F473485

General Info

Members Datasets Scaffolds Average Seq Length
662 339 662 127

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10000552|Ga0316576_1000055213
Length 132
Sequence MHDDGSSHAITDDIRVEVDSHFVPERSDPHVGRWFFAYRVRITNESVRTVQLLSRRWRIIDAHGQIEEVTGPGVVGEQPVLTPGESFEYASFCPLGTPFGTMEGSYQMVDDDGVKFEVTVARFTLSQPLEVN

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
151 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
161 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
162 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
163 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
175 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
176 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
180 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
193 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
194 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
199 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
202 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
212 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
217 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
220 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
221 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
222 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
223 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
224 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
225 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
226 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
227 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
228 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
229 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
246 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
247 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
248 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
253 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
254 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
255 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
258 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
291 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
294 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
313 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
318 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
319 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
330 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
331 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
332 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
333 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
334 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
335 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
336 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 1.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 5.74
Rhizosphere 84.74
Stem 0
Stem Tuber 0
Unclassified 8.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10068542 3300003316 Bacteria 1928
2 rootL2_10097826 3300003322 Bacteria 4895
3 rootH1_10007647 3300003323 Bacteria 55493
4 rootH1_10058373 3300003323 Bacteria 5984
5 Ga0065715_10274377 3300005293 Bacteria 1102
6 Ga0065715_10546729 3300005293 Bacteria 744
7 Ga0070683_100056107 3300005329 Bacteria 3658
8 Ga0070690_100021042 3300005330 Bacteria 3980
9 Ga0070670_100369788 3300005331 Bacteria 1262
10 Ga0068869_100651659 3300005334 Bacteria 894
11 Ga0068869_101533201 3300005334 Bacteria 592
12 Ga0070666_10000496 3300005335 Bacteria 23684
13 Ga0070666_10474594 3300005335 Bacteria 905
14 Ga0070666_10510933 3300005335 Bacteria 872
15 Ga0070680_100085388 3300005336 Bacteria 2608
16 Ga0070682_100017839 3300005337 Bacteria 4141
17 Ga0070682_100041944 3300005337 Bacteria 2823
18 Ga0068868_100013762 3300005338 Bacteria 5944
19 Ga0070661_100468504 3300005344 Bacteria 1004
20 Ga0070692_10565581 3300005345 Bacteria 747
21 Ga0070675_100069351 3300005354 Bacteria 2921
22 Ga0070671_100006552 3300005355 Bacteria 9309
23 Ga0070671_100009932 3300005355 Bacteria 7644
24 Ga0070671_100087408 3300005355 Bacteria 2609
25 Ga0070673_100079390 3300005364 Bacteria 2657
26 Ga0070667_100000008 3300005367 Bacteria 285591
27 Ga0070667_100006624 3300005367 Bacteria 9629
28 Ga0070667_100012080 3300005367 Bacteria 7149
29 Ga0070709_10054960 3300005434 Bacteria 2512
30 Ga0070709_10065831 3300005434 Bacteria 2322
31 Ga0070709_10899790 3300005434 Bacteria 700
32 Ga0070709_10899850 3300005434 Bacteria 700
33 Ga0070714_100001058 3300005435 Bacteria 19666
34 Ga0070714_100010004 3300005435 Bacteria 7481
35 Ga0070714_101188271 3300005435 Bacteria 744
36 Ga0070714_101327145 3300005435 Bacteria 702
37 Ga0070713_100008095 3300005436 Bacteria 7433
38 Ga0070713_100059740 3300005436 Bacteria 3185
39 Ga0070713_100295524 3300005436 Bacteria 1490
40 Ga0070710_10021966 3300005437 Bacteria 3332
41 Ga0070710_10644757 3300005437 Bacteria 742
42 Ga0070711_100002891 3300005439 Bacteria 9895
43 Ga0070711_100066663 3300005439 Bacteria 2523
44 Ga0070711_100433988 3300005439 Bacteria 1073
45 Ga0070663_100905617 3300005455 Bacteria 762
46 Ga0070678_100026325 3300005456 Bacteria 3930
47 Ga0070678_100071437 3300005456 Bacteria 2598
48 Ga0070662_100215378 3300005457 Bacteria 1530
49 Ga0070681_10172655 3300005458 Bacteria 2083
50 Ga0070685_10259888 3300005466 Bacteria 1154
51 Ga0070685_10681015 3300005466 Bacteria 748
52 Ga0070707_101909595 3300005468 Bacteria 561
53 Ga0070679_100026728 3300005530 Bacteria 5675
54 Ga0070684_100223202 3300005535 Bacteria 1719
55 Ga0068853_100715760 3300005539 Bacteria 955
56 Ga0070672_100283766 3300005543 Bacteria 1401
57 Ga0070686_100009034 3300005544 Bacteria 5590
58 Ga0070686_101254600 3300005544 Bacteria 617
59 Ga0070695_100489788 3300005545 Bacteria 949
60 Ga0070696_100029592 3300005546 Bacteria 3744
61 Ga0070696_100833338 3300005546 Bacteria 761
62 Ga0070693_100086897 3300005547 Bacteria 1877
63 Ga0070665_100000509 3300005548 Bacteria 55803
64 Ga0070665_100012054 3300005548 Bacteria 8721
65 Ga0070665_100016149 3300005548 Bacteria 7493
66 Ga0070665_100052877 3300005548 Bacteria 4073
67 Ga0070665_100559379 3300005548 Bacteria 1156
68 Ga0070665_100673819 3300005548 Bacteria 1047
69 Ga0070665_100825421 3300005548 Bacteria 940
70 Ga0070665_101789584 3300005548 Bacteria 621
71 Ga0070704_100056014 3300005549 Bacteria 2798
72 Ga0070704_100069596 3300005549 Bacteria 2550
73 Ga0068855_100009767 3300005563 Bacteria 11575
74 Ga0068855_100455056 3300005563 Bacteria 1396
75 Ga0068857_100093293 3300005577 Bacteria 2696
76 Ga0068857_101972854 3300005577 Bacteria 572
77 Ga0068854_100610584 3300005578 Bacteria 932
78 Ga0068856_100061084 3300005614 Bacteria 3722
79 Ga0068856_100153668 3300005614 Bacteria 2311
80 Ga0068856_100336918 3300005614 Bacteria 1526
81 Ga0068859_100045726 3300005617 Bacteria 4398
82 Ga0068859_100115509 3300005617 Bacteria 2749
83 Ga0068864_100357948 3300005618 Bacteria 1379
84 Ga0068864_101531421 3300005618 Bacteria 670
85 Ga0068866_10279753 3300005718 Bacteria 1033
86 Ga0068861_100216007 3300005719 Bacteria 1618
87 Ga0068851_10391698 3300005834 Bacteria 816
88 Ga0068870_10658442 3300005840 Bacteria 718
89 Ga0068863_100002484 3300005841 Bacteria 18330
90 Ga0068863_100006983 3300005841 Bacteria 11070
91 Ga0068863_100061192 3300005841 Bacteria 3559
92 Ga0068863_100115021 3300005841 Bacteria 2563
93 Ga0068858_100000598 3300005842 Bacteria 37671
94 Ga0068858_100002641 3300005842 Bacteria 18052
95 Ga0068858_100009281 3300005842 Bacteria 9393
96 Ga0068860_100000771 3300005843 Bacteria 36058
97 Ga0068860_100088174 3300005843 Bacteria 2953
98 Ga0068862_100007748 3300005844 Bacteria 8882
99 Ga0068862_101141804 3300005844 Bacteria 776
100 Ga0068862_102788672 3300005844 Bacteria 500
101 Ga0070717_10186734 3300006028 Bacteria 1809
102 Ga0070715_10000669 3300006163 Bacteria 9159
103 Ga0070716_100001421 3300006173 Bacteria 10639
104 Ga0070716_100002786 3300006173 Bacteria 8122
105 Ga0070716_100867530 3300006173 Unclassified 704
106 Ga0070712_100000683 3300006175 Bacteria 20066
107 Ga0070712_100085173 3300006175 Bacteria 2300
108 Ga0070712_100097881 3300006175 Bacteria 2163
109 Ga0097621_100009247 3300006237 Bacteria 7149
110 Ga0097621_100111692 3300006237 Bacteria 2310
111 Ga0097621_100136303 3300006237 Bacteria 2094
112 Ga0068871_100015422 3300006358 Bacteria 5719
113 Ga0068871_100029484 3300006358 Bacteria 4310
114 Ga0068871_100177815 3300006358 Bacteria 1827
115 Ga0075430_101069096 3300006846 Bacteria 665
116 Ga0068865_100009034 3300006881 Bacteria 6165
117 Ga0068865_100454400 3300006881 Bacteria 1060
118 Ga0097620_100045727 3300006931 Bacteria 4398
119 Ga0097620_100115501 3300006931 Bacteria 2749
120 Ga0075435_101133228 3300007076 Bacteria 684
121 Ga0099794_10178257 3300007265 Bacteria 1084
122 Ga0099795_10000053 3300007788 Bacteria 22441
123 Ga0099795_10028291 3300007788 Bacteria 1904
124 Ga0105250_10016067 3300009092 Bacteria 3054
125 Ga0105240_10008483 3300009093 Bacteria 14696
126 Ga0105240_10015651 3300009093 Bacteria 10301
127 Ga0105240_10038444 3300009093 Bacteria 6139
128 Ga0105240_10045312 3300009093 Bacteria 5580
129 Ga0105240_10073560 3300009093 Bacteria 4219
130 Ga0105240_10092604 3300009093 Bacteria 3690
131 Ga0105240_10459398 3300009093 Bacteria 1423
132 Ga0105240_10491127 3300009093 Bacteria 1367
133 Ga0105240_10981577 3300009093 Bacteria 904
134 Ga0105245_10005446 3300009098 Bacteria 11181
135 Ga0105247_10000091 3300009101 Bacteria 97097
136 Ga0105247_10008379 3300009101 Bacteria 6302
137 Ga0105247_10016824 3300009101 Bacteria 4384
138 Ga0105243_10333340 3300009148 Bacteria 1387
139 Ga0105241_10009602 3300009174 Bacteria 7113
140 Ga0105241_10467969 3300009174 Bacteria 1118
141 Ga0105242_10000422 3300009176 Bacteria 33749
142 Ga0105248_10008369 3300009177 Bacteria 11361
143 Ga0105248_10054897 3300009177 Bacteria 4468
144 Ga0105248_10287866 3300009177 Bacteria 1850
145 Ga0105248_10678430 3300009177 Bacteria 1163
146 Ga0105248_11905637 3300009177 Bacteria 675
147 Ga0105248_12041989 3300009177 Bacteria 651
148 Ga0105237_10013318 3300009545 Bacteria 8625
149 Ga0105237_10125028 3300009545 Bacteria 2566
150 Ga0105237_10161390 3300009545 Bacteria 2240
151 Ga0105237_10293186 3300009545 Bacteria 1629
152 Ga0105237_10561974 3300009545 Bacteria 1148
153 Ga0105237_10564881 3300009545 Bacteria 1144
154 Ga0105237_10818779 3300009545 Bacteria 938
155 Ga0105238_10115276 3300009551 Bacteria 2666
156 Ga0105238_10301421 3300009551 Bacteria 1586
157 Ga0105238_10395259 3300009551 Bacteria 1375
158 Ga0105238_10506396 3300009551 Bacteria 1209
159 Ga0105238_10600600 3300009551 Bacteria 1108
160 Ga0105238_11958410 3300009551 Bacteria 619
161 Ga0105249_10040291 3300009553 Bacteria 4242
162 Ga0105249_10078018 3300009553 Bacteria 3073
163 Ga0105249_10327642 3300009553 Bacteria 1544
164 Ga0099796_10000096 3300010159 Bacteria 14200
165 Ga0099796_10000234 3300010159 Bacteria 8666
166 Ga0099796_10000788 3300010159 Bacteria 5719
167 Ga0099796_10081714 3300010159 Bacteria 1186
168 Ga0105239_10008715 3300010375 Bacteria 11480
169 Ga0105239_10263262 3300010375 Bacteria 1938
170 Ga0105239_11034085 3300010375 Bacteria 945
171 Ga0105246_10623892 3300011119 Bacteria 935
172 Ga0105246_11194654 3300011119 Bacteria 700
173 Ga0157370_10474616 3300013104 Bacteria 1149
174 Ga0157369_10117693 3300013105 Bacteria 2821
175 Ga0157369_11435456 3300013105 Bacteria 702
176 Ga0157374_10001660 3300013296 Bacteria 18628
177 Ga0157374_11157299 3300013296 Bacteria 794
178 Ga0157374_12556355 3300013296 Bacteria 538
179 Ga0157378_10002030 3300013297 Bacteria 18126
180 Ga0163162_10009296 3300013306 Bacteria 9558
181 Ga0163162_10217056 3300013306 Bacteria 2043
182 Ga0163162_10290810 3300013306 Bacteria 1766
183 Ga0163162_12193624 3300013306 Bacteria 634
184 Ga0157372_10386511 3300013307 Bacteria 1630
185 Ga0157372_11172816 3300013307 Bacteria 888
186 Ga0157375_10037041 3300013308 Bacteria 4670
187 Ga0157375_11195254 3300013308 Bacteria 892
188 Ga0163163_10024106 3300014325 Bacteria 5789
189 Ga0163163_10026466 3300014325 Bacteria 5545
190 Ga0163163_10156437 3300014325 Bacteria 2324
191 Ga0163163_10529621 3300014325 Bacteria 1241
192 Ga0163163_10603908 3300014325 Bacteria 1160
193 Ga0163163_11025766 3300014325 Bacteria 888
194 Ga0163163_11494964 3300014325 Bacteria 737
195 Ga0157380_10248974 3300014326 Bacteria 1607
196 Ga0157380_10490984 3300014326 Bacteria 1190
197 Ga0157380_11260793 3300014326 Bacteria 785
198 Ga0157379_10010805 3300014968 Bacteria 7961
199 Ga0157379_10050000 3300014968 Bacteria 3731
200 Ga0157379_10105843 3300014968 Bacteria 2525
201 Ga0157379_10210143 3300014968 Bacteria 1761
202 Ga0157379_10456076 3300014968 Bacteria 1181
203 Ga0157379_10549876 3300014968 Bacteria 1074
204 Ga0157376_10072368 3300014969 Bacteria 2932
205 Ga0157376_10622690 3300014969 Bacteria 1077
206 Ga0157376_11143678 3300014969 Bacteria 805
207 Ga0157376_11393544 3300014969 Bacteria 732
208 Ga0213873_10006485 3300021358 Bacteria 2303
209 Ga0213872_10089217 3300021361 Bacteria 1381
210 Ga0213874_10004025 3300021377 Bacteria 3316
211 Ga0213874_10041085 3300021377 Bacteria 1383
212 Ga0213876_10119970 3300021384 Bacteria 1396
213 Ga0228598_1022414 3300024227 Bacteria 1242
214 Ga0228598_1040467 3300024227 Bacteria 919
215 Ga0207692_10106771 3300025898 Bacteria 1546
216 Ga0207692_10879259 3300025898 Bacteria 589
217 Ga0207692_11092995 3300025898 Bacteria 528
218 Ga0207710_10000241 3300025900 Bacteria 46419
219 Ga0207680_10062362 3300025903 Bacteria 2277
220 Ga0207680_10089478 3300025903 Bacteria 1954
221 Ga0207680_10113706 3300025903 Bacteria 1760
222 Ga0207647_10232343 3300025904 Bacteria 1061
223 Ga0207685_10003015 3300025905 Bacteria 3999
224 Ga0207699_10023052 3300025906 Bacteria 3383
225 Ga0207643_10619436 3300025908 Bacteria 697
226 Ga0207654_10123384 3300025911 Bacteria 1630
227 Ga0207654_10173594 3300025911 Bacteria 1402
228 Ga0207695_10031349 3300025913 Bacteria 5832
229 Ga0207695_10034473 3300025913 Bacteria 5504
230 Ga0207695_10036099 3300025913 Bacteria 5347
231 Ga0207695_10041050 3300025913 Bacteria 4953
232 Ga0207695_10056994 3300025913 Bacteria 4062
233 Ga0207695_10057161 3300025913 Bacteria 4055
234 Ga0207695_10151702 3300025913 Bacteria 2256
235 Ga0207695_10620050 3300025913 Bacteria 963
236 Ga0207671_10048805 3300025914 Bacteria 3133
237 Ga0207671_10049864 3300025914 Bacteria 3100
238 Ga0207671_10142780 3300025914 Bacteria 1846
239 Ga0207671_10153228 3300025914 Bacteria 1781
240 Ga0207671_10222867 3300025914 Bacteria 1478
241 Ga0207671_10398133 3300025914 Bacteria 1095
242 Ga0207693_10000226 3300025915 Bacteria 51496
243 Ga0207693_10067112 3300025915 Bacteria 2808
244 Ga0207693_10079827 3300025915 Bacteria 2561
245 Ga0207663_10018125 3300025916 Bacteria 3938
246 Ga0207663_10032699 3300025916 Bacteria 3091
247 Ga0207660_10072608 3300025917 Bacteria 2506
248 Ga0207657_11505194 3300025919 Bacteria 503
249 Ga0207649_10419336 3300025920 Bacteria 1005
250 Ga0207652_10147649 3300025921 Bacteria 2105
251 Ga0207681_11403294 3300025923 Bacteria 586
252 Ga0207694_10269179 3300025924 Bacteria 1397
253 Ga0207694_10349415 3300025924 Bacteria 1224
254 Ga0207694_10544415 3300025924 Bacteria 974
255 Ga0207694_11290486 3300025924 Bacteria 617
256 Ga0207650_10056637 3300025925 Bacteria 2913
257 Ga0207650_10546897 3300025925 Bacteria 970
258 Ga0207687_10052745 3300025927 Bacteria 2839
259 Ga0207700_10167822 3300025928 Bacteria 1828
260 Ga0207700_10537608 3300025928 Bacteria 1036
261 Ga0207664_10000874 3300025929 Bacteria 20374
262 Ga0207664_10015495 3300025929 Bacteria 5535
263 Ga0207664_10974918 3300025929 Bacteria 760
264 Ga0207644_10008547 3300025931 Bacteria 6698
265 Ga0207644_10020441 3300025931 Bacteria 4501
266 Ga0207644_10510840 3300025931 Bacteria 992
267 Ga0207706_10314391 3300025933 Bacteria 1364
268 Ga0207686_10059540 3300025934 Bacteria 2413
269 Ga0207709_10225783 3300025935 Bacteria 1353
270 Ga0207704_10036138 3300025938 Bacteria 2839
271 Ga0207704_10344661 3300025938 Bacteria 1158
272 Ga0207665_10002356 3300025939 Bacteria 12761
273 Ga0207665_10033438 3300025939 Bacteria 3408
274 Ga0207665_10751449 3300025939 Bacteria 769
275 Ga0207691_10503296 3300025940 Bacteria 1029
276 Ga0207711_10183538 3300025941 Bacteria 1903
277 Ga0207711_10455496 3300025941 Bacteria 1191
278 Ga0207711_10817891 3300025941 Bacteria 867
279 Ga0207689_10395332 3300025942 Bacteria 1152
280 Ga0207689_11037869 3300025942 Bacteria 691
281 Ga0207661_10204781 3300025944 Bacteria 1736
282 Ga0207679_11061650 3300025945 Bacteria 743
283 Ga0207667_10216074 3300025949 Bacteria 1965
284 Ga0207667_10978395 3300025949 Bacteria 834
285 Ga0207651_10043010 3300025960 Bacteria 3012
286 Ga0207651_10233363 3300025960 Bacteria 1495
287 Ga0207712_10051998 3300025961 Bacteria 2868
288 Ga0207712_10066477 3300025961 Bacteria 2577
289 Ga0207712_10343241 3300025961 Bacteria 1239
290 Ga0207640_10086854 3300025981 Bacteria 2155
291 Ga0207658_10000030 3300025986 Bacteria 168693
292 Ga0207658_10010121 3300025986 Bacteria 6405
293 Ga0207658_10360988 3300025986 Bacteria 1267
294 Ga0207658_11162855 3300025986 Bacteria 705
295 Ga0207677_10136030 3300026023 Bacteria 1874
296 Ga0207703_10000729 3300026035 Bacteria 32318
297 Ga0207703_10007683 3300026035 Bacteria 8545
298 Ga0207703_10040071 3300026035 Bacteria 3747
299 Ga0207703_10068599 3300026035 Bacteria 2922
300 Ga0207703_10153572 3300026035 Bacteria 2010
301 Ga0207703_10921714 3300026035 Bacteria 837
302 Ga0207678_10010212 3300026067 Bacteria 8242
303 Ga0207702_10022988 3300026078 Bacteria 5172
304 Ga0207702_10158952 3300026078 Bacteria 2062
305 Ga0207702_10161499 3300026078 Bacteria 2046
306 Ga0207641_10009315 3300026088 Bacteria 8101
307 Ga0207641_10107245 3300026088 Bacteria 2471
308 Ga0207648_10713900 3300026089 Bacteria 929
309 Ga0207676_10705310 3300026095 Bacteria 978
310 Ga0207674_10286362 3300026116 Bacteria 1596
311 Ga0207674_10532590 3300026116 Bacteria 1135
312 Ga0207675_100551123 3300026118 Bacteria 1152
313 Ga0207675_100818170 3300026118 Bacteria 945
314 Ga0207683_10001388 3300026121 Bacteria 21837
315 Ga0207683_10193010 3300026121 Bacteria 1849
316 Ga0207698_11005606 3300026142 Bacteria 845
317 Ga0207698_12721621 3300026142 Bacteria 503
318 Ga0209179_1000082 3300027512 Bacteria 15283
319 Ga0209179_1008935 3300027512 Bacteria 1703
320 Ga0209179_1028474 3300027512 Bacteria 1132
321 Ga0209588_1057613 3300027671 Bacteria 1256
322 Ga0209588_1156333 3300027671 Bacteria 721
323 Ga0268266_10000246 3300028379 Bacteria 91633
324 Ga0268266_10002398 3300028379 Bacteria 20201
325 Ga0268266_10020953 3300028379 Bacteria 5573
326 Ga0268266_10024656 3300028379 Bacteria 5118
327 Ga0268266_10096007 3300028379 Bacteria 2604
328 Ga0268266_11375179 3300028379 Unclassified 681
329 Ga0268266_11809325 3300028379 Bacteria 585
330 Ga0268266_12221136 3300028379 Bacteria 521
331 Ga0268265_10005087 3300028380 Bacteria 9016
332 Ga0268264_10000102 3300028381 Bacteria 222526
333 Ga0268264_10312907 3300028381 Bacteria 1482
334 Ga0268264_10352465 3300028381 Bacteria 1401
335 Ga0265326_10012329 3300028558 Bacteria 2515
336 Ga0265326_10030252 3300028558 Bacteria 1542
337 Ga0265319_1008703 3300028563 Bacteria 4413
338 Ga0265334_10000008 3300028573 Bacteria 200602
339 Ga0265334_10001247 3300028573 Bacteria 12415
340 Ga0265318_10000270 3300028577 Bacteria 44032
341 Ga0265338_10072217 3300028800 Bacteria 2947
342 Ga0265324_10073170 3300029957 Bacteria 1167
343 Ga0307511_10001554 3300030521 Bacteria 24331
344 Ga0307511_10009601 3300030521 Bacteria 9638
345 Ga0307511_10197524 3300030521 Bacteria 1051
346 Ga0265762_1024288 3300030760 Bacteria 1126
347 Ga0265762_1035755 3300030760 Bacteria 957
348 Ga0265762_1180486 3300030760 Bacteria 520
349 Ga0265763_1007554 3300030763 Bacteria 956
350 Ga0265760_10296819 3300031090 Unclassified 572
351 Ga0265760_10352984 3300031090 Bacteria 526
352 Ga0265330_10005661 3300031235 Bacteria 6213
353 Ga0265330_10389805 3300031235 Bacteria 589
354 Ga0265332_10002814 3300031238 Bacteria 8644
355 Ga0265328_10008403 3300031239 Bacteria 4259
356 Ga0265328_10097463 3300031239 Bacteria 1087
357 Ga0265328_10143577 3300031239 Bacteria 896
358 Ga0265320_10020396 3300031240 Bacteria 3595
359 Ga0265325_10005394 3300031241 Bacteria 7900
360 Ga0265325_10097684 3300031241 Bacteria 1441
361 Ga0265329_10026312 3300031242 Bacteria 1917
362 Ga0265340_10044851 3300031247 Bacteria 2162
363 Ga0265339_10014987 3300031249 Bacteria 4660
364 Ga0265331_10003147 3300031250 Bacteria 10771
365 Ga0265331_10012515 3300031250 Bacteria 4592
366 Ga0265316_10057269 3300031344 Bacteria 3039
367 Ga0307513_10025617 3300031456 Bacteria 6827
368 Ga0307513_10046215 3300031456 Bacteria 4750
369 Ga0307509_10000005 3300031507 Bacteria 435959
370 Ga0307509_10957217 3300031507 Unclassified 522
371 Ga0307408_100814932 3300031548 Bacteria 848
372 Ga0265313_10000076 3300031595 Bacteria 96542
373 Ga0265313_10000653 3300031595 Bacteria 35705
374 Ga0307514_10202814 3300031649 Bacteria 1244
375 Ga0316575_10006773 3300031665 Bacteria 4139
376 Ga0316575_10107083 3300031665 Bacteria 1139
377 Ga0316575_10149683 3300031665 Bacteria 963
378 Ga0316579_10068564 3300031691 Bacteria 1677
379 Ga0316579_10086156 3300031691 Bacteria 1499
380 Ga0265314_10013166 3300031711 Bacteria 6699
381 Ga0265342_10022958 3300031712 Bacteria 3957
382 Ga0265342_10051007 3300031712 Bacteria 2469
383 Ga0316576_10000552 3300031727 Bacteria 17595
384 Ga0316576_10003801 3300031727 Bacteria 8930
385 Ga0316576_10018182 3300031727 Bacteria 4792
386 Ga0316576_10045118 3300031727 Bacteria 3186
387 Ga0316578_10000053 3300031728 Bacteria 24064
388 Ga0316578_10060124 3300031728 Bacteria 2236
389 Ga0316578_10196595 3300031728 Bacteria 1214
390 Ga0307516_10000067 3300031730 Bacteria 111575
391 Ga0316577_10008728 3300031733 Bacteria 5433
392 Ga0316577_10038625 3300031733 Bacteria 2670
393 Ga0316577_10596612 3300031733 Bacteria 628
394 Ga0307413_10007351 3300031824 Bacteria 5109
395 Ga0307410_10026652 3300031852 Bacteria 3642
396 Ga0307410_10078830 3300031852 Bacteria 2306
397 Ga0307406_10145767 3300031901 Bacteria 1682
398 Ga0307407_10239307 3300031903 Bacteria 1237
399 Ga0307409_100278134 3300031995 Bacteria 1545
400 Ga0307416_100583715 3300032002 Bacteria 1195
401 Ga0307414_10186707 3300032004 Bacteria 1673
402 Ga0307411_10021443 3300032005 Bacteria 3781
403 Ga0307411_10103834 3300032005 Bacteria 2017
404 Ga0307415_100287594 3300032126 Bacteria 1355
405 Ga0316583_10003601 3300032133 Bacteria 5472
406 Ga0316583_10033063 3300032133 Bacteria 1838
407 Ga0316580_10001292 3300032139 Bacteria 6478
408 Ga0316580_10035903 3300032139 Bacteria 1534
409 Ga0307507_10301114 3300033179 Bacteria 983
410 Ga0307510_10000006 3300033180 Bacteria 566474
411 Ga0307510_10016283 3300033180 Bacteria 8778
412 Ga0307510_10136839 3300033180 Bacteria 2105
413 Ga0316592_1053336 3300033524 Bacteria 904
414 Ga0316596_1069078 3300033541 Bacteria 946
415 Ga0373944_0209135 3300035089 Bacteria 709
416 Ga0373923_0346475 3300035111 Bacteria 709
417 Ga0373936_0006275 3300035113 Bacteria 4484
418 Ga0373936_0024444 3300035113 Bacteria 2359
419 Ga0373953_0122611 3300035117 Bacteria 1105
420 Ga0373953_0223088 3300035117 Bacteria 817
421 Ga0373954_0144513 3300035118 Bacteria 1161
422 Ga0373954_0255660 3300035118 Bacteria 862
423 Ga0373956_0624983 3300035119 Bacteria 514
424 Ga0373943_0184512 3300035170 Bacteria 1148
425 Ga0373946_0050344 3300035171 Bacteria 1740
426 Ga0373955_0009589 3300035172 Bacteria 4543
427 Ga0316574_0004214 3300035398 Bacteria 7499
428 Ga0316574_0100816 3300035398 Bacteria 1848
429 Ga0316574_0280881 3300035398 Bacteria 1060
430 Ga0316574_0496866 3300035398 Bacteria 761
431 Ga0316574_0497290 3300035398 Bacteria 760
432 Ga0373927_0000001 3300035695 Bacteria 1082160
433 Ga0373927_0024652 3300035695 Bacteria 3931
434 Ga0373933_0024810 3300035724 Bacteria 3435
435 Ga0373933_0563253 3300035724 Bacteria 748
436 Ga0373937_0033162 3300036401 Bacteria 4688
437 Ga0373937_0100177 3300036401 Bacteria 2688
438 Ga0373937_0606769 3300036401 Bacteria 1039
439 Ga0373937_1249198 3300036401 Bacteria 691
440 Ga0373937_1581660 3300036401 Bacteria 603
441 Ga0316582_0041787 3300036647 Bacteria 2868
442 Ga0316582_0441116 3300036647 Bacteria 897
443 Ga0316582_0993999 3300036647 Bacteria 573
444 Ga0316584_0007920 3300036712 Bacteria 7291
445 Ga0316584_0119501 3300036712 Bacteria 1970
446 Ga0316584_0123095 3300036712 Bacteria 1937
447 Ga0316584_0397858 3300036712 Bacteria 982
448 Ga0316584_0705824 3300036712 Bacteria 691
449 Ga0316584_1102681 3300036712 Bacteria 527
450 Ga0373925_0017486 3300037068 Bacteria 5198
451 Ga0373925_0352726 3300037068 Bacteria 1195
452 Ga0316581_0039519 3300037588 Bacteria 1436
453 Ga0436364_0938232 3300037853 Bacteria 3043
454 Ga0436364_1079144 3300037853 Bacteria 575
455 Ga0400491_16032 3300038727 Bacteria 1674
456 Ga0400483_074789 3300039062 Bacteria 1145
457 Ga0400483_229164 3300039062 Bacteria 5245
458 Ga0436365_0344571 3300039437 Bacteria 1194
459 Ga0436365_0919918 3300039437 Bacteria 6141
460 Ga0436365_1734234 3300039437 Bacteria 2745
461 Ga0436365_1803492 3300039437 Bacteria 1170
462 Ga0436360_1015686 3300039438 Bacteria 10514
463 Ga0436360_1292859 3300039438 Bacteria 2226
464 Ga0436361_0120662 3300039447 Bacteria 588
465 Ga0436361_0159837 3300039447 Bacteria 808
466 Ga0436361_0537095 3300039447 Bacteria 2680
467 Ga0436361_1027302 3300039447 Bacteria 2845
468 Ga0436361_1066456 3300039447 Bacteria 1157
469 Ga0436363_0082299 3300039450 Bacteria 1129
470 Ga0436363_0122034 3300039450 Bacteria 1257
471 Ga0436363_0397597 3300039450 Bacteria 771
472 Ga0436363_0502379 3300039450 Bacteria 2115
473 Ga0436363_0581112 3300039450 Bacteria 6599
474 Ga0436363_0658005 3300039450 Bacteria 1969
475 Ga0436363_1395368 3300039450 Bacteria 8364
476 Ga0436362_0056993 3300039453 Bacteria 784
477 Ga0436362_0580586 3300039453 Bacteria 3569
478 Ga0436362_1153707 3300039453 Bacteria 741
479 Ga0439461_0208873 3300041410 Bacteria 528
480 Ga0451807_0242516 3300041486 Bacteria 694
481 Ga0451807_1950251 3300041486 Bacteria 1012
482 Ga0451837_1278518 3300041494 Bacteria 1685
483 Ga0451839_1122753 3300041496 Bacteria 663
484 Ga0451577_0044972 3300042876 Bacteria 3951
485 Ga0451577_0687840 3300042876 Bacteria 927
486 Ga0466969_0045492 3300044656 Bacteria 2179
487 Ga0453683_0115177 3300044673 Bacteria 1691
488 Ga0453684_0302454 3300044712 Bacteria 1817
489 Ga0453684_0363767 3300044712 Bacteria 1628
490 Ga0453684_2277349 3300044712 Bacteria 539
491 Ga0466970_0710502 3300044765 Unclassified 586
492 Ga0466959_0118566 3300045049 Bacteria 1883
493 Ga0466959_0419556 3300045049 Bacteria 908
494 Ga0451576_0027268 3300045051 Bacteria 6136
495 Ga0451576_0046467 3300045051 Bacteria 4571
496 Ga0451576_1437657 3300045051 Bacteria 717
497 Ga0466958_1083395 3300045836 Unclassified 523
498 Ga0495592_0692973 3300046454 Bacteria 613
499 Ga0495629_0306552 3300046459 Bacteria 1087
500 Ga0495638_0035712 3300046460 Bacteria 3167
501 Ga0495651_0292860 3300046462 Bacteria 1095
502 Ga0495580_0008063 3300046472 Bacteria 8404
503 Ga0495580_0018491 3300046472 Bacteria 5189
504 Ga0495580_0699807 3300046472 Bacteria 663
505 Ga0495582_0599047 3300046473 Bacteria 638
506 Ga0495639_0243221 3300046475 Bacteria 888
507 Ga0495662_0103530 3300046476 Bacteria 1393
508 Ga0495606_0122533 3300046507 Bacteria 1554
509 Ga0495608_0379504 3300046511 Bacteria 867
510 Ga0495608_0787034 3300046511 Bacteria 562
511 Ga0495616_0257846 3300046513 Bacteria 747
512 Ga0495620_0179583 3300046515 Bacteria 819
513 Ga0495628_0070403 3300046516 Bacteria 2727
514 Ga0495630_0359276 3300046517 Unclassified 1115
515 Ga0495632_0066473 3300046519 Bacteria 1740
516 Ga0495648_0322295 3300046524 Bacteria 716
517 Ga0495665_0048657 3300046531 Bacteria 2248
518 Ga0495640_0528408 3300046533 Bacteria 716
519 Ga0495586_0025330 3300046535 Bacteria 3174
520 Ga0495587_0011965 3300046536 Bacteria 5485
521 Ga0495587_0191151 3300046536 Bacteria 1159
522 Ga0495609_0060384 3300046538 Bacteria 1676
523 Ga0495645_0305479 3300046543 Bacteria 1038
524 Ga0495668_0210018 3300046616 Unclassified 1066
525 Ga0495634_0264579 3300046642 Bacteria 1048
526 Ga0495625_0009758 3300046660 Bacteria 7989
527 Ga0495625_0427819 3300046660 Bacteria 822
528 Ga0495657_0568867 3300046675 Bacteria 657
529 Ga0495646_0582992 3300046680 Bacteria 569
530 Ga0495658_0106897 3300046683 Bacteria 1678
531 Ga0495669_0179142 3300046684 Bacteria 1010
532 Ga0495671_0565932 3300046692 Bacteria 541
533 Ga0495604_0267750 3300047317 Bacteria 1159
534 Ga0495674_0058164 3300047319 Bacteria 3381
535 Ga0495687_107510 3300047443 Bacteria 1033
536 Ga0495687_179240 3300047443 Bacteria 693
537 Ga0495675_0301952 3300047444 Bacteria 951
538 Ga0495681_0128683 3300047470 Bacteria 1080
539 Ga0495684_0498758 3300047471 Bacteria 837
540 Ga0495686_0319465 3300047472 Bacteria 851
541 Ga0496100_0098204 3300048903 Bacteria 2012
542 Ga0496100_0281525 3300048903 Bacteria 1240
543 Ga0496101_0042578 3300048904 Bacteria 3241
544 Ga0496101_0276487 3300048904 Bacteria 1312
545 Ga0496101_0281931 3300048904 Bacteria 1299
546 Ga0496102_0025626 3300048905 Bacteria 5253
547 Ga0496102_0059027 3300048905 Bacteria 3507
548 Ga0496102_0094373 3300048905 Bacteria 2772
549 Ga0496102_0115092 3300048905 Bacteria 2509
550 Ga0496102_0620808 3300048905 Bacteria 1004
551 Ga0496103_0031670 3300048906 Bacteria 3224
552 Ga0496103_0095347 3300048906 Bacteria 1880
553 Ga0496104_0096551 3300048907 Bacteria 2827
554 Ga0496104_0191881 3300048907 Bacteria 1955
555 Ga0496105_0002839 3300048908 Bacteria 12678
556 Ga0496105_0022709 3300048908 Bacteria 5083
557 Ga0496106_0016627 3300048909 Bacteria 5443
558 Ga0496107_0011507 3300048910 Bacteria 6163
559 Ga0496107_0241397 3300048910 Bacteria 1344
560 Ga0496108_0032625 3300048911 Bacteria 4326
561 Ga0496108_0209555 3300048911 Bacteria 1692
562 Ga0496109_0073684 3300048912 Bacteria 3137
563 Ga0496109_0495713 3300048912 Bacteria 1153
564 Ga0496109_0766177 3300048912 Bacteria 903
565 Ga0496110_0011389 3300048913 Bacteria 7277
566 Ga0496111_0705589 3300048914 Bacteria 734
567 Ga0496112_0066822 3300048915 Bacteria 3548
568 Ga0496112_0083617 3300048915 Bacteria 3157
569 Ga0496112_0163655 3300048915 Bacteria 2191
570 Ga0496112_0613009 3300048915 Bacteria 1020
571 Ga0496114_0003309 3300048917 Bacteria 12378
572 Ga0496114_0296529 3300048917 Bacteria 1427
573 Ga0496114_0545324 3300048917 Bacteria 1025
574 Ga0496115_0004612 3300048918 Bacteria 9979
575 Ga0496115_0019223 3300048918 Bacteria 5255
576 Ga0496115_0534042 3300048918 Bacteria 939
577 Ga0496116_0003851 3300048919 Bacteria 14645
578 Ga0496117_0000229 3300048920 Bacteria 105861
579 Ga0496118_0000016 3300048921 Bacteria 549586
580 Ga0496118_0007348 3300048921 Bacteria 11715
581 Ga0496119_0006549 3300048922 Bacteria 10742
582 Ga0496119_0010886 3300048922 Bacteria 7601
583 Ga0496120_0000839 3300048923 Bacteria 43743
584 Ga0496120_0023961 3300048923 Bacteria 3812
585 Ga0496121_0007867 3300048924 Bacteria 12750
586 Ga0496121_0070321 3300048924 Bacteria 2820
587 Ga0496124_0017163 3300048927 Bacteria 6839
588 Ga0496124_0534111 3300048927 Bacteria 778
589 Ga0496125_0000353 3300048928 Bacteria 86674
590 Ga0496125_0020465 3300048928 Bacteria 6210
591 Ga0496126_0002458 3300048929 Bacteria 24978
592 Ga0496126_0047696 3300048929 Bacteria 3921
593 Ga0496126_0255807 3300048929 Bacteria 1458
594 Ga0495682_0364352 3300049460 Bacteria 509
595 Ga0501032_0650307 3300049569 Bacteria 669
596 Ga0501033_0195330 3300049570 Bacteria 1447
597 Ga0501033_0671763 3300049570 Bacteria 706
598 Ga0501036_0003616 3300049572 Bacteria 12361
599 Ga0501036_0048011 3300049572 Bacteria 3615
600 Ga0501037_0352710 3300049573 Bacteria 1015
601 Ga0501037_0385669 3300049573 Bacteria 962
602 Ga0501038_0002930 3300049574 Bacteria 15918
603 Ga0501038_0976909 3300049574 Bacteria 622
604 Ga0501039_0032408 3300049575 Bacteria 4029
605 Ga0501040_0005143 3300049576 Bacteria 8461
606 Ga0501040_0127859 3300049576 Bacteria 1785
607 Ga0501041_0001297 3300049577 Bacteria 13757
608 Ga0501041_0144725 3300049577 Bacteria 1483
609 Ga0501042_0000439 3300049578 Bacteria 21222
610 Ga0501042_0191473 3300049578 Bacteria 1475
611 Ga0501042_0194922 3300049578 Bacteria 1461
612 Ga0501042_0198644 3300049578 Bacteria 1446
613 Ga0501043_0114979 3300049579 Bacteria 2112
614 Ga0501046_0034962 3300049580 Bacteria 4051
615 Ga0501046_0063947 3300049580 Bacteria 2873
616 Ga0501047_0180441 3300049581 Bacteria 1978
617 Ga0501048_0003706 3300049582 Bacteria 11642
618 Ga0501048_0455787 3300049582 Bacteria 916
619 Ga0501068_0021610 3300049584 Bacteria 3759
620 Ga0501068_0833571 3300049584 Bacteria 605
621 Ga0501070_0895749 3300049586 Bacteria 692
622 Ga0501071_0001933 3300049587 Bacteria 12343
623 Ga0501071_1301684 3300049587 Bacteria 561
624 Ga0501072_0001847 3300049588 Bacteria 15766
625 Ga0501072_0376478 3300049588 Bacteria 1126
626 Ga0501075_0014371 3300049591 Bacteria 5671
627 Ga0501076_0035786 3300049592 Bacteria 3885
628 Ga0501076_0094154 3300049592 Bacteria 2412
629 Ga0501076_0104895 3300049592 Bacteria 2281
630 Ga0501076_0257786 3300049592 Bacteria 1427
631 Ga0501077_0005786 3300049593 Bacteria 7531
632 Ga0501230_033332 3300049667 Bacteria 970
633 Ga0501235_041491 3300049669 Bacteria 1053
634 Ga0501236_052909 3300049670 Bacteria 702
635 Ga0501079_0115180 3300049741 Bacteria 2089
636 Ga0501079_0830511 3300049741 Bacteria 728
637 Ga0501080_0558138 3300049742 Bacteria 1019
638 Ga0501080_0641415 3300049742 Bacteria 940
639 Ga0501081_0008365 3300049743 Bacteria 6714
640 Ga0501035_0009197 3300049822 Bacteria 9187
641 Ga0501044_1120227 3300049823 Bacteria 656
642 Ga0501045_0002981 3300049824 Bacteria 11579
643 Ga0501045_0021552 3300049824 Bacteria 4610
644 Ga0501045_0610145 3300049824 Bacteria 808
645 nmdc:mga0qj67_798761_c1 3300050509 Bacteria 747
646 nmdc:mga0rr50_1435996_c1 3300050513 Bacteria 584
647 nmdc:mga08x19_227697_c1 3300050514 Bacteria 1282
648 Ga0495601_0491163 3300053077 Bacteria 793
649 Ga0495601_0692188 3300053077 Bacteria 651
650 Ga0500583_0143337 3300053092 Bacteria 1188
651 Ga0500556_0000435 3300053104 Bacteria 29836
652 Ga0500595_085442 3300053119 Bacteria 919
653 Ga0500559_0105731 3300053136 Bacteria 1301
654 Ga0500639_093651 3300053163 Bacteria 1492
655 Ga0500636_0293846 3300053177 Bacteria 804
656 Ga0500637_0027480 3300053178 Bacteria 3142
657 Ga0500637_0228468 3300053178 Bacteria 1049
658 Ga0501084_0156561 3300054114 Bacteria 1921
659 Ga0501082_0003701 3300060353 Bacteria 13355
660 Ga0501082_0996662 3300060353 Bacteria 733
661 Ga0530510_0016026 3300061734 Bacteria 5297
662 Ga0530510_0024869 3300061734 Bacteria 4279

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10007647 rootH1_1000764742 122
2 3300037588 Ga0316581_0039519 Ga0316581_0039519_915_1286 122
3 3300049667 Ga0501230_033332 Ga0501230_033332_218_586 122
4 3300049669 Ga0501235_041491 Ga0501235_041491_387_755 122
5 3300035113 Ga0373936_0024444 Ga0373936_0024444_834_1244 123
6 3300035398 Ga0316574_0100816 Ga0316574_0100816_1355_1726 123
7 3300005435 Ga0070714_100001058 Ga0070714_10000105812 125
8 3300007788 Ga0099795_10000053 Ga0099795_1000005323 125
9 3300010159 Ga0099796_10000096 Ga0099796_100000969 125
10 3300013306 Ga0163162_12193624 Ga0163162_121936241 125
11 3300025906 Ga0207699_10023052 Ga0207699_100230522 125
12 3300025916 Ga0207663_10032699 Ga0207663_100326994 125
13 3300025929 Ga0207664_10000874 Ga0207664_1000087413 125
14 3300027512 Ga0209179_1000082 Ga0209179_100008210 125
15 3300028558 Ga0265326_10012329 Ga0265326_100123293 125
16 3300028573 Ga0265334_10000008 Ga0265334_10000008169 125
17 3300031241 Ga0265325_10097684 Ga0265325_100976842 125
18 3300031507 Ga0307509_10957217 Ga0307509_109572172 125
19 3300031595 Ga0265313_10000076 Ga0265313_1000007630 125
20 3300033180 Ga0307510_10136839 Ga0307510_101368392 125
21 3300035724 Ga0373933_0563253 Ga0373933_0563253_278_655 125
22 3300036401 Ga0373937_1249198 Ga0373937_1249198_108_485 125
23 3300039447 Ga0436361_0120662 Ga0436361_0120662_173_550 125
24 3300048904 Ga0496101_0281931 Ga0496101_0281931_237_614 125
25 3300048908 Ga0496105_0002839 Ga0496105_0002839_5073_5450 125
26 3300048910 Ga0496107_0241397 Ga0496107_0241397_361_738 125
27 3300048918 Ga0496115_0019223 Ga0496115_0019223_507_884 125
28 3300003316 rootH1_10068542 rootH1_100685422 126
29 3300003322 rootL2_10097826 rootL2_100978265 126
30 3300003323 rootH1_10058373 rootH1_100583735 126
31 3300005293 Ga0065715_10274377 Ga0065715_102743771 126
32 3300005293 Ga0065715_10546729 Ga0065715_105467292 126
33 3300005329 Ga0070683_100056107 Ga0070683_1000561073 126
34 3300005330 Ga0070690_100021042 Ga0070690_1000210424 126
35 3300005331 Ga0070670_100369788 Ga0070670_1003697882 126
36 3300005334 Ga0068869_100651659 Ga0068869_1006516592 126
37 3300005334 Ga0068869_101533201 Ga0068869_1015332012 126
38 3300005335 Ga0070666_10000496 Ga0070666_1000049620 126
39 3300005335 Ga0070666_10474594 Ga0070666_104745942 126
40 3300005335 Ga0070666_10510933 Ga0070666_105109332 126
41 3300005336 Ga0070680_100085388 Ga0070680_1000853883 126
42 3300005337 Ga0070682_100017839 Ga0070682_1000178393 126
43 3300005337 Ga0070682_100041944 Ga0070682_1000419443 126
44 3300005338 Ga0068868_100013762 Ga0068868_1000137627 126
45 3300005344 Ga0070661_100468504 Ga0070661_1004685041 126
46 3300005345 Ga0070692_10565581 Ga0070692_105655812 126
47 3300005354 Ga0070675_100069351 Ga0070675_1000693513 126
48 3300005355 Ga0070671_100006552 Ga0070671_1000065524 126
49 3300005355 Ga0070671_100009932 Ga0070671_1000099322 126
50 3300005355 Ga0070671_100087408 Ga0070671_1000874082 126
51 3300005364 Ga0070673_100079390 Ga0070673_1000793903 126
52 3300005367 Ga0070667_100000008 Ga0070667_10000000870 126
53 3300005367 Ga0070667_100006624 Ga0070667_1000066247 126
54 3300005367 Ga0070667_100012080 Ga0070667_1000120804 126
55 3300005434 Ga0070709_10054960 Ga0070709_100549604 126
56 3300005434 Ga0070709_10065831 Ga0070709_100658314 126
57 3300005434 Ga0070709_10899790 Ga0070709_108997901 126
58 3300005434 Ga0070709_10899850 Ga0070709_108998502 126
59 3300005435 Ga0070714_100010004 Ga0070714_1000100046 126
60 3300005435 Ga0070714_101188271 Ga0070714_1011882711 126
61 3300005435 Ga0070714_101327145 Ga0070714_1013271451 126
62 3300005436 Ga0070713_100008095 Ga0070713_1000080954 126
63 3300005436 Ga0070713_100059740 Ga0070713_1000597405 126
64 3300005436 Ga0070713_100295524 Ga0070713_1002955241 126
65 3300005437 Ga0070710_10021966 Ga0070710_100219663 126
66 3300005437 Ga0070710_10644757 Ga0070710_106447572 126
67 3300005439 Ga0070711_100002891 Ga0070711_1000028917 126
68 3300005439 Ga0070711_100066663 Ga0070711_1000666632 126
69 3300005439 Ga0070711_100433988 Ga0070711_1004339882 126
70 3300005455 Ga0070663_100905617 Ga0070663_1009056172 126
71 3300005456 Ga0070678_100026325 Ga0070678_1000263253 126
72 3300005456 Ga0070678_100071437 Ga0070678_1000714373 126
73 3300005457 Ga0070662_100215378 Ga0070662_1002153783 126
74 3300005458 Ga0070681_10172655 Ga0070681_101726553 126
75 3300005466 Ga0070685_10259888 Ga0070685_102598882 126
76 3300005466 Ga0070685_10681015 Ga0070685_106810152 126
77 3300005468 Ga0070707_101909595 Ga0070707_1019095952 126
78 3300005530 Ga0070679_100026728 Ga0070679_1000267286 126
79 3300005535 Ga0070684_100223202 Ga0070684_1002232022 126
80 3300005539 Ga0068853_100715760 Ga0068853_1007157602 126
81 3300005543 Ga0070672_100283766 Ga0070672_1002837662 126
82 3300005544 Ga0070686_100009034 Ga0070686_1000090344 126
83 3300005544 Ga0070686_101254600 Ga0070686_1012546002 126
84 3300005545 Ga0070695_100489788 Ga0070695_1004897882 126
85 3300005546 Ga0070696_100029592 Ga0070696_1000295923 126
86 3300005546 Ga0070696_100833338 Ga0070696_1008333382 126
87 3300005547 Ga0070693_100086897 Ga0070693_1000868972 126
88 3300005548 Ga0070665_100000509 Ga0070665_10000050930 126
89 3300005548 Ga0070665_100012054 Ga0070665_1000120549 126
90 3300005548 Ga0070665_100016149 Ga0070665_1000161492 126
91 3300005548 Ga0070665_100052877 Ga0070665_1000528773 126
92 3300005548 Ga0070665_100559379 Ga0070665_1005593792 126
93 3300005548 Ga0070665_100673819 Ga0070665_1006738192 126
94 3300005548 Ga0070665_100825421 Ga0070665_1008254211 126
95 3300005548 Ga0070665_101789584 Ga0070665_1017895841 126
96 3300005549 Ga0070704_100056014 Ga0070704_1000560145 126
97 3300005549 Ga0070704_100069596 Ga0070704_1000695962 126
98 3300005563 Ga0068855_100009767 Ga0068855_1000097677 126
99 3300005563 Ga0068855_100455056 Ga0068855_1004550563 126
100 3300005577 Ga0068857_100093293 Ga0068857_1000932932 126
101 3300005577 Ga0068857_101972854 Ga0068857_1019728541 126
102 3300005578 Ga0068854_100610584 Ga0068854_1006105842 126
103 3300005614 Ga0068856_100061084 Ga0068856_1000610845 126
104 3300005614 Ga0068856_100153668 Ga0068856_1001536682 126
105 3300005614 Ga0068856_100336918 Ga0068856_1003369183 126
106 3300005617 Ga0068859_100045726 Ga0068859_1000457264 126
107 3300005617 Ga0068859_100115509 Ga0068859_1001155094 126
108 3300005618 Ga0068864_100357948 Ga0068864_1003579482 126
109 3300005618 Ga0068864_101531421 Ga0068864_1015314212 126
110 3300005718 Ga0068866_10279753 Ga0068866_102797531 126
111 3300005719 Ga0068861_100216007 Ga0068861_1002160073 126
112 3300005834 Ga0068851_10391698 Ga0068851_103916982 126
113 3300005840 Ga0068870_10658442 Ga0068870_106584422 126
114 3300005841 Ga0068863_100002484 Ga0068863_1000024849 126
115 3300005841 Ga0068863_100006983 Ga0068863_1000069837 126
116 3300005841 Ga0068863_100061192 Ga0068863_1000611922 126
117 3300005841 Ga0068863_100115021 Ga0068863_1001150213 126
118 3300005842 Ga0068858_100000598 Ga0068858_10000059825 126
119 3300005842 Ga0068858_100002641 Ga0068858_10000264111 126
120 3300005842 Ga0068858_100009281 Ga0068858_1000092816 126
121 3300005843 Ga0068860_100000771 Ga0068860_10000077124 126
122 3300005843 Ga0068860_100088174 Ga0068860_1000881744 126
123 3300005844 Ga0068862_100007748 Ga0068862_1000077485 126
124 3300005844 Ga0068862_101141804 Ga0068862_1011418042 126
125 3300005844 Ga0068862_102788672 Ga0068862_1027886722 126
126 3300006028 Ga0070717_10186734 Ga0070717_101867342 126
127 3300006163 Ga0070715_10000669 Ga0070715_100006697 126
128 3300006173 Ga0070716_100001421 Ga0070716_1000014213 126
129 3300006173 Ga0070716_100002786 Ga0070716_1000027869 126
130 3300006173 Ga0070716_100867530 Ga0070716_1008675302 126
131 3300006175 Ga0070712_100000683 Ga0070712_10000068310 126
132 3300006175 Ga0070712_100085173 Ga0070712_1000851732 126
133 3300006175 Ga0070712_100097881 Ga0070712_1000978813 126
134 3300006237 Ga0097621_100009247 Ga0097621_1000092476 126
135 3300006237 Ga0097621_100111692 Ga0097621_1001116922 126
136 3300006237 Ga0097621_100136303 Ga0097621_1001363031 126
137 3300006358 Ga0068871_100015422 Ga0068871_1000154227 126
138 3300006358 Ga0068871_100029484 Ga0068871_1000294843 126
139 3300006358 Ga0068871_100177815 Ga0068871_1001778152 126
140 3300006846 Ga0075430_101069096 Ga0075430_1010690961 126
141 3300006881 Ga0068865_100009034 Ga0068865_1000090347 126
142 3300006881 Ga0068865_100454400 Ga0068865_1004544002 126
143 3300006931 Ga0097620_100045727 Ga0097620_1000457274 126
144 3300006931 Ga0097620_100115501 Ga0097620_1001155014 126
145 3300007076 Ga0075435_101133228 Ga0075435_1011332282 126
146 3300007265 Ga0099794_10178257 Ga0099794_101782572 126
147 3300007788 Ga0099795_10028291 Ga0099795_100282912 126
148 3300009092 Ga0105250_10016067 Ga0105250_100160672 126
149 3300009093 Ga0105240_10008483 Ga0105240_1000848310 126
150 3300009093 Ga0105240_10015651 Ga0105240_100156514 126
151 3300009093 Ga0105240_10038444 Ga0105240_100384446 126
152 3300009093 Ga0105240_10045312 Ga0105240_100453126 126
153 3300009093 Ga0105240_10073560 Ga0105240_100735605 126
154 3300009093 Ga0105240_10092604 Ga0105240_100926041 126
155 3300009093 Ga0105240_10459398 Ga0105240_104593983 126
156 3300009093 Ga0105240_10491127 Ga0105240_104911272 126
157 3300009093 Ga0105240_10981577 Ga0105240_109815772 126
158 3300009098 Ga0105245_10005446 Ga0105245_100054467 126
159 3300009101 Ga0105247_10000091 Ga0105247_100000918 126
160 3300009101 Ga0105247_10008379 Ga0105247_100083794 126
161 3300009101 Ga0105247_10016824 Ga0105247_100168246 126
162 3300009148 Ga0105243_10333340 Ga0105243_103333402 126
163 3300009174 Ga0105241_10009602 Ga0105241_100096027 126
164 3300009174 Ga0105241_10467969 Ga0105241_104679693 126
165 3300009176 Ga0105242_10000422 Ga0105242_1000042211 126
166 3300009177 Ga0105248_10008369 Ga0105248_100083693 126
167 3300009177 Ga0105248_10054897 Ga0105248_100548973 126
168 3300009177 Ga0105248_10287866 Ga0105248_102878662 126
169 3300009177 Ga0105248_10678430 Ga0105248_106784302 126
170 3300009177 Ga0105248_11905637 Ga0105248_119056372 126
171 3300009177 Ga0105248_12041989 Ga0105248_120419892 126
172 3300009545 Ga0105237_10013318 Ga0105237_100133182 126
173 3300009545 Ga0105237_10125028 Ga0105237_101250283 126
174 3300009545 Ga0105237_10161390 Ga0105237_101613902 126
175 3300009545 Ga0105237_10293186 Ga0105237_102931862 126
176 3300009545 Ga0105237_10561974 Ga0105237_105619742 126
177 3300009545 Ga0105237_10564881 Ga0105237_105648812 126
178 3300009545 Ga0105237_10818779 Ga0105237_108187792 126
179 3300009551 Ga0105238_10115276 Ga0105238_101152762 126
180 3300009551 Ga0105238_10301421 Ga0105238_103014212 126
181 3300009551 Ga0105238_10395259 Ga0105238_103952593 126
182 3300009551 Ga0105238_10506396 Ga0105238_105063961 126
183 3300009551 Ga0105238_10600600 Ga0105238_106006002 126
184 3300009551 Ga0105238_11958410 Ga0105238_119584102 126
185 3300009553 Ga0105249_10040291 Ga0105249_100402916 126
186 3300009553 Ga0105249_10078018 Ga0105249_100780182 126
187 3300009553 Ga0105249_10327642 Ga0105249_103276423 126
188 3300010159 Ga0099796_10000234 Ga0099796_100002342 126
189 3300010159 Ga0099796_10000788 Ga0099796_100007885 126
190 3300010159 Ga0099796_10081714 Ga0099796_100817142 126
191 3300010375 Ga0105239_10008715 Ga0105239_100087159 126
192 3300010375 Ga0105239_10263262 Ga0105239_102632623 126
193 3300010375 Ga0105239_11034085 Ga0105239_110340851 126
194 3300011119 Ga0105246_10623892 Ga0105246_106238922 126
195 3300011119 Ga0105246_11194654 Ga0105246_111946542 126
196 3300013104 Ga0157370_10474616 Ga0157370_104746162 126
197 3300013105 Ga0157369_10117693 Ga0157369_101176934 126
198 3300013105 Ga0157369_11435456 Ga0157369_114354561 126
199 3300013296 Ga0157374_10001660 Ga0157374_1000166013 126
200 3300013296 Ga0157374_11157299 Ga0157374_111572992 126
201 3300013296 Ga0157374_12556355 Ga0157374_125563551 126
202 3300013297 Ga0157378_10002030 Ga0157378_1000203011 126
203 3300013306 Ga0163162_10009296 Ga0163162_100092965 126
204 3300013306 Ga0163162_10217056 Ga0163162_102170563 126
205 3300013306 Ga0163162_10290810 Ga0163162_102908103 126
206 3300013307 Ga0157372_10386511 Ga0157372_103865113 126
207 3300013307 Ga0157372_11172816 Ga0157372_111728161 126
208 3300013308 Ga0157375_10037041 Ga0157375_100370412 126
209 3300013308 Ga0157375_11195254 Ga0157375_111952541 126
210 3300014325 Ga0163163_10024106 Ga0163163_100241064 126
211 3300014325 Ga0163163_10026466 Ga0163163_100264666 126
212 3300014325 Ga0163163_10156437 Ga0163163_101564372 126
213 3300014325 Ga0163163_10529621 Ga0163163_105296212 126
214 3300014325 Ga0163163_10603908 Ga0163163_106039082 126
215 3300014325 Ga0163163_11025766 Ga0163163_110257662 126
216 3300014325 Ga0163163_11494964 Ga0163163_114949642 126
217 3300014326 Ga0157380_10248974 Ga0157380_102489743 126
218 3300014326 Ga0157380_10490984 Ga0157380_104909842 126
219 3300014326 Ga0157380_11260793 Ga0157380_112607932 126
220 3300014968 Ga0157379_10010805 Ga0157379_100108058 126
221 3300014968 Ga0157379_10050000 Ga0157379_100500002 126
222 3300014968 Ga0157379_10105843 Ga0157379_101058432 126
223 3300014968 Ga0157379_10210143 Ga0157379_102101433 126
224 3300014968 Ga0157379_10456076 Ga0157379_104560761 126
225 3300014968 Ga0157379_10549876 Ga0157379_105498762 126
226 3300014969 Ga0157376_10072368 Ga0157376_100723685 126
227 3300014969 Ga0157376_10622690 Ga0157376_106226902 126
228 3300014969 Ga0157376_11143678 Ga0157376_111436782 126
229 3300014969 Ga0157376_11393544 Ga0157376_113935442 126
230 3300021358 Ga0213873_10006485 Ga0213873_100064853 126
231 3300021361 Ga0213872_10089217 Ga0213872_100892172 126
232 3300021377 Ga0213874_10004025 Ga0213874_100040255 126
233 3300021377 Ga0213874_10041085 Ga0213874_100410853 126
234 3300021384 Ga0213876_10119970 Ga0213876_101199702 126
235 3300024227 Ga0228598_1022414 Ga0228598_10224142 126
236 3300024227 Ga0228598_1040467 Ga0228598_10404672 126
237 3300025898 Ga0207692_10106771 Ga0207692_101067712 126
238 3300025898 Ga0207692_10879259 Ga0207692_108792592 126
239 3300025898 Ga0207692_11092995 Ga0207692_110929951 126
240 3300025900 Ga0207710_10000241 Ga0207710_1000024134 126
241 3300025903 Ga0207680_10062362 Ga0207680_100623622 126
242 3300025903 Ga0207680_10089478 Ga0207680_100894782 126
243 3300025903 Ga0207680_10113706 Ga0207680_101137062 126
244 3300025904 Ga0207647_10232343 Ga0207647_102323432 126
245 3300025905 Ga0207685_10003015 Ga0207685_100030152 126
246 3300025908 Ga0207643_10619436 Ga0207643_106194362 126
247 3300025911 Ga0207654_10123384 Ga0207654_101233843 126
248 3300025911 Ga0207654_10173594 Ga0207654_101735941 126
249 3300025913 Ga0207695_10031349 Ga0207695_100313494 126
250 3300025913 Ga0207695_10034473 Ga0207695_100344736 126
251 3300025913 Ga0207695_10036099 Ga0207695_100360991 126
252 3300025913 Ga0207695_10041050 Ga0207695_100410501 126
253 3300025913 Ga0207695_10056994 Ga0207695_100569945 126
254 3300025913 Ga0207695_10057161 Ga0207695_100571615 126
255 3300025913 Ga0207695_10151702 Ga0207695_101517021 126
256 3300025913 Ga0207695_10620050 Ga0207695_106200502 126
257 3300025914 Ga0207671_10048805 Ga0207671_100488052 126
258 3300025914 Ga0207671_10049864 Ga0207671_100498643 126
259 3300025914 Ga0207671_10142780 Ga0207671_101427803 126
260 3300025914 Ga0207671_10153228 Ga0207671_101532282 126
261 3300025914 Ga0207671_10222867 Ga0207671_102228673 126
262 3300025914 Ga0207671_10398133 Ga0207671_103981332 126
263 3300025915 Ga0207693_10000226 Ga0207693_1000022636 126
264 3300025915 Ga0207693_10067112 Ga0207693_100671123 126
265 3300025915 Ga0207693_10079827 Ga0207693_100798272 126
266 3300025916 Ga0207663_10018125 Ga0207663_100181253 126
267 3300025917 Ga0207660_10072608 Ga0207660_100726083 126
268 3300025919 Ga0207657_11505194 Ga0207657_115051941 126
269 3300025920 Ga0207649_10419336 Ga0207649_104193361 126
270 3300025921 Ga0207652_10147649 Ga0207652_101476493 126
271 3300025923 Ga0207681_11403294 Ga0207681_114032942 126
272 3300025924 Ga0207694_10269179 Ga0207694_102691793 126
273 3300025924 Ga0207694_10349415 Ga0207694_103494151 126
274 3300025924 Ga0207694_10544415 Ga0207694_105444152 126
275 3300025924 Ga0207694_11290486 Ga0207694_112904862 126
276 3300025925 Ga0207650_10056637 Ga0207650_100566373 126
277 3300025925 Ga0207650_10546897 Ga0207650_105468972 126
278 3300025927 Ga0207687_10052745 Ga0207687_100527454 126
279 3300025928 Ga0207700_10167822 Ga0207700_101678222 126
280 3300025928 Ga0207700_10537608 Ga0207700_105376083 126
281 3300025929 Ga0207664_10015495 Ga0207664_100154952 126
282 3300025929 Ga0207664_10974918 Ga0207664_109749182 126
283 3300025931 Ga0207644_10008547 Ga0207644_100085474 126
284 3300025931 Ga0207644_10020441 Ga0207644_100204416 126
285 3300025931 Ga0207644_10510840 Ga0207644_105108402 126
286 3300025933 Ga0207706_10314391 Ga0207706_103143912 126
287 3300025934 Ga0207686_10059540 Ga0207686_100595402 126
288 3300025935 Ga0207709_10225783 Ga0207709_102257832 126
289 3300025938 Ga0207704_10036138 Ga0207704_100361382 126
290 3300025938 Ga0207704_10344661 Ga0207704_103446612 126
291 3300025939 Ga0207665_10002356 Ga0207665_100023564 126
292 3300025939 Ga0207665_10033438 Ga0207665_100334383 126
293 3300025939 Ga0207665_10751449 Ga0207665_107514492 126
294 3300025940 Ga0207691_10503296 Ga0207691_105032962 126
295 3300025941 Ga0207711_10183538 Ga0207711_101835383 126
296 3300025941 Ga0207711_10455496 Ga0207711_104554962 126
297 3300025941 Ga0207711_10817891 Ga0207711_108178911 126
298 3300025942 Ga0207689_10395332 Ga0207689_103953322 126
299 3300025942 Ga0207689_11037869 Ga0207689_110378692 126
300 3300025944 Ga0207661_10204781 Ga0207661_102047812 126
301 3300025945 Ga0207679_11061650 Ga0207679_110616502 126
302 3300025949 Ga0207667_10216074 Ga0207667_102160743 126
303 3300025949 Ga0207667_10978395 Ga0207667_109783951 126
304 3300025960 Ga0207651_10043010 Ga0207651_100430102 126
305 3300025960 Ga0207651_10233363 Ga0207651_102333632 126
306 3300025961 Ga0207712_10051998 Ga0207712_100519982 126
307 3300025961 Ga0207712_10066477 Ga0207712_100664774 126
308 3300025961 Ga0207712_10343241 Ga0207712_103432412 126
309 3300025981 Ga0207640_10086854 Ga0207640_100868542 126
310 3300025986 Ga0207658_10000030 Ga0207658_1000003098 126
311 3300025986 Ga0207658_10010121 Ga0207658_100101214 126
312 3300025986 Ga0207658_10360988 Ga0207658_103609882 126
313 3300025986 Ga0207658_11162855 Ga0207658_111628552 126
314 3300026023 Ga0207677_10136030 Ga0207677_101360303 126
315 3300026035 Ga0207703_10000729 Ga0207703_1000072914 126
316 3300026035 Ga0207703_10007683 Ga0207703_100076832 126
317 3300026035 Ga0207703_10040071 Ga0207703_100400715 126
318 3300026035 Ga0207703_10068599 Ga0207703_100685993 126
319 3300026035 Ga0207703_10153572 Ga0207703_101535723 126
320 3300026035 Ga0207703_10921714 Ga0207703_109217142 126
321 3300026067 Ga0207678_10010212 Ga0207678_100102129 126
322 3300026078 Ga0207702_10022988 Ga0207702_100229883 126
323 3300026078 Ga0207702_10158952 Ga0207702_101589522 126
324 3300026078 Ga0207702_10161499 Ga0207702_101614993 126
325 3300026088 Ga0207641_10009315 Ga0207641_100093156 126
326 3300026088 Ga0207641_10107245 Ga0207641_101072453 126
327 3300026089 Ga0207648_10713900 Ga0207648_107139002 126
328 3300026095 Ga0207676_10705310 Ga0207676_107053101 126
329 3300026116 Ga0207674_10286362 Ga0207674_102863622 126
330 3300026116 Ga0207674_10532590 Ga0207674_105325902 126
331 3300026118 Ga0207675_100551123 Ga0207675_1005511231 126
332 3300026118 Ga0207675_100818170 Ga0207675_1008181702 126
333 3300026121 Ga0207683_10001388 Ga0207683_1000138816 126
334 3300026121 Ga0207683_10193010 Ga0207683_101930101 126
335 3300026142 Ga0207698_11005606 Ga0207698_110056061 126
336 3300026142 Ga0207698_12721621 Ga0207698_127216211 126
337 3300027512 Ga0209179_1008935 Ga0209179_10089353 126
338 3300027512 Ga0209179_1028474 Ga0209179_10284743 126
339 3300027671 Ga0209588_1057613 Ga0209588_10576131 126
340 3300027671 Ga0209588_1156333 Ga0209588_11563332 126
341 3300028379 Ga0268266_10000246 Ga0268266_1000024683 126
342 3300028379 Ga0268266_10002398 Ga0268266_1000239812 126
343 3300028379 Ga0268266_10020953 Ga0268266_100209537 126
344 3300028379 Ga0268266_10024656 Ga0268266_100246567 126
345 3300028379 Ga0268266_10096007 Ga0268266_100960073 126
346 3300028379 Ga0268266_11375179 Ga0268266_113751791 126
347 3300028379 Ga0268266_11809325 Ga0268266_118093251 126
348 3300028379 Ga0268266_12221136 Ga0268266_122211361 126
349 3300028380 Ga0268265_10005087 Ga0268265_100050876 126
350 3300028381 Ga0268264_10000102 Ga0268264_10000102158 126
351 3300028381 Ga0268264_10312907 Ga0268264_103129072 126
352 3300028381 Ga0268264_10352465 Ga0268264_103524652 126
353 3300028558 Ga0265326_10030252 Ga0265326_100302522 126
354 3300028563 Ga0265319_1008703 Ga0265319_10087033 126
355 3300028573 Ga0265334_10001247 Ga0265334_100012477 126
356 3300028577 Ga0265318_10000270 Ga0265318_1000027049 126
357 3300028800 Ga0265338_10072217 Ga0265338_100722173 126
358 3300029957 Ga0265324_10073170 Ga0265324_100731701 126
359 3300030521 Ga0307511_10001554 Ga0307511_100015547 126
360 3300030521 Ga0307511_10009601 Ga0307511_100096019 126
361 3300030521 Ga0307511_10197524 Ga0307511_101975242 126
362 3300030760 Ga0265762_1024288 Ga0265762_10242882 126
363 3300030760 Ga0265762_1035755 Ga0265762_10357552 126
364 3300030760 Ga0265762_1180486 Ga0265762_11804862 126
365 3300030763 Ga0265763_1007554 Ga0265763_10075542 126
366 3300031090 Ga0265760_10296819 Ga0265760_102968192 126
367 3300031090 Ga0265760_10352984 Ga0265760_103529842 126
368 3300031235 Ga0265330_10005661 Ga0265330_100056613 126
369 3300031235 Ga0265330_10389805 Ga0265330_103898052 126
370 3300031238 Ga0265332_10002814 Ga0265332_100028145 126
371 3300031239 Ga0265328_10008403 Ga0265328_100084035 126
372 3300031239 Ga0265328_10097463 Ga0265328_100974632 126
373 3300031239 Ga0265328_10143577 Ga0265328_101435772 126
374 3300031240 Ga0265320_10020396 Ga0265320_100203964 126
375 3300031241 Ga0265325_10005394 Ga0265325_100053946 126
376 3300031242 Ga0265329_10026312 Ga0265329_100263122 126
377 3300031247 Ga0265340_10044851 Ga0265340_100448512 126
378 3300031249 Ga0265339_10014987 Ga0265339_100149875 126
379 3300031250 Ga0265331_10003147 Ga0265331_100031476 126
380 3300031250 Ga0265331_10012515 Ga0265331_100125154 126
381 3300031344 Ga0265316_10057269 Ga0265316_100572693 126
382 3300031456 Ga0307513_10025617 Ga0307513_100256175 126
383 3300031456 Ga0307513_10046215 Ga0307513_100462153 126
384 3300031507 Ga0307509_10000005 Ga0307509_10000005284 126
385 3300031548 Ga0307408_100814932 Ga0307408_1008149321 126
386 3300031595 Ga0265313_10000653 Ga0265313_1000065325 126
387 3300031649 Ga0307514_10202814 Ga0307514_102028142 126
388 3300031665 Ga0316575_10006773 Ga0316575_100067734 126
389 3300031665 Ga0316575_10107083 Ga0316575_101070832 126
390 3300031665 Ga0316575_10149683 Ga0316575_101496832 126
391 3300031691 Ga0316579_10068564 Ga0316579_100685643 126
392 3300031691 Ga0316579_10086156 Ga0316579_100861563 126
393 3300031711 Ga0265314_10013166 Ga0265314_100131663 126
394 3300031712 Ga0265342_10022958 Ga0265342_100229585 126
395 3300031712 Ga0265342_10051007 Ga0265342_100510073 126
396 3300031727 Ga0316576_10000552 Ga0316576_1000055213 126
397 3300031727 Ga0316576_10003801 Ga0316576_100038013 126
398 3300031727 Ga0316576_10018182 Ga0316576_100181823 126
399 3300031727 Ga0316576_10045118 Ga0316576_100451184 126
400 3300031728 Ga0316578_10000053 Ga0316578_1000005312 126
401 3300031728 Ga0316578_10060124 Ga0316578_100601243 126
402 3300031728 Ga0316578_10196595 Ga0316578_101965952 126
403 3300031730 Ga0307516_10000067 Ga0307516_1000006712 126
404 3300031733 Ga0316577_10008728 Ga0316577_100087285 126
405 3300031733 Ga0316577_10038625 Ga0316577_100386254 126
406 3300031733 Ga0316577_10596612 Ga0316577_105966121 126
407 3300031824 Ga0307413_10007351 Ga0307413_100073514 126
408 3300031852 Ga0307410_10026652 Ga0307410_100266525 126
409 3300031852 Ga0307410_10078830 Ga0307410_100788302 126
410 3300031901 Ga0307406_10145767 Ga0307406_101457672 126
411 3300031903 Ga0307407_10239307 Ga0307407_102393072 126
412 3300031995 Ga0307409_100278134 Ga0307409_1002781342 126
413 3300032002 Ga0307416_100583715 Ga0307416_1005837152 126
414 3300032004 Ga0307414_10186707 Ga0307414_101867072 126
415 3300032005 Ga0307411_10021443 Ga0307411_100214433 126
416 3300032005 Ga0307411_10103834 Ga0307411_101038342 126
417 3300032126 Ga0307415_100287594 Ga0307415_1002875942 126
418 3300032133 Ga0316583_10003601 Ga0316583_100036016 126
419 3300032133 Ga0316583_10033063 Ga0316583_100330631 126
420 3300032139 Ga0316580_10001292 Ga0316580_100012926 126
421 3300032139 Ga0316580_10035903 Ga0316580_100359032 126
422 3300033179 Ga0307507_10301114 Ga0307507_103011142 126
423 3300033180 Ga0307510_10000006 Ga0307510_10000006485 126
424 3300033180 Ga0307510_10016283 Ga0307510_100162835 126
425 3300033524 Ga0316592_1053336 Ga0316592_10533362 126
426 3300033541 Ga0316596_1069078 Ga0316596_10690782 126
427 3300035089 Ga0373944_0209135 Ga0373944_0209135_121_501 126
428 3300035111 Ga0373923_0346475 Ga0373923_0346475_50_430 126
429 3300035113 Ga0373936_0006275 Ga0373936_0006275_2192_2572 126
430 3300035117 Ga0373953_0122611 Ga0373953_0122611_346_726 126
431 3300035117 Ga0373953_0223088 Ga0373953_0223088_319_699 126
432 3300035118 Ga0373954_0144513 Ga0373954_0144513_18_404 126
433 3300035118 Ga0373954_0255660 Ga0373954_0255660_33_413 126
434 3300035119 Ga0373956_0624983 Ga0373956_0624983_20_400 126
435 3300035170 Ga0373943_0184512 Ga0373943_0184512_469_849 126
436 3300035171 Ga0373946_0050344 Ga0373946_0050344_603_983 126
437 3300035172 Ga0373955_0009589 Ga0373955_0009589_932_1312 126
438 3300035398 Ga0316574_0004214 Ga0316574_0004214_1287_1670 126
439 3300035398 Ga0316574_0280881 Ga0316574_0280881_405_785 126
440 3300035398 Ga0316574_0496866 Ga0316574_0496866_186_566 126
441 3300035398 Ga0316574_0497290 Ga0316574_0497290_241_624 126
442 3300035695 Ga0373927_0000001 Ga0373927_0000001_985742_986128 126
443 3300035695 Ga0373927_0024652 Ga0373927_0024652_1310_1690 126
444 3300035724 Ga0373933_0024810 Ga0373933_0024810_86_472 126
445 3300036401 Ga0373937_0033162 Ga0373937_0033162_3253_3633 126
446 3300036401 Ga0373937_0100177 Ga0373937_0100177_392_772 126
447 3300036401 Ga0373937_0606769 Ga0373937_0606769_127_507 126
448 3300036401 Ga0373937_1581660 Ga0373937_1581660_190_570 126
449 3300036647 Ga0316582_0041787 Ga0316582_0041787_1772_2155 126
450 3300036647 Ga0316582_0441116 Ga0316582_0441116_257_640 126
451 3300036647 Ga0316582_0993999 Ga0316582_0993999_126_506 126
452 3300036712 Ga0316584_0007920 Ga0316584_0007920_2522_2905 126
453 3300036712 Ga0316584_0119501 Ga0316584_0119501_1262_1645 126
454 3300036712 Ga0316584_0123095 Ga0316584_0123095_961_1341 126
455 3300036712 Ga0316584_0397858 Ga0316584_0397858_118_501 126
456 3300036712 Ga0316584_0705824 Ga0316584_0705824_106_486 126
457 3300036712 Ga0316584_1102681 Ga0316584_1102681_22_405 126
458 3300037068 Ga0373925_0017486 Ga0373925_0017486_3480_3860 126
459 3300037068 Ga0373925_0352726 Ga0373925_0352726_217_645 126
460 3300037853 Ga0436364_0938232 Ga0436364_0938232_852_1232 126
461 3300037853 Ga0436364_1079144 Ga0436364_1079144_140_520 126
462 3300038727 Ga0400491_16032 Ga0400491_16032_805_1188 126
463 3300039062 Ga0400483_074789 Ga0400483_074789_389_772 126
464 3300039062 Ga0400483_229164 Ga0400483_229164_132_515 126
465 3300039437 Ga0436365_0344571 Ga0436365_0344571_444_824 126
466 3300039437 Ga0436365_0919918 Ga0436365_0919918_1517_1897 126
467 3300039437 Ga0436365_1734234 Ga0436365_1734234_1437_1826 126
468 3300039437 Ga0436365_1803492 Ga0436365_1803492_63_491 126
469 3300039438 Ga0436360_1015686 Ga0436360_1015686_5420_5800 126
470 3300039438 Ga0436360_1292859 Ga0436360_1292859_1218_1598 126
471 3300039447 Ga0436361_0159837 Ga0436361_0159837_76_456 126
472 3300039447 Ga0436361_0537095 Ga0436361_0537095_40_420 126
473 3300039447 Ga0436361_1027302 Ga0436361_1027302_790_1170 126
474 3300039447 Ga0436361_1066456 Ga0436361_1066456_276_704 126
475 3300039450 Ga0436363_0082299 Ga0436363_0082299_120_503 126
476 3300039450 Ga0436363_0122034 Ga0436363_0122034_423_803 126
477 3300039450 Ga0436363_0397597 Ga0436363_0397597_343_726 126
478 3300039450 Ga0436363_0502379 Ga0436363_0502379_1306_1686 126
479 3300039450 Ga0436363_0581112 Ga0436363_0581112_1935_2315 126
480 3300039450 Ga0436363_0658005 Ga0436363_0658005_145_534 126
481 3300039450 Ga0436363_1395368 Ga0436363_1395368_5103_5483 126
482 3300039453 Ga0436362_0056993 Ga0436362_0056993_235_615 126
483 3300039453 Ga0436362_0580586 Ga0436362_0580586_514_894 126
484 3300039453 Ga0436362_1153707 Ga0436362_1153707_116_496 126
485 3300041410 Ga0439461_0208873 Ga0439461_0208873_32_412 126
486 3300041486 Ga0451807_0242516 Ga0451807_0242516_157_537 126
487 3300041486 Ga0451807_1950251 Ga0451807_1950251_425_805 126
488 3300041494 Ga0451837_1278518 Ga0451837_1278518_577_957 126
489 3300041496 Ga0451839_1122753 Ga0451839_1122753_23_403 126
490 3300042876 Ga0451577_0044972 Ga0451577_0044972_348_731 126
491 3300042876 Ga0451577_0687840 Ga0451577_0687840_460_843 126
492 3300044656 Ga0466969_0045492 Ga0466969_0045492_1076_1456 126
493 3300044673 Ga0453683_0115177 Ga0453683_0115177_873_1256 126
494 3300044712 Ga0453684_0302454 Ga0453684_0302454_1023_1406 126
495 3300044712 Ga0453684_0363767 Ga0453684_0363767_526_927 126
496 3300044712 Ga0453684_2277349 Ga0453684_2277349_145_528 126
497 3300044765 Ga0466970_0710502 Ga0466970_0710502_179_559 126
498 3300045049 Ga0466959_0118566 Ga0466959_0118566_901_1281 126
499 3300045049 Ga0466959_0419556 Ga0466959_0419556_229_609 126
500 3300045051 Ga0451576_0027268 Ga0451576_0027268_1350_1751 126
501 3300045051 Ga0451576_0046467 Ga0451576_0046467_1590_1973 126
502 3300045051 Ga0451576_1437657 Ga0451576_1437657_100_483 126
503 3300045836 Ga0466958_1083395 Ga0466958_1083395_130_510 126
504 3300046454 Ga0495592_0692973 Ga0495592_0692973_145_525 126
505 3300046459 Ga0495629_0306552 Ga0495629_0306552_84_464 126
506 3300046460 Ga0495638_0035712 Ga0495638_0035712_206_586 126
507 3300046462 Ga0495651_0292860 Ga0495651_0292860_670_1050 126
508 3300046472 Ga0495580_0008063 Ga0495580_0008063_2363_2743 126
509 3300046472 Ga0495580_0018491 Ga0495580_0018491_3613_3993 126
510 3300046472 Ga0495580_0699807 Ga0495580_0699807_10_390 126
511 3300046473 Ga0495582_0599047 Ga0495582_0599047_19_399 126
512 3300046475 Ga0495639_0243221 Ga0495639_0243221_26_406 126
513 3300046476 Ga0495662_0103530 Ga0495662_0103530_289_669 126
514 3300046507 Ga0495606_0122533 Ga0495606_0122533_695_1075 126
515 3300046511 Ga0495608_0379504 Ga0495608_0379504_121_501 126
516 3300046511 Ga0495608_0787034 Ga0495608_0787034_118_498 126
517 3300046513 Ga0495616_0257846 Ga0495616_0257846_210_590 126
518 3300046515 Ga0495620_0179583 Ga0495620_0179583_160_549 126
519 3300046516 Ga0495628_0070403 Ga0495628_0070403_1657_2037 126
520 3300046517 Ga0495630_0359276 Ga0495630_0359276_43_426 126
521 3300046519 Ga0495632_0066473 Ga0495632_0066473_997_1377 126
522 3300046524 Ga0495648_0322295 Ga0495648_0322295_114_494 126
523 3300046531 Ga0495665_0048657 Ga0495665_0048657_734_1114 126
524 3300046533 Ga0495640_0528408 Ga0495640_0528408_303_683 126
525 3300046535 Ga0495586_0025330 Ga0495586_0025330_1264_1647 126
526 3300046536 Ga0495587_0011965 Ga0495587_0011965_1327_1707 126
527 3300046536 Ga0495587_0191151 Ga0495587_0191151_364_744 126
528 3300046538 Ga0495609_0060384 Ga0495609_0060384_326_706 126
529 3300046543 Ga0495645_0305479 Ga0495645_0305479_134_514 126
530 3300046616 Ga0495668_0210018 Ga0495668_0210018_510_890 126
531 3300046642 Ga0495634_0264579 Ga0495634_0264579_165_545 126
532 3300046660 Ga0495625_0009758 Ga0495625_0009758_5931_6311 126
533 3300046660 Ga0495625_0427819 Ga0495625_0427819_328_708 126
534 3300046675 Ga0495657_0568867 Ga0495657_0568867_247_627 126
535 3300046680 Ga0495646_0582992 Ga0495646_0582992_118_498 126
536 3300046683 Ga0495658_0106897 Ga0495658_0106897_80_463 126
537 3300046684 Ga0495669_0179142 Ga0495669_0179142_280_669 126
538 3300046692 Ga0495671_0565932 Ga0495671_0565932_75_470 126
539 3300047317 Ga0495604_0267750 Ga0495604_0267750_286_666 126
540 3300047319 Ga0495674_0058164 Ga0495674_0058164_2738_3118 126
541 3300047443 Ga0495687_107510 Ga0495687_107510_160_540 126
542 3300047443 Ga0495687_179240 Ga0495687_179240_247_627 126
543 3300047444 Ga0495675_0301952 Ga0495675_0301952_305_685 126
544 3300047470 Ga0495681_0128683 Ga0495681_0128683_365_754 126
545 3300047471 Ga0495684_0498758 Ga0495684_0498758_319_699 126
546 3300047472 Ga0495686_0319465 Ga0495686_0319465_340_747 126
547 3300048903 Ga0496100_0098204 Ga0496100_0098204_1580_1960 126
548 3300048903 Ga0496100_0281525 Ga0496100_0281525_31_411 126
549 3300048904 Ga0496101_0042578 Ga0496101_0042578_661_1041 126
550 3300048904 Ga0496101_0276487 Ga0496101_0276487_717_1112 126
551 3300048905 Ga0496102_0025626 Ga0496102_0025626_375_755 126
552 3300048905 Ga0496102_0059027 Ga0496102_0059027_1276_1656 126
553 3300048905 Ga0496102_0094373 Ga0496102_0094373_855_1235 126
554 3300048905 Ga0496102_0115092 Ga0496102_0115092_1203_1583 126
555 3300048905 Ga0496102_0620808 Ga0496102_0620808_335_730 126
556 3300048906 Ga0496103_0031670 Ga0496103_0031670_2536_2916 126
557 3300048906 Ga0496103_0095347 Ga0496103_0095347_1425_1805 126
558 3300048907 Ga0496104_0096551 Ga0496104_0096551_54_434 126
559 3300048907 Ga0496104_0191881 Ga0496104_0191881_1113_1508 126
560 3300048908 Ga0496105_0022709 Ga0496105_0022709_3392_3772 126
561 3300048909 Ga0496106_0016627 Ga0496106_0016627_3583_3963 126
562 3300048910 Ga0496107_0011507 Ga0496107_0011507_2883_3263 126
563 3300048911 Ga0496108_0032625 Ga0496108_0032625_2636_3016 126
564 3300048911 Ga0496108_0209555 Ga0496108_0209555_391_771 126
565 3300048912 Ga0496109_0073684 Ga0496109_0073684_656_1036 126
566 3300048912 Ga0496109_0495713 Ga0496109_0495713_432_812 126
567 3300048912 Ga0496109_0766177 Ga0496109_0766177_190_570 126
568 3300048913 Ga0496110_0011389 Ga0496110_0011389_6693_7073 126
569 3300048914 Ga0496111_0705589 Ga0496111_0705589_53_433 126
570 3300048915 Ga0496112_0066822 Ga0496112_0066822_563_943 126
571 3300048915 Ga0496112_0083617 Ga0496112_0083617_11_391 126
572 3300048915 Ga0496112_0163655 Ga0496112_0163655_264_644 126
573 3300048915 Ga0496112_0613009 Ga0496112_0613009_45_425 126
574 3300048917 Ga0496114_0003309 Ga0496114_0003309_4390_4770 126
575 3300048917 Ga0496114_0296529 Ga0496114_0296529_747_1127 126
576 3300048917 Ga0496114_0545324 Ga0496114_0545324_263_658 126
577 3300048918 Ga0496115_0004612 Ga0496115_0004612_6370_6750 126
578 3300048918 Ga0496115_0534042 Ga0496115_0534042_33_413 126
579 3300048919 Ga0496116_0003851 Ga0496116_0003851_1199_1579 126
580 3300048920 Ga0496117_0000229 Ga0496117_0000229_97354_97734 126
581 3300048921 Ga0496118_0000016 Ga0496118_0000016_491021_491401 126
582 3300048921 Ga0496118_0007348 Ga0496118_0007348_5184_5564 126
583 3300048922 Ga0496119_0006549 Ga0496119_0006549_6610_6990 126
584 3300048922 Ga0496119_0010886 Ga0496119_0010886_336_716 126
585 3300048923 Ga0496120_0000839 Ga0496120_0000839_3158_3538 126
586 3300048923 Ga0496120_0023961 Ga0496120_0023961_1260_1640 126
587 3300048924 Ga0496121_0007867 Ga0496121_0007867_10061_10441 126
588 3300048924 Ga0496121_0070321 Ga0496121_0070321_1736_2116 126
589 3300048927 Ga0496124_0017163 Ga0496124_0017163_1011_1391 126
590 3300048927 Ga0496124_0534111 Ga0496124_0534111_326_706 126
591 3300048928 Ga0496125_0000353 Ga0496125_0000353_70743_71123 126
592 3300048928 Ga0496125_0020465 Ga0496125_0020465_2313_2693 126
593 3300048929 Ga0496126_0002458 Ga0496126_0002458_340_720 126
594 3300048929 Ga0496126_0047696 Ga0496126_0047696_2126_2506 126
595 3300048929 Ga0496126_0255807 Ga0496126_0255807_299_682 126
596 3300049460 Ga0495682_0364352 Ga0495682_0364352_29_457 126
597 3300049569 Ga0501032_0650307 Ga0501032_0650307_237_629 126
598 3300049570 Ga0501033_0195330 Ga0501033_0195330_315_707 126
599 3300049570 Ga0501033_0671763 Ga0501033_0671763_22_414 126
600 3300049572 Ga0501036_0003616 Ga0501036_0003616_11134_11526 126
601 3300049572 Ga0501036_0048011 Ga0501036_0048011_414_806 126
602 3300049573 Ga0501037_0352710 Ga0501037_0352710_460_852 126
603 3300049573 Ga0501037_0385669 Ga0501037_0385669_68_460 126
604 3300049574 Ga0501038_0002930 Ga0501038_0002930_11089_11481 126
605 3300049574 Ga0501038_0976909 Ga0501038_0976909_117_509 126
606 3300049575 Ga0501039_0032408 Ga0501039_0032408_2670_3062 126
607 3300049576 Ga0501040_0005143 Ga0501040_0005143_1052_1444 126
608 3300049576 Ga0501040_0127859 Ga0501040_0127859_320_712 126
609 3300049577 Ga0501041_0001297 Ga0501041_0001297_7601_7993 126
610 3300049577 Ga0501041_0144725 Ga0501041_0144725_246_638 126
611 3300049578 Ga0501042_0000439 Ga0501042_0000439_7911_8303 126
612 3300049578 Ga0501042_0191473 Ga0501042_0191473_153_533 126
613 3300049578 Ga0501042_0194922 Ga0501042_0194922_56_448 126
614 3300049578 Ga0501042_0198644 Ga0501042_0198644_378_770 126
615 3300049579 Ga0501043_0114979 Ga0501043_0114979_774_1166 126
616 3300049580 Ga0501046_0034962 Ga0501046_0034962_3263_3655 126
617 3300049580 Ga0501046_0063947 Ga0501046_0063947_1075_1467 126
618 3300049581 Ga0501047_0180441 Ga0501047_0180441_16_399 126
619 3300049582 Ga0501048_0003706 Ga0501048_0003706_24_416 126
620 3300049582 Ga0501048_0455787 Ga0501048_0455787_325_717 126
621 3300049584 Ga0501068_0021610 Ga0501068_0021610_1278_1670 126
622 3300049584 Ga0501068_0833571 Ga0501068_0833571_175_567 126
623 3300049586 Ga0501070_0895749 Ga0501070_0895749_268_660 126
624 3300049587 Ga0501071_0001933 Ga0501071_0001933_872_1264 126
625 3300049587 Ga0501071_1301684 Ga0501071_1301684_153_533 126
626 3300049588 Ga0501072_0001847 Ga0501072_0001847_11088_11480 126
627 3300049588 Ga0501072_0376478 Ga0501072_0376478_149_541 126
628 3300049591 Ga0501075_0014371 Ga0501075_0014371_2615_3007 126
629 3300049592 Ga0501076_0035786 Ga0501076_0035786_1626_2018 126
630 3300049592 Ga0501076_0094154 Ga0501076_0094154_170_550 126
631 3300049592 Ga0501076_0104895 Ga0501076_0104895_537_929 126
632 3300049592 Ga0501076_0257786 Ga0501076_0257786_819_1211 126
633 3300049593 Ga0501077_0005786 Ga0501077_0005786_5842_6234 126
634 3300049670 Ga0501236_052909 Ga0501236_052909_20_421 126
635 3300049741 Ga0501079_0115180 Ga0501079_0115180_989_1381 126
636 3300049741 Ga0501079_0830511 Ga0501079_0830511_29_409 126
637 3300049742 Ga0501080_0558138 Ga0501080_0558138_611_1003 126
638 3300049742 Ga0501080_0641415 Ga0501080_0641415_370_762 126
639 3300049743 Ga0501081_0008365 Ga0501081_0008365_3090_3482 126
640 3300049822 Ga0501035_0009197 Ga0501035_0009197_6646_7038 126
641 3300049823 Ga0501044_1120227 Ga0501044_1120227_253_645 126
642 3300049824 Ga0501045_0002981 Ga0501045_0002981_24_416 126
643 3300049824 Ga0501045_0021552 Ga0501045_0021552_1654_2046 126
644 3300049824 Ga0501045_0610145 Ga0501045_0610145_232_612 126
645 3300050509 nmdc:mga0qj67_798761_c1 nmdc:mga0qj67_798761_c1_208_588 126
646 3300050513 nmdc:mga0rr50_1435996_c1 nmdc:mga0rr50_1435996_c1_11_391 126
647 3300050514 nmdc:mga08x19_227697_c1 nmdc:mga08x19_227697_c1_275_655 126
648 3300053077 Ga0495601_0491163 Ga0495601_0491163_214_594 126
649 3300053077 Ga0495601_0692188 Ga0495601_0692188_46_426 126
650 3300053092 Ga0500583_0143337 Ga0500583_0143337_13_393 126
651 3300053104 Ga0500556_0000435 Ga0500556_0000435_7583_7963 126
652 3300053119 Ga0500595_085442 Ga0500595_085442_317_697 126
653 3300053136 Ga0500559_0105731 Ga0500559_0105731_499_882 126
654 3300053163 Ga0500639_093651 Ga0500639_093651_861_1241 126
655 3300053177 Ga0500636_0293846 Ga0500636_0293846_294_674 126
656 3300053178 Ga0500637_0027480 Ga0500637_0027480_1933_2313 126
657 3300053178 Ga0500637_0228468 Ga0500637_0228468_651_1031 126
658 3300054114 Ga0501084_0156561 Ga0501084_0156561_123_515 126
659 3300060353 Ga0501082_0003701 Ga0501082_0003701_11929_12321 126
660 3300060353 Ga0501082_0996662 Ga0501082_0996662_76_456 126
661 3300061734 Ga0530510_0016026 Ga0530510_0016026_1061_1453 126
662 3300061734 Ga0530510_0024869 Ga0530510_0024869_3003_3395 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04379

DUF525

ApaG domain

24

110

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xq4-assembly1.cif.gz_A crystal structure of the putative apaa protein from bordetella pertussis, northeast structural genomics target ber40 0.9758 3 124
2f1e-assembly1.cif.gz_A solution structure of apag protein 0.9725 6 120
1tza-assembly1.cif.gz_B x-ray structure of northeast structural genomics consortium target sor45 0.9668 7 126
1xq4-assembly1.cif.gz_A crystal structure of the putative apaa protein from bordetella pertussis, northeast structural genomics target ber40 0.9604 3 124
5hdw-assembly1.cif.gz_A apag domain of fbxo3 0.9574 8 122
ID Description Score Start End Superfamily
af_Q65XS0_164_295_2.60.40.1470 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.9895 8 120 2.60.40.1470
1xq4B00 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.9761 3 121 2.60.40.1470
2f1eA00 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.9725 6 120 2.60.40.1470
1tzaB00 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.966 7 126 2.60.40.1470
1xvsB00 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.9628 2 124 2.60.40.1470
ID Description Score Start End GO Terms
AF-A0A534P798-F1-model_v4 Co2+/Mg2+ efflux protein ApaG 1.003 8 112
AF-A0A554XN54-F1-model_v4 Protein ApaG 1.002 6 121 GO:0070987
AF-A0A1A6DUG4-F1-model_v4 Co2+/Mg2+ efflux protein ApaG 1.002 6 121 GO:0070987
AF-A0A498ELH1-F1-model_v4 deleted 1.001 3 123
AF-A0A838N077-F1-model_v4 Co2+/Mg2+ efflux protein ApaG 1.001 8 120 GO:0070987

Feature Viewer

pLDDT pTM Quality
95.73 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map