076958
1245 Ga0501079_1595894
1246 Ga0501080_0005619
1247 Ga0501080_0046345
1248 Ga0501080_0638872
1249 Ga0501081_0000111
1250 Ga0501081_0002416
1251 Ga0501081_0111992
1252 Ga0501081_0161667
1253 Ga0501081_0225827
1254 Ga0501081_0471244
1255 Ga0501083_0002743
1256 Ga0501083_0013327
1257 Ga0501083_0506209
1258 Ga0501035_0005598
1259 Ga0501044_0543114
1260 Ga0501045_0001426
1261 Ga0501045_0105825
1262 nmdc:mga05p37_151675_c1
1263 nmdc:mga05p37_1671232_c1
1264 nmdc:mga05p37_211085_c1
1265 nmdc:mga05p37_221888_c1
1266 nmdc:mga05p37_228562_c1
1267 nmdc:mga05p37_326040_c1
1268 nmdc:mga05p37_70354_c1
1269 nmdc:mga09592_106566_c1
1270 nmdc:mga09592_598137_c1
1271 nmdc:mga09592_613316_c1
1272 nmdc:mga06r32_340533_c1
1273 nmdc:mga08y16_162082_c1
1274 nmdc:mga08y16_1841_c1
1275 nmdc:mga0n895_118028_c1
1276 nmdc:mga0n895_120538_c1
1277 nmdc:mga0n895_13385_c1
1278 nmdc:mga0n895_18087_c1
1279 nmdc:mga0n895_30654_c1
1280 nmdc:mga0n895_3980_c1
1281 nmdc:mga0n895_401714_c1
1282 nmdc:mga0n895_428576_c1
1283 nmdc:mga0n895_454573_c1
1284 nmdc:mga0n895_72806_c1
1285 nmdc:mga0rr50_100815_c1
1286 nmdc:mga0rr50_1131141_c1
1287 nmdc:mga0rr50_152299_c1
1288 nmdc:mga0rr50_187021_c1
1289 nmdc:mga0rr50_362221_c1
1290 nmdc:mga0rr50_434788_c1
1291 nmdc:mga0rr50_59932_c1
1292 nmdc:mga0rr50_75500_c1
1293 nmdc:mga0rr50_957605_c1
1294 nmdc:mga08x19_175143_c1
1295 nmdc:mga08x19_282994_c1
1296 nmdc:mga08x19_391764_c1
1297 nmdc:mga08x19_422357_c1
1298 nmdc:mga0a205_1114549_c1
1299 nmdc:mga0a205_16471_c1
1300 nmdc:mga0a205_1787_c1
1301 nmdc:mga0a205_1873_c2
1302 nmdc:mga0a205_191005_c1
1303 nmdc:mga0a205_1987_c1
1304 nmdc:mga0a205_261368_c1
1305 nmdc:mga0a205_61216_c1
1306 nmdc:mga0a205_689_c1
1307 nmdc:mga0a205_8468_c1
1308 Ga0495619_0000824
1309 Ga0501084_0000724
1310 Ga0501084_0084316
1311 Ga0501084_0334423
1312 Ga0501082_0001342
1313 Ga0501082_0004978
1314 Ga0501082_0068992
1315 Ga0501082_0706967
1316 Ga0530510_0000128
1317 Ga0530510_0299138
1318 2513722055
1319 2524441207
1320 2745078668
1321 2788436622
1322 2874128131
1323 2885316769
1324 2937845902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02641

DUF190

Uncharacterized ACR, COG1993

9

105

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dcl-assembly1.cif.gz_B-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.9537 11 112
1o51-assembly1.cif.gz_A crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution 0.9514 10 110
2dcl-assembly1.cif.gz_C-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.9317 10 109
1o51-assembly1.cif.gz_A crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution 0.9309 10 110
2dcl-assembly1.cif.gz_A-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.9213 5 113
ID Description Score Start End Superfamily
1o51A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9432 11 110 3.30.70.120
2dclC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9317 10 109 3.30.70.120
af_Q58919_1_108_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.923 10 113 3.30.70.120
1o51A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9223 11 110 3.30.70.120
af_P95087_118_229_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8982 10 113 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A101FFT7-F1-model_v4 Putative nitrgene regulatory protein PII/ATP phosphoribosyltransferase 0.9657 8 110 GO:0016757
AF-A0A2V8IKN4-F1-model_v4 Uncharacterized protein 0.9647 5 113
AF-A0A354DM12-F1-model_v4 Uncharacterized protein 0.96 11 111
AF-A0A0S2HVE7-F1-model_v4 Uncharacterized protein 0.9588 10 112
AF-A0A0J1F878-F1-model_v4 Uncharacterized protein 0.957 9 110

Map