F473485
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 662 | 339 | 662 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300031727|Ga0316576_10000552|Ga0316576_1000055213 |
| Length | 132 |
| Sequence | MHDDGSSHAITDDIRVEVDSHFVPERSDPHVGRWFFAYRVRITNESVRTVQLLSRRWRIIDAHGQIEEVTGPGVVGEQPVLTPGESFEYASFCPLGTPFGTMEGSYQMVDDDGVKFEVTVARFTLSQPLEVN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 65 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 66 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 92 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 93 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 96 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 152 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 157 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 165 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 167 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 171 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 175 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 176 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 177 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 180 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 181 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 182 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 193 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 194 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 195 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 196 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 208 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 209 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 212 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 213 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 215 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 216 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 217 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 220 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 221 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 222 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 223 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 224 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 226 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 227 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 228 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 229 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 230 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 231 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 232 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 233 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 234 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 235 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 288 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 291 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 292 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 293 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 294 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 295 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 296 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 318 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 331 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 332 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 333 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 334 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 335 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.79 |
| Metatranscriptomes | 1.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.21 |
| Nodule | 0 |
| Rhizoplane | 5.74 |
| Rhizosphere | 84.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10068542 | 3300003316 | Bacteria | 1928 |
| 2 | rootL2_10097826 | 3300003322 | Bacteria | 4895 |
| 3 | rootH1_10007647 | 3300003323 | Bacteria | 55493 |
| 4 | rootH1_10058373 | 3300003323 | Bacteria | 5984 |
| 5 | Ga0065715_10274377 | 3300005293 | Bacteria | 1102 |
| 6 | Ga0065715_10546729 | 3300005293 | Bacteria | 744 |
| 7 | Ga0070683_100056107 | 3300005329 | Bacteria | 3658 |
| 8 | Ga0070690_100021042 | 3300005330 | Bacteria | 3980 |
| 9 | Ga0070670_100369788 | 3300005331 | Bacteria | 1262 |
| 10 | Ga0068869_100651659 | 3300005334 | Bacteria | 894 |
| 11 | Ga0068869_101533201 | 3300005334 | Bacteria | 592 |
| 12 | Ga0070666_10000496 | 3300005335 | Bacteria | 23684 |
| 13 | Ga0070666_10474594 | 3300005335 | Bacteria | 905 |
| 14 | Ga0070666_10510933 | 3300005335 | Bacteria | 872 |
| 15 | Ga0070680_100085388 | 3300005336 | Bacteria | 2608 |
| 16 | Ga0070682_100017839 | 3300005337 | Bacteria | 4141 |
| 17 | Ga0070682_100041944 | 3300005337 | Bacteria | 2823 |
| 18 | Ga0068868_100013762 | 3300005338 | Bacteria | 5944 |
| 19 | Ga0070661_100468504 | 3300005344 | Bacteria | 1004 |
| 20 | Ga0070692_10565581 | 3300005345 | Bacteria | 747 |
| 21 | Ga0070675_100069351 | 3300005354 | Bacteria | 2921 |
| 22 | Ga0070671_100006552 | 3300005355 | Bacteria | 9309 |
| 23 | Ga0070671_100009932 | 3300005355 | Bacteria | 7644 |
| 24 | Ga0070671_100087408 | 3300005355 | Bacteria | 2609 |
| 25 | Ga0070673_100079390 | 3300005364 | Bacteria | 2657 |
| 26 | Ga0070667_100000008 | 3300005367 | Bacteria | 285591 |
| 27 | Ga0070667_100006624 | 3300005367 | Bacteria | 9629 |
| 28 | Ga0070667_100012080 | 3300005367 | Bacteria | 7149 |
| 29 | Ga0070709_10054960 | 3300005434 | Bacteria | 2512 |
| 30 | Ga0070709_10065831 | 3300005434 | Bacteria | 2322 |
| 31 | Ga0070709_10899790 | 3300005434 | Bacteria | 700 |
| 32 | Ga0070709_10899850 | 3300005434 | Bacteria | 700 |
| 33 | Ga0070714_100001058 | 3300005435 | Bacteria | 19666 |
| 34 | Ga0070714_100010004 | 3300005435 | Bacteria | 7481 |
| 35 | Ga0070714_101188271 | 3300005435 | Bacteria | 744 |
| 36 | Ga0070714_101327145 | 3300005435 | Bacteria | 702 |
| 37 | Ga0070713_100008095 | 3300005436 | Bacteria | 7433 |
| 38 | Ga0070713_100059740 | 3300005436 | Bacteria | 3185 |
| 39 | Ga0070713_100295524 | 3300005436 | Bacteria | 1490 |
| 40 | Ga0070710_10021966 | 3300005437 | Bacteria | 3332 |
| 41 | Ga0070710_10644757 | 3300005437 | Bacteria | 742 |
| 42 | Ga0070711_100002891 | 3300005439 | Bacteria | 9895 |
| 43 | Ga0070711_100066663 | 3300005439 | Bacteria | 2523 |
| 44 | Ga0070711_100433988 | 3300005439 | Bacteria | 1073 |
| 45 | Ga0070663_100905617 | 3300005455 | Bacteria | 762 |
| 46 | Ga0070678_100026325 | 3300005456 | Bacteria | 3930 |
| 47 | Ga0070678_100071437 | 3300005456 | Bacteria | 2598 |
| 48 | Ga0070662_100215378 | 3300005457 | Bacteria | 1530 |
| 49 | Ga0070681_10172655 | 3300005458 | Bacteria | 2083 |
| 50 | Ga0070685_10259888 | 3300005466 | Bacteria | 1154 |
| 51 | Ga0070685_10681015 | 3300005466 | Bacteria | 748 |
| 52 | Ga0070707_101909595 | 3300005468 | Bacteria | 561 |
| 53 | Ga0070679_100026728 | 3300005530 | Bacteria | 5675 |
| 54 | Ga0070684_100223202 | 3300005535 | Bacteria | 1719 |
| 55 | Ga0068853_100715760 | 3300005539 | Bacteria | 955 |
| 56 | Ga0070672_100283766 | 3300005543 | Bacteria | 1401 |
| 57 | Ga0070686_100009034 | 3300005544 | Bacteria | 5590 |
| 58 | Ga0070686_101254600 | 3300005544 | Bacteria | 617 |
| 59 | Ga0070695_100489788 | 3300005545 | Bacteria | 949 |
| 60 | Ga0070696_100029592 | 3300005546 | Bacteria | 3744 |
| 61 | Ga0070696_100833338 | 3300005546 | Bacteria | 761 |
| 62 | Ga0070693_100086897 | 3300005547 | Bacteria | 1877 |
| 63 | Ga0070665_100000509 | 3300005548 | Bacteria | 55803 |
| 64 | Ga0070665_100012054 | 3300005548 | Bacteria | 8721 |
| 65 | Ga0070665_100016149 | 3300005548 | Bacteria | 7493 |
| 66 | Ga0070665_100052877 | 3300005548 | Bacteria | 4073 |
| 67 | Ga0070665_100559379 | 3300005548 | Bacteria | 1156 |
| 68 | Ga0070665_100673819 | 3300005548 | Bacteria | 1047 |
| 69 | Ga0070665_100825421 | 3300005548 | Bacteria | 940 |
| 70 | Ga0070665_101789584 | 3300005548 | Bacteria | 621 |
| 71 | Ga0070704_100056014 | 3300005549 | Bacteria | 2798 |
| 72 | Ga0070704_100069596 | 3300005549 | Bacteria | 2550 |
| 73 | Ga0068855_100009767 | 3300005563 | Bacteria | 11575 |
| 74 | Ga0068855_100455056 | 3300005563 | Bacteria | 1396 |
| 75 | Ga0068857_100093293 | 3300005577 | Bacteria | 2696 |
| 76 | Ga0068857_101972854 | 3300005577 | Bacteria | 572 |
| 77 | Ga0068854_100610584 | 3300005578 | Bacteria | 932 |
| 78 | Ga0068856_100061084 | 3300005614 | Bacteria | 3722 |
| 79 | Ga0068856_100153668 | 3300005614 | Bacteria | 2311 |
| 80 | Ga0068856_100336918 | 3300005614 | Bacteria | 1526 |
| 81 | Ga0068859_100045726 | 3300005617 | Bacteria | 4398 |
| 82 | Ga0068859_100115509 | 3300005617 | Bacteria | 2749 |
| 83 | Ga0068864_100357948 | 3300005618 | Bacteria | 1379 |
| 84 | Ga0068864_101531421 | 3300005618 | Bacteria | 670 |
| 85 | Ga0068866_10279753 | 3300005718 | Bacteria | 1033 |
| 86 | Ga0068861_100216007 | 3300005719 | Bacteria | 1618 |
| 87 | Ga0068851_10391698 | 3300005834 | Bacteria | 816 |
| 88 | Ga0068870_10658442 | 3300005840 | Bacteria | 718 |
| 89 | Ga0068863_100002484 | 3300005841 | Bacteria | 18330 |
| 90 | Ga0068863_100006983 | 3300005841 | Bacteria | 11070 |
| 91 | Ga0068863_100061192 | 3300005841 | Bacteria | 3559 |
| 92 | Ga0068863_100115021 | 3300005841 | Bacteria | 2563 |
| 93 | Ga0068858_100000598 | 3300005842 | Bacteria | 37671 |
| 94 | Ga0068858_100002641 | 3300005842 | Bacteria | 18052 |
| 95 | Ga0068858_100009281 | 3300005842 | Bacteria | 9393 |
| 96 | Ga0068860_100000771 | 3300005843 | Bacteria | 36058 |
| 97 | Ga0068860_100088174 | 3300005843 | Bacteria | 2953 |
| 98 | Ga0068862_100007748 | 3300005844 | Bacteria | 8882 |
| 99 | Ga0068862_101141804 | 3300005844 | Bacteria | 776 |
| 100 | Ga0068862_102788672 | 3300005844 | Bacteria | 500 |
| 101 | Ga0070717_10186734 | 3300006028 | Bacteria | 1809 |
| 102 | Ga0070715_10000669 | 3300006163 | Bacteria | 9159 |
| 103 | Ga0070716_100001421 | 3300006173 | Bacteria | 10639 |
| 104 | Ga0070716_100002786 | 3300006173 | Bacteria | 8122 |
| 105 | Ga0070716_100867530 | 3300006173 | Unclassified | 704 |
| 106 | Ga0070712_100000683 | 3300006175 | Bacteria | 20066 |
| 107 | Ga0070712_100085173 | 3300006175 | Bacteria | 2300 |
| 108 | Ga0070712_100097881 | 3300006175 | Bacteria | 2163 |
| 109 | Ga0097621_100009247 | 3300006237 | Bacteria | 7149 |
| 110 | Ga0097621_100111692 | 3300006237 | Bacteria | 2310 |
| 111 | Ga0097621_100136303 | 3300006237 | Bacteria | 2094 |
| 112 | Ga0068871_100015422 | 3300006358 | Bacteria | 5719 |
| 113 | Ga0068871_100029484 | 3300006358 | Bacteria | 4310 |
| 114 | Ga0068871_100177815 | 3300006358 | Bacteria | 1827 |
| 115 | Ga0075430_101069096 | 3300006846 | Bacteria | 665 |
| 116 | Ga0068865_100009034 | 3300006881 | Bacteria | 6165 |
| 117 | Ga0068865_100454400 | 3300006881 | Bacteria | 1060 |
| 118 | Ga0097620_100045727 | 3300006931 | Bacteria | 4398 |
| 119 | Ga0097620_100115501 | 3300006931 | Bacteria | 2749 |
| 120 | Ga0075435_101133228 | 3300007076 | Bacteria | 684 |
| 121 | Ga0099794_10178257 | 3300007265 | Bacteria | 1084 |
| 122 | Ga0099795_10000053 | 3300007788 | Bacteria | 22441 |
| 123 | Ga0099795_10028291 | 3300007788 | Bacteria | 1904 |
| 124 | Ga0105250_10016067 | 3300009092 | Bacteria | 3054 |
| 125 | Ga0105240_10008483 | 3300009093 | Bacteria | 14696 |
| 126 | Ga0105240_10015651 | 3300009093 | Bacteria | 10301 |
| 127 | Ga0105240_10038444 | 3300009093 | Bacteria | 6139 |
| 128 | Ga0105240_10045312 | 3300009093 | Bacteria | 5580 |
| 129 | Ga0105240_10073560 | 3300009093 | Bacteria | 4219 |
| 130 | Ga0105240_10092604 | 3300009093 | Bacteria | 3690 |
| 131 | Ga0105240_10459398 | 3300009093 | Bacteria | 1423 |
| 132 | Ga0105240_10491127 | 3300009093 | Bacteria | 1367 |
| 133 | Ga0105240_10981577 | 3300009093 | Bacteria | 904 |
| 134 | Ga0105245_10005446 | 3300009098 | Bacteria | 11181 |
| 135 | Ga0105247_10000091 | 3300009101 | Bacteria | 97097 |
| 136 | Ga0105247_10008379 | 3300009101 | Bacteria | 6302 |
| 137 | Ga0105247_10016824 | 3300009101 | Bacteria | 4384 |
| 138 | Ga0105243_10333340 | 3300009148 | Bacteria | 1387 |
| 139 | Ga0105241_10009602 | 3300009174 | Bacteria | 7113 |
| 140 | Ga0105241_10467969 | 3300009174 | Bacteria | 1118 |
| 141 | Ga0105242_10000422 | 3300009176 | Bacteria | 33749 |
| 142 | Ga0105248_10008369 | 3300009177 | Bacteria | 11361 |
| 143 | Ga0105248_10054897 | 3300009177 | Bacteria | 4468 |
| 144 | Ga0105248_10287866 | 3300009177 | Bacteria | 1850 |
| 145 | Ga0105248_10678430 | 3300009177 | Bacteria | 1163 |
| 146 | Ga0105248_11905637 | 3300009177 | Bacteria | 675 |
| 147 | Ga0105248_12041989 | 3300009177 | Bacteria | 651 |
| 148 | Ga0105237_10013318 | 3300009545 | Bacteria | 8625 |
| 149 | Ga0105237_10125028 | 3300009545 | Bacteria | 2566 |
| 150 | Ga0105237_10161390 | 3300009545 | Bacteria | 2240 |
| 151 | Ga0105237_10293186 | 3300009545 | Bacteria | 1629 |
| 152 | Ga0105237_10561974 | 3300009545 | Bacteria | 1148 |
| 153 | Ga0105237_10564881 | 3300009545 | Bacteria | 1144 |
| 154 | Ga0105237_10818779 | 3300009545 | Bacteria | 938 |
| 155 | Ga0105238_10115276 | 3300009551 | Bacteria | 2666 |
| 156 | Ga0105238_10301421 | 3300009551 | Bacteria | 1586 |
| 157 | Ga0105238_10395259 | 3300009551 | Bacteria | 1375 |
| 158 | Ga0105238_10506396 | 3300009551 | Bacteria | 1209 |
| 159 | Ga0105238_10600600 | 3300009551 | Bacteria | 1108 |
| 160 | Ga0105238_11958410 | 3300009551 | Bacteria | 619 |
| 161 | Ga0105249_10040291 | 3300009553 | Bacteria | 4242 |
| 162 | Ga0105249_10078018 | 3300009553 | Bacteria | 3073 |
| 163 | Ga0105249_10327642 | 3300009553 | Bacteria | 1544 |
| 164 | Ga0099796_10000096 | 3300010159 | Bacteria | 14200 |
| 165 | Ga0099796_10000234 | 3300010159 | Bacteria | 8666 |
| 166 | Ga0099796_10000788 | 3300010159 | Bacteria | 5719 |
| 167 | Ga0099796_10081714 | 3300010159 | Bacteria | 1186 |
| 168 | Ga0105239_10008715 | 3300010375 | Bacteria | 11480 |
| 169 | Ga0105239_10263262 | 3300010375 | Bacteria | 1938 |
| 170 | Ga0105239_11034085 | 3300010375 | Bacteria | 945 |
| 171 | Ga0105246_10623892 | 3300011119 | Bacteria | 935 |
| 172 | Ga0105246_11194654 | 3300011119 | Bacteria | 700 |
| 173 | Ga0157370_10474616 | 3300013104 | Bacteria | 1149 |
| 174 | Ga0157369_10117693 | 3300013105 | Bacteria | 2821 |
| 175 | Ga0157369_11435456 | 3300013105 | Bacteria | 702 |
| 176 | Ga0157374_10001660 | 3300013296 | Bacteria | 18628 |
| 177 | Ga0157374_11157299 | 3300013296 | Bacteria | 794 |
| 178 | Ga0157374_12556355 | 3300013296 | Bacteria | 538 |
| 179 | Ga0157378_10002030 | 3300013297 | Bacteria | 18126 |
| 180 | Ga0163162_10009296 | 3300013306 | Bacteria | 9558 |
| 181 | Ga0163162_10217056 | 3300013306 | Bacteria | 2043 |
| 182 | Ga0163162_10290810 | 3300013306 | Bacteria | 1766 |
| 183 | Ga0163162_12193624 | 3300013306 | Bacteria | 634 |
| 184 | Ga0157372_10386511 | 3300013307 | Bacteria | 1630 |
| 185 | Ga0157372_11172816 | 3300013307 | Bacteria | 888 |
| 186 | Ga0157375_10037041 | 3300013308 | Bacteria | 4670 |
| 187 | Ga0157375_11195254 | 3300013308 | Bacteria | 892 |
| 188 | Ga0163163_10024106 | 3300014325 | Bacteria | 5789 |
| 189 | Ga0163163_10026466 | 3300014325 | Bacteria | 5545 |
| 190 | Ga0163163_10156437 | 3300014325 | Bacteria | 2324 |
| 191 | Ga0163163_10529621 | 3300014325 | Bacteria | 1241 |
| 192 | Ga0163163_10603908 | 3300014325 | Bacteria | 1160 |
| 193 | Ga0163163_11025766 | 3300014325 | Bacteria | 888 |
| 194 | Ga0163163_11494964 | 3300014325 | Bacteria | 737 |
| 195 | Ga0157380_10248974 | 3300014326 | Bacteria | 1607 |
| 196 | Ga0157380_10490984 | 3300014326 | Bacteria | 1190 |
| 197 | Ga0157380_11260793 | 3300014326 | Bacteria | 785 |
| 198 | Ga0157379_10010805 | 3300014968 | Bacteria | 7961 |
| 199 | Ga0157379_10050000 | 3300014968 | Bacteria | 3731 |
| 200 | Ga0157379_10105843 | 3300014968 | Bacteria | 2525 |
| 201 | Ga0157379_10210143 | 3300014968 | Bacteria | 1761 |
| 202 | Ga0157379_10456076 | 3300014968 | Bacteria | 1181 |
| 203 | Ga0157379_10549876 | 3300014968 | Bacteria | 1074 |
| 204 | Ga0157376_10072368 | 3300014969 | Bacteria | 2932 |
| 205 | Ga0157376_10622690 | 3300014969 | Bacteria | 1077 |
| 206 | Ga0157376_11143678 | 3300014969 | Bacteria | 805 |
| 207 | Ga0157376_11393544 | 3300014969 | Bacteria | 732 |
| 208 | Ga0213873_10006485 | 3300021358 | Bacteria | 2303 |
| 209 | Ga0213872_10089217 | 3300021361 | Bacteria | 1381 |
| 210 | Ga0213874_10004025 | 3300021377 | Bacteria | 3316 |
| 211 | Ga0213874_10041085 | 3300021377 | Bacteria | 1383 |
| 212 | Ga0213876_10119970 | 3300021384 | Bacteria | 1396 |
| 213 | Ga0228598_1022414 | 3300024227 | Bacteria | 1242 |
| 214 | Ga0228598_1040467 | 3300024227 | Bacteria | 919 |
| 215 | Ga0207692_10106771 | 3300025898 | Bacteria | 1546 |
| 216 | Ga0207692_10879259 | 3300025898 | Bacteria | 589 |
| 217 | Ga0207692_11092995 | 3300025898 | Bacteria | 528 |
| 218 | Ga0207710_10000241 | 3300025900 | Bacteria | 46419 |
| 219 | Ga0207680_10062362 | 3300025903 | Bacteria | 2277 |
| 220 | Ga0207680_10089478 | 3300025903 | Bacteria | 1954 |
| 221 | Ga0207680_10113706 | 3300025903 | Bacteria | 1760 |
| 222 | Ga0207647_10232343 | 3300025904 | Bacteria | 1061 |
| 223 | Ga0207685_10003015 | 3300025905 | Bacteria | 3999 |
| 224 | Ga0207699_10023052 | 3300025906 | Bacteria | 3383 |
| 225 | Ga0207643_10619436 | 3300025908 | Bacteria | 697 |
| 226 | Ga0207654_10123384 | 3300025911 | Bacteria | 1630 |
| 227 | Ga0207654_10173594 | 3300025911 | Bacteria | 1402 |
| 228 | Ga0207695_10031349 | 3300025913 | Bacteria | 5832 |
| 229 | Ga0207695_10034473 | 3300025913 | Bacteria | 5504 |
| 230 | Ga0207695_10036099 | 3300025913 | Bacteria | 5347 |
| 231 | Ga0207695_10041050 | 3300025913 | Bacteria | 4953 |
| 232 | Ga0207695_10056994 | 3300025913 | Bacteria | 4062 |
| 233 | Ga0207695_10057161 | 3300025913 | Bacteria | 4055 |
| 234 | Ga0207695_10151702 | 3300025913 | Bacteria | 2256 |
| 235 | Ga0207695_10620050 | 3300025913 | Bacteria | 963 |
| 236 | Ga0207671_10048805 | 3300025914 | Bacteria | 3133 |
| 237 | Ga0207671_10049864 | 3300025914 | Bacteria | 3100 |
| 238 | Ga0207671_10142780 | 3300025914 | Bacteria | 1846 |
| 239 | Ga0207671_10153228 | 3300025914 | Bacteria | 1781 |
| 240 | Ga0207671_10222867 | 3300025914 | Bacteria | 1478 |
| 241 | Ga0207671_10398133 | 3300025914 | Bacteria | 1095 |
| 242 | Ga0207693_10000226 | 3300025915 | Bacteria | 51496 |
| 243 | Ga0207693_10067112 | 3300025915 | Bacteria | 2808 |
| 244 | Ga0207693_10079827 | 3300025915 | Bacteria | 2561 |
| 245 | Ga0207663_10018125 | 3300025916 | Bacteria | 3938 |
| 246 | Ga0207663_10032699 | 3300025916 | Bacteria | 3091 |
| 247 | Ga0207660_10072608 | 3300025917 | Bacteria | 2506 |
| 248 | Ga0207657_11505194 | 3300025919 | Bacteria | 503 |
| 249 | Ga0207649_10419336 | 3300025920 | Bacteria | 1005 |
| 250 | Ga0207652_10147649 | 3300025921 | Bacteria | 2105 |
| 251 | Ga0207681_11403294 | 3300025923 | Bacteria | 586 |
| 252 | Ga0207694_10269179 | 3300025924 | Bacteria | 1397 |
| 253 | Ga0207694_10349415 | 3300025924 | Bacteria | 1224 |
| 254 | Ga0207694_10544415 | 3300025924 | Bacteria | 974 |
| 255 | Ga0207694_11290486 | 3300025924 | Bacteria | 617 |
| 256 | Ga0207650_10056637 | 3300025925 | Bacteria | 2913 |
| 257 | Ga0207650_10546897 | 3300025925 | Bacteria | 970 |
| 258 | Ga0207687_10052745 | 3300025927 | Bacteria | 2839 |
| 259 | Ga0207700_10167822 | 3300025928 | Bacteria | 1828 |
| 260 | Ga0207700_10537608 | 3300025928 | Bacteria | 1036 |
| 261 | Ga0207664_10000874 | 3300025929 | Bacteria | 20374 |
| 262 | Ga0207664_10015495 | 3300025929 | Bacteria | 5535 |
| 263 | Ga0207664_10974918 | 3300025929 | Bacteria | 760 |
| 264 | Ga0207644_10008547 | 3300025931 | Bacteria | 6698 |
| 265 | Ga0207644_10020441 | 3300025931 | Bacteria | 4501 |
| 266 | Ga0207644_10510840 | 3300025931 | Bacteria | 992 |
| 267 | Ga0207706_10314391 | 3300025933 | Bacteria | 1364 |
| 268 | Ga0207686_10059540 | 3300025934 | Bacteria | 2413 |
| 269 | Ga0207709_10225783 | 3300025935 | Bacteria | 1353 |
| 270 | Ga0207704_10036138 | 3300025938 | Bacteria | 2839 |
| 271 | Ga0207704_10344661 | 3300025938 | Bacteria | 1158 |
| 272 | Ga0207665_10002356 | 3300025939 | Bacteria | 12761 |
| 273 | Ga0207665_10033438 | 3300025939 | Bacteria | 3408 |
| 274 | Ga0207665_10751449 | 3300025939 | Bacteria | 769 |
| 275 | Ga0207691_10503296 | 3300025940 | Bacteria | 1029 |
| 276 | Ga0207711_10183538 | 3300025941 | Bacteria | 1903 |
| 277 | Ga0207711_10455496 | 3300025941 | Bacteria | 1191 |
| 278 | Ga0207711_10817891 | 3300025941 | Bacteria | 867 |
| 279 | Ga0207689_10395332 | 3300025942 | Bacteria | 1152 |
| 280 | Ga0207689_11037869 | 3300025942 | Bacteria | 691 |
| 281 | Ga0207661_10204781 | 3300025944 | Bacteria | 1736 |
| 282 | Ga0207679_11061650 | 3300025945 | Bacteria | 743 |
| 283 | Ga0207667_10216074 | 3300025949 | Bacteria | 1965 |
| 284 | Ga0207667_10978395 | 3300025949 | Bacteria | 834 |
| 285 | Ga0207651_10043010 | 3300025960 | Bacteria | 3012 |
| 286 | Ga0207651_10233363 | 3300025960 | Bacteria | 1495 |
| 287 | Ga0207712_10051998 | 3300025961 | Bacteria | 2868 |
| 288 | Ga0207712_10066477 | 3300025961 | Bacteria | 2577 |
| 289 | Ga0207712_10343241 | 3300025961 | Bacteria | 1239 |
| 290 | Ga0207640_10086854 | 3300025981 | Bacteria | 2155 |
| 291 | Ga0207658_10000030 | 3300025986 | Bacteria | 168693 |
| 292 | Ga0207658_10010121 | 3300025986 | Bacteria | 6405 |
| 293 | Ga0207658_10360988 | 3300025986 | Bacteria | 1267 |
| 294 | Ga0207658_11162855 | 3300025986 | Bacteria | 705 |
| 295 | Ga0207677_10136030 | 3300026023 | Bacteria | 1874 |
| 296 | Ga0207703_10000729 | 3300026035 | Bacteria | 32318 |
| 297 | Ga0207703_10007683 | 3300026035 | Bacteria | 8545 |
| 298 | Ga0207703_10040071 | 3300026035 | Bacteria | 3747 |
| 299 | Ga0207703_10068599 | 3300026035 | Bacteria | 2922 |
| 300 | Ga0207703_10153572 | 3300026035 | Bacteria | 2010 |
| 301 | Ga0207703_10921714 | 3300026035 | Bacteria | 837 |
| 302 | Ga0207678_10010212 | 3300026067 | Bacteria | 8242 |
| 303 | Ga0207702_10022988 | 3300026078 | Bacteria | 5172 |
| 304 | Ga0207702_10158952 | 3300026078 | Bacteria | 2062 |
| 305 | Ga0207702_10161499 | 3300026078 | Bacteria | 2046 |
| 306 | Ga0207641_10009315 | 3300026088 | Bacteria | 8101 |
| 307 | Ga0207641_10107245 | 3300026088 | Bacteria | 2471 |
| 308 | Ga0207648_10713900 | 3300026089 | Bacteria | 929 |
| 309 | Ga0207676_10705310 | 3300026095 | Bacteria | 978 |
| 310 | Ga0207674_10286362 | 3300026116 | Bacteria | 1596 |
| 311 | Ga0207674_10532590 | 3300026116 | Bacteria | 1135 |
| 312 | Ga0207675_100551123 | 3300026118 | Bacteria | 1152 |
| 313 | Ga0207675_100818170 | 3300026118 | Bacteria | 945 |
| 314 | Ga0207683_10001388 | 3300026121 | Bacteria | 21837 |
| 315 | Ga0207683_10193010 | 3300026121 | Bacteria | 1849 |
| 316 | Ga0207698_11005606 | 3300026142 | Bacteria | 845 |
| 317 | Ga0207698_12721621 | 3300026142 | Bacteria | 503 |
| 318 | Ga0209179_1000082 | 3300027512 | Bacteria | 15283 |
| 319 | Ga0209179_1008935 | 3300027512 | Bacteria | 1703 |
| 320 | Ga0209179_1028474 | 3300027512 | Bacteria | 1132 |
| 321 | Ga0209588_1057613 | 3300027671 | Bacteria | 1256 |
| 322 | Ga0209588_1156333 | 3300027671 | Bacteria | 721 |
| 323 | Ga0268266_10000246 | 3300028379 | Bacteria | 91633 |
| 324 | Ga0268266_10002398 | 3300028379 | Bacteria | 20201 |
| 325 | Ga0268266_10020953 | 3300028379 | Bacteria | 5573 |
| 326 | Ga0268266_10024656 | 3300028379 | Bacteria | 5118 |
| 327 | Ga0268266_10096007 | 3300028379 | Bacteria | 2604 |
| 328 | Ga0268266_11375179 | 3300028379 | Unclassified | 681 |
| 329 | Ga0268266_11809325 | 3300028379 | Bacteria | 585 |
| 330 | Ga0268266_12221136 | 3300028379 | Bacteria | 521 |
| 331 | Ga0268265_10005087 | 3300028380 | Bacteria | 9016 |
| 332 | Ga0268264_10000102 | 3300028381 | Bacteria | 222526 |
| 333 | Ga0268264_10312907 | 3300028381 | Bacteria | 1482 |
| 334 | Ga0268264_10352465 | 3300028381 | Bacteria | 1401 |
| 335 | Ga0265326_10012329 | 3300028558 | Bacteria | 2515 |
| 336 | Ga0265326_10030252 | 3300028558 | Bacteria | 1542 |
| 337 | Ga0265319_1008703 | 3300028563 | Bacteria | 4413 |
| 338 | Ga0265334_10000008 | 3300028573 | Bacteria | 200602 |
| 339 | Ga0265334_10001247 | 3300028573 | Bacteria | 12415 |
| 340 | Ga0265318_10000270 | 3300028577 | Bacteria | 44032 |
| 341 | Ga0265338_10072217 | 3300028800 | Bacteria | 2947 |
| 342 | Ga0265324_10073170 | 3300029957 | Bacteria | 1167 |
| 343 | Ga0307511_10001554 | 3300030521 | Bacteria | 24331 |
| 344 | Ga0307511_10009601 | 3300030521 | Bacteria | 9638 |
| 345 | Ga0307511_10197524 | 3300030521 | Bacteria | 1051 |
| 346 | Ga0265762_1024288 | 3300030760 | Bacteria | 1126 |
| 347 | Ga0265762_1035755 | 3300030760 | Bacteria | 957 |
| 348 | Ga0265762_1180486 | 3300030760 | Bacteria | 520 |
| 349 | Ga0265763_1007554 | 3300030763 | Bacteria | 956 |
| 350 | Ga0265760_10296819 | 3300031090 | Unclassified | 572 |
| 351 | Ga0265760_10352984 | 3300031090 | Bacteria | 526 |
| 352 | Ga0265330_10005661 | 3300031235 | Bacteria | 6213 |
| 353 | Ga0265330_10389805 | 3300031235 | Bacteria | 589 |
| 354 | Ga0265332_10002814 | 3300031238 | Bacteria | 8644 |
| 355 | Ga0265328_10008403 | 3300031239 | Bacteria | 4259 |
| 356 | Ga0265328_10097463 | 3300031239 | Bacteria | 1087 |
| 357 | Ga0265328_10143577 | 3300031239 | Bacteria | 896 |
| 358 | Ga0265320_10020396 | 3300031240 | Bacteria | 3595 |
| 359 | Ga0265325_10005394 | 3300031241 | Bacteria | 7900 |
| 360 | Ga0265325_10097684 | 3300031241 | Bacteria | 1441 |
| 361 | Ga0265329_10026312 | 3300031242 | Bacteria | 1917 |
| 362 | Ga0265340_10044851 | 3300031247 | Bacteria | 2162 |
| 363 | Ga0265339_10014987 | 3300031249 | Bacteria | 4660 |
| 364 | Ga0265331_10003147 | 3300031250 | Bacteria | 10771 |
| 365 | Ga0265331_10012515 | 3300031250 | Bacteria | 4592 |
| 366 | Ga0265316_10057269 | 3300031344 | Bacteria | 3039 |
| 367 | Ga0307513_10025617 | 3300031456 | Bacteria | 6827 |
| 368 | Ga0307513_10046215 | 3300031456 | Bacteria | 4750 |
| 369 | Ga0307509_10000005 | 3300031507 | Bacteria | 435959 |
| 370 | Ga0307509_10957217 | 3300031507 | Unclassified | 522 |
| 371 | Ga0307408_100814932 | 3300031548 | Bacteria | 848 |
| 372 | Ga0265313_10000076 | 3300031595 | Bacteria | 96542 |
| 373 | Ga0265313_10000653 | 3300031595 | Bacteria | 35705 |
| 374 | Ga0307514_10202814 | 3300031649 | Bacteria | 1244 |
| 375 | Ga0316575_10006773 | 3300031665 | Bacteria | 4139 |
| 376 | Ga0316575_10107083 | 3300031665 | Bacteria | 1139 |
| 377 | Ga0316575_10149683 | 3300031665 | Bacteria | 963 |
| 378 | Ga0316579_10068564 | 3300031691 | Bacteria | 1677 |
| 379 | Ga0316579_10086156 | 3300031691 | Bacteria | 1499 |
| 380 | Ga0265314_10013166 | 3300031711 | Bacteria | 6699 |
| 381 | Ga0265342_10022958 | 3300031712 | Bacteria | 3957 |
| 382 | Ga0265342_10051007 | 3300031712 | Bacteria | 2469 |
| 383 | Ga0316576_10000552 | 3300031727 | Bacteria | 17595 |
| 384 | Ga0316576_10003801 | 3300031727 | Bacteria | 8930 |
| 385 | Ga0316576_10018182 | 3300031727 | Bacteria | 4792 |
| 386 | Ga0316576_10045118 | 3300031727 | Bacteria | 3186 |
| 387 | Ga0316578_10000053 | 3300031728 | Bacteria | 24064 |
| 388 | Ga0316578_10060124 | 3300031728 | Bacteria | 2236 |
| 389 | Ga0316578_10196595 | 3300031728 | Bacteria | 1214 |
| 390 | Ga0307516_10000067 | 3300031730 | Bacteria | 111575 |
| 391 | Ga0316577_10008728 | 3300031733 | Bacteria | 5433 |
| 392 | Ga0316577_10038625 | 3300031733 | Bacteria | 2670 |
| 393 | Ga0316577_10596612 | 3300031733 | Bacteria | 628 |
| 394 | Ga0307413_10007351 | 3300031824 | Bacteria | 5109 |
| 395 | Ga0307410_10026652 | 3300031852 | Bacteria | 3642 |
| 396 | Ga0307410_10078830 | 3300031852 | Bacteria | 2306 |
| 397 | Ga0307406_10145767 | 3300031901 | Bacteria | 1682 |
| 398 | Ga0307407_10239307 | 3300031903 | Bacteria | 1237 |
| 399 | Ga0307409_100278134 | 3300031995 | Bacteria | 1545 |
| 400 | Ga0307416_100583715 | 3300032002 | Bacteria | 1195 |
| 401 | Ga0307414_10186707 | 3300032004 | Bacteria | 1673 |
| 402 | Ga0307411_10021443 | 3300032005 | Bacteria | 3781 |
| 403 | Ga0307411_10103834 | 3300032005 | Bacteria | 2017 |
| 404 | Ga0307415_100287594 | 3300032126 | Bacteria | 1355 |
| 405 | Ga0316583_10003601 | 3300032133 | Bacteria | 5472 |
| 406 | Ga0316583_10033063 | 3300032133 | Bacteria | 1838 |
| 407 | Ga0316580_10001292 | 3300032139 | Bacteria | 6478 |
| 408 | Ga0316580_10035903 | 3300032139 | Bacteria | 1534 |
| 409 | Ga0307507_10301114 | 3300033179 | Bacteria | 983 |
| 410 | Ga0307510_10000006 | 3300033180 | Bacteria | 566474 |
| 411 | Ga0307510_10016283 | 3300033180 | Bacteria | 8778 |
| 412 | Ga0307510_10136839 | 3300033180 | Bacteria | 2105 |
| 413 | Ga0316592_1053336 | 3300033524 | Bacteria | 904 |
| 414 | Ga0316596_1069078 | 3300033541 | Bacteria | 946 |
| 415 | Ga0373944_0209135 | 3300035089 | Bacteria | 709 |
| 416 | Ga0373923_0346475 | 3300035111 | Bacteria | 709 |
| 417 | Ga0373936_0006275 | 3300035113 | Bacteria | 4484 |
| 418 | Ga0373936_0024444 | 3300035113 | Bacteria | 2359 |
| 419 | Ga0373953_0122611 | 3300035117 | Bacteria | 1105 |
| 420 | Ga0373953_0223088 | 3300035117 | Bacteria | 817 |
| 421 | Ga0373954_0144513 | 3300035118 | Bacteria | 1161 |
| 422 | Ga0373954_0255660 | 3300035118 | Bacteria | 862 |
| 423 | Ga0373956_0624983 | 3300035119 | Bacteria | 514 |
| 424 | Ga0373943_0184512 | 3300035170 | Bacteria | 1148 |
| 425 | Ga0373946_0050344 | 3300035171 | Bacteria | 1740 |
| 426 | Ga0373955_0009589 | 3300035172 | Bacteria | 4543 |
| 427 | Ga0316574_0004214 | 3300035398 | Bacteria | 7499 |
| 428 | Ga0316574_0100816 | 3300035398 | Bacteria | 1848 |
| 429 | Ga0316574_0280881 | 3300035398 | Bacteria | 1060 |
| 430 | Ga0316574_0496866 | 3300035398 | Bacteria | 761 |
| 431 | Ga0316574_0497290 | 3300035398 | Bacteria | 760 |
| 432 | Ga0373927_0000001 | 3300035695 | Bacteria | 1082160 |
| 433 | Ga0373927_0024652 | 3300035695 | Bacteria | 3931 |
| 434 | Ga0373933_0024810 | 3300035724 | Bacteria | 3435 |
| 435 | Ga0373933_0563253 | 3300035724 | Bacteria | 748 |
| 436 | Ga0373937_0033162 | 3300036401 | Bacteria | 4688 |
| 437 | Ga0373937_0100177 | 3300036401 | Bacteria | 2688 |
| 438 | Ga0373937_0606769 | 3300036401 | Bacteria | 1039 |
| 439 | Ga0373937_1249198 | 3300036401 | Bacteria | 691 |
| 440 | Ga0373937_1581660 | 3300036401 | Bacteria | 603 |
| 441 | Ga0316582_0041787 | 3300036647 | Bacteria | 2868 |
| 442 | Ga0316582_0441116 | 3300036647 | Bacteria | 897 |
| 443 | Ga0316582_0993999 | 3300036647 | Bacteria | 573 |
| 444 | Ga0316584_0007920 | 3300036712 | Bacteria | 7291 |
| 445 | Ga0316584_0119501 | 3300036712 | Bacteria | 1970 |
| 446 | Ga0316584_0123095 | 3300036712 | Bacteria | 1937 |
| 447 | Ga0316584_0397858 | 3300036712 | Bacteria | 982 |
| 448 | Ga0316584_0705824 | 3300036712 | Bacteria | 691 |
| 449 | Ga0316584_1102681 | 3300036712 | Bacteria | 527 |
| 450 | Ga0373925_0017486 | 3300037068 | Bacteria | 5198 |
| 451 | Ga0373925_0352726 | 3300037068 | Bacteria | 1195 |
| 452 | Ga0316581_0039519 | 3300037588 | Bacteria | 1436 |
| 453 | Ga0436364_0938232 | 3300037853 | Bacteria | 3043 |
| 454 | Ga0436364_1079144 | 3300037853 | Bacteria | 575 |
| 455 | Ga0400491_16032 | 3300038727 | Bacteria | 1674 |
| 456 | Ga0400483_074789 | 3300039062 | Bacteria | 1145 |
| 457 | Ga0400483_229164 | 3300039062 | Bacteria | 5245 |
| 458 | Ga0436365_0344571 | 3300039437 | Bacteria | 1194 |
| 459 | Ga0436365_0919918 | 3300039437 | Bacteria | 6141 |
| 460 | Ga0436365_1734234 | 3300039437 | Bacteria | 2745 |
| 461 | Ga0436365_1803492 | 3300039437 | Bacteria | 1170 |
| 462 | Ga0436360_1015686 | 3300039438 | Bacteria | 10514 |
| 463 | Ga0436360_1292859 | 3300039438 | Bacteria | 2226 |
| 464 | Ga0436361_0120662 | 3300039447 | Bacteria | 588 |
| 465 | Ga0436361_0159837 | 3300039447 | Bacteria | 808 |
| 466 | Ga0436361_0537095 | 3300039447 | Bacteria | 2680 |
| 467 | Ga0436361_1027302 | 3300039447 | Bacteria | 2845 |
| 468 | Ga0436361_1066456 | 3300039447 | Bacteria | 1157 |
| 469 | Ga0436363_0082299 | 3300039450 | Bacteria | 1129 |
| 470 | Ga0436363_0122034 | 3300039450 | Bacteria | 1257 |
| 471 | Ga0436363_0397597 | 3300039450 | Bacteria | 771 |
| 472 | Ga0436363_0502379 | 3300039450 | Bacteria | 2115 |
| 473 | Ga0436363_0581112 | 3300039450 | Bacteria | 6599 |
| 474 | Ga0436363_0658005 | 3300039450 | Bacteria | 1969 |
| 475 | Ga0436363_1395368 | 3300039450 | Bacteria | 8364 |
| 476 | Ga0436362_0056993 | 3300039453 | Bacteria | 784 |
| 477 | Ga0436362_0580586 | 3300039453 | Bacteria | 3569 |
| 478 | Ga0436362_1153707 | 3300039453 | Bacteria | 741 |
| 479 | Ga0439461_0208873 | 3300041410 | Bacteria | 528 |
| 480 | Ga0451807_0242516 | 3300041486 | Bacteria | 694 |
| 481 | Ga0451807_1950251 | 3300041486 | Bacteria | 1012 |
| 482 | Ga0451837_1278518 | 3300041494 | Bacteria | 1685 |
| 483 | Ga0451839_1122753 | 3300041496 | Bacteria | 663 |
| 484 | Ga0451577_0044972 | 3300042876 | Bacteria | 3951 |
| 485 | Ga0451577_0687840 | 3300042876 | Bacteria | 927 |
| 486 | Ga0466969_0045492 | 3300044656 | Bacteria | 2179 |
| 487 | Ga0453683_0115177 | 3300044673 | Bacteria | 1691 |
| 488 | Ga0453684_0302454 | 3300044712 | Bacteria | 1817 |
| 489 | Ga0453684_0363767 | 3300044712 | Bacteria | 1628 |
| 490 | Ga0453684_2277349 | 3300044712 | Bacteria | 539 |
| 491 | Ga0466970_0710502 | 3300044765 | Unclassified | 586 |
| 492 | Ga0466959_0118566 | 3300045049 | Bacteria | 1883 |
| 493 | Ga0466959_0419556 | 3300045049 | Bacteria | 908 |
| 494 | Ga0451576_0027268 | 3300045051 | Bacteria | 6136 |
| 495 | Ga0451576_0046467 | 3300045051 | Bacteria | 4571 |
| 496 | Ga0451576_1437657 | 3300045051 | Bacteria | 717 |
| 497 | Ga0466958_1083395 | 3300045836 | Unclassified | 523 |
| 498 | Ga0495592_0692973 | 3300046454 | Bacteria | 613 |
| 499 | Ga0495629_0306552 | 3300046459 | Bacteria | 1087 |
| 500 | Ga0495638_0035712 | 3300046460 | Bacteria | 3167 |
| 501 | Ga0495651_0292860 | 3300046462 | Bacteria | 1095 |
| 502 | Ga0495580_0008063 | 3300046472 | Bacteria | 8404 |
| 503 | Ga0495580_0018491 | 3300046472 | Bacteria | 5189 |
| 504 | Ga0495580_0699807 | 3300046472 | Bacteria | 663 |
| 505 | Ga0495582_0599047 | 3300046473 | Bacteria | 638 |
| 506 | Ga0495639_0243221 | 3300046475 | Bacteria | 888 |
| 507 | Ga0495662_0103530 | 3300046476 | Bacteria | 1393 |
| 508 | Ga0495606_0122533 | 3300046507 | Bacteria | 1554 |
| 509 | Ga0495608_0379504 | 3300046511 | Bacteria | 867 |
| 510 | Ga0495608_0787034 | 3300046511 | Bacteria | 562 |
| 511 | Ga0495616_0257846 | 3300046513 | Bacteria | 747 |
| 512 | Ga0495620_0179583 | 3300046515 | Bacteria | 819 |
| 513 | Ga0495628_0070403 | 3300046516 | Bacteria | 2727 |
| 514 | Ga0495630_0359276 | 3300046517 | Unclassified | 1115 |
| 515 | Ga0495632_0066473 | 3300046519 | Bacteria | 1740 |
| 516 | Ga0495648_0322295 | 3300046524 | Bacteria | 716 |
| 517 | Ga0495665_0048657 | 3300046531 | Bacteria | 2248 |
| 518 | Ga0495640_0528408 | 3300046533 | Bacteria | 716 |
| 519 | Ga0495586_0025330 | 3300046535 | Bacteria | 3174 |
| 520 | Ga0495587_0011965 | 3300046536 | Bacteria | 5485 |
| 521 | Ga0495587_0191151 | 3300046536 | Bacteria | 1159 |
| 522 | Ga0495609_0060384 | 3300046538 | Bacteria | 1676 |
| 523 | Ga0495645_0305479 | 3300046543 | Bacteria | 1038 |
| 524 | Ga0495668_0210018 | 3300046616 | Unclassified | 1066 |
| 525 | Ga0495634_0264579 | 3300046642 | Bacteria | 1048 |
| 526 | Ga0495625_0009758 | 3300046660 | Bacteria | 7989 |
| 527 | Ga0495625_0427819 | 3300046660 | Bacteria | 822 |
| 528 | Ga0495657_0568867 | 3300046675 | Bacteria | 657 |
| 529 | Ga0495646_0582992 | 3300046680 | Bacteria | 569 |
| 530 | Ga0495658_0106897 | 3300046683 | Bacteria | 1678 |
| 531 | Ga0495669_0179142 | 3300046684 | Bacteria | 1010 |
| 532 | Ga0495671_0565932 | 3300046692 | Bacteria | 541 |
| 533 | Ga0495604_0267750 | 3300047317 | Bacteria | 1159 |
| 534 | Ga0495674_0058164 | 3300047319 | Bacteria | 3381 |
| 535 | Ga0495687_107510 | 3300047443 | Bacteria | 1033 |
| 536 | Ga0495687_179240 | 3300047443 | Bacteria | 693 |
| 537 | Ga0495675_0301952 | 3300047444 | Bacteria | 951 |
| 538 | Ga0495681_0128683 | 3300047470 | Bacteria | 1080 |
| 539 | Ga0495684_0498758 | 3300047471 | Bacteria | 837 |
| 540 | Ga0495686_0319465 | 3300047472 | Bacteria | 851 |
| 541 | Ga0496100_0098204 | 3300048903 | Bacteria | 2012 |
| 542 | Ga0496100_0281525 | 3300048903 | Bacteria | 1240 |
| 543 | Ga0496101_0042578 | 3300048904 | Bacteria | 3241 |
| 544 | Ga0496101_0276487 | 3300048904 | Bacteria | 1312 |
| 545 | Ga0496101_0281931 | 3300048904 | Bacteria | 1299 |
| 546 | Ga0496102_0025626 | 3300048905 | Bacteria | 5253 |
| 547 | Ga0496102_0059027 | 3300048905 | Bacteria | 3507 |
| 548 | Ga0496102_0094373 | 3300048905 | Bacteria | 2772 |
| 549 | Ga0496102_0115092 | 3300048905 | Bacteria | 2509 |
| 550 | Ga0496102_0620808 | 3300048905 | Bacteria | 1004 |
| 551 | Ga0496103_0031670 | 3300048906 | Bacteria | 3224 |
| 552 | Ga0496103_0095347 | 3300048906 | Bacteria | 1880 |
| 553 | Ga0496104_0096551 | 3300048907 | Bacteria | 2827 |
| 554 | Ga0496104_0191881 | 3300048907 | Bacteria | 1955 |
| 555 | Ga0496105_0002839 | 3300048908 | Bacteria | 12678 |
| 556 | Ga0496105_0022709 | 3300048908 | Bacteria | 5083 |
| 557 | Ga0496106_0016627 | 3300048909 | Bacteria | 5443 |
| 558 | Ga0496107_0011507 | 3300048910 | Bacteria | 6163 |
| 559 | Ga0496107_0241397 | 3300048910 | Bacteria | 1344 |
| 560 | Ga0496108_0032625 | 3300048911 | Bacteria | 4326 |
| 561 | Ga0496108_0209555 | 3300048911 | Bacteria | 1692 |
| 562 | Ga0496109_0073684 | 3300048912 | Bacteria | 3137 |
| 563 | Ga0496109_0495713 | 3300048912 | Bacteria | 1153 |
| 564 | Ga0496109_0766177 | 3300048912 | Bacteria | 903 |
| 565 | Ga0496110_0011389 | 3300048913 | Bacteria | 7277 |
| 566 | Ga0496111_0705589 | 3300048914 | Bacteria | 734 |
| 567 | Ga0496112_0066822 | 3300048915 | Bacteria | 3548 |
| 568 | Ga0496112_0083617 | 3300048915 | Bacteria | 3157 |
| 569 | Ga0496112_0163655 | 3300048915 | Bacteria | 2191 |
| 570 | Ga0496112_0613009 | 3300048915 | Bacteria | 1020 |
| 571 | Ga0496114_0003309 | 3300048917 | Bacteria | 12378 |
| 572 | Ga0496114_0296529 | 3300048917 | Bacteria | 1427 |
| 573 | Ga0496114_0545324 | 3300048917 | Bacteria | 1025 |
| 574 | Ga0496115_0004612 | 3300048918 | Bacteria | 9979 |
| 575 | Ga0496115_0019223 | 3300048918 | Bacteria | 5255 |
| 576 | Ga0496115_0534042 | 3300048918 | Bacteria | 939 |
| 577 | Ga0496116_0003851 | 3300048919 | Bacteria | 14645 |
| 578 | Ga0496117_0000229 | 3300048920 | Bacteria | 105861 |
| 579 | Ga0496118_0000016 | 3300048921 | Bacteria | 549586 |
| 580 | Ga0496118_0007348 | 3300048921 | Bacteria | 11715 |
| 581 | Ga0496119_0006549 | 3300048922 | Bacteria | 10742 |
| 582 | Ga0496119_0010886 | 3300048922 | Bacteria | 7601 |
| 583 | Ga0496120_0000839 | 3300048923 | Bacteria | 43743 |
| 584 | Ga0496120_0023961 | 3300048923 | Bacteria | 3812 |
| 585 | Ga0496121_0007867 | 3300048924 | Bacteria | 12750 |
| 586 | Ga0496121_0070321 | 3300048924 | Bacteria | 2820 |
| 587 | Ga0496124_0017163 | 3300048927 | Bacteria | 6839 |
| 588 | Ga0496124_0534111 | 3300048927 | Bacteria | 778 |
| 589 | Ga0496125_0000353 | 3300048928 | Bacteria | 86674 |
| 590 | Ga0496125_0020465 | 3300048928 | Bacteria | 6210 |
| 591 | Ga0496126_0002458 | 3300048929 | Bacteria | 24978 |
| 592 | Ga0496126_0047696 | 3300048929 | Bacteria | 3921 |
| 593 | Ga0496126_0255807 | 3300048929 | Bacteria | 1458 |
| 594 | Ga0495682_0364352 | 3300049460 | Bacteria | 509 |
| 595 | Ga0501032_0650307 | 3300049569 | Bacteria | 669 |
| 596 | Ga0501033_0195330 | 3300049570 | Bacteria | 1447 |
| 597 | Ga0501033_0671763 | 3300049570 | Bacteria | 706 |
| 598 | Ga0501036_0003616 | 3300049572 | Bacteria | 12361 |
| 599 | Ga0501036_0048011 | 3300049572 | Bacteria | 3615 |
| 600 | Ga0501037_0352710 | 3300049573 | Bacteria | 1015 |
| 601 | Ga0501037_0385669 | 3300049573 | Bacteria | 962 |
| 602 | Ga0501038_0002930 | 3300049574 | Bacteria | 15918 |
| 603 | Ga0501038_0976909 | 3300049574 | Bacteria | 622 |
| 604 | Ga0501039_0032408 | 3300049575 | Bacteria | 4029 |
| 605 | Ga0501040_0005143 | 3300049576 | Bacteria | 8461 |
| 606 | Ga0501040_0127859 | 3300049576 | Bacteria | 1785 |
| 607 | Ga0501041_0001297 | 3300049577 | Bacteria | 13757 |
| 608 | Ga0501041_0144725 | 3300049577 | Bacteria | 1483 |
| 609 | Ga0501042_0000439 | 3300049578 | Bacteria | 21222 |
| 610 | Ga0501042_0191473 | 3300049578 | Bacteria | 1475 |
| 611 | Ga0501042_0194922 | 3300049578 | Bacteria | 1461 |
| 612 | Ga0501042_0198644 | 3300049578 | Bacteria | 1446 |
| 613 | Ga0501043_0114979 | 3300049579 | Bacteria | 2112 |
| 614 | Ga0501046_0034962 | 3300049580 | Bacteria | 4051 |
| 615 | Ga0501046_0063947 | 3300049580 | Bacteria | 2873 |
| 616 | Ga0501047_0180441 | 3300049581 | Bacteria | 1978 |
| 617 | Ga0501048_0003706 | 3300049582 | Bacteria | 11642 |
| 618 | Ga0501048_0455787 | 3300049582 | Bacteria | 916 |
| 619 | Ga0501068_0021610 | 3300049584 | Bacteria | 3759 |
| 620 | Ga0501068_0833571 | 3300049584 | Bacteria | 605 |
| 621 | Ga0501070_0895749 | 3300049586 | Bacteria | 692 |
| 622 | Ga0501071_0001933 | 3300049587 | Bacteria | 12343 |
| 623 | Ga0501071_1301684 | 3300049587 | Bacteria | 561 |
| 624 | Ga0501072_0001847 | 3300049588 | Bacteria | 15766 |
| 625 | Ga0501072_0376478 | 3300049588 | Bacteria | 1126 |
| 626 | Ga0501075_0014371 | 3300049591 | Bacteria | 5671 |
| 627 | Ga0501076_0035786 | 3300049592 | Bacteria | 3885 |
| 628 | Ga0501076_0094154 | 3300049592 | Bacteria | 2412 |
| 629 | Ga0501076_0104895 | 3300049592 | Bacteria | 2281 |
| 630 | Ga0501076_0257786 | 3300049592 | Bacteria | 1427 |
| 631 | Ga0501077_0005786 | 3300049593 | Bacteria | 7531 |
| 632 | Ga0501230_033332 | 3300049667 | Bacteria | 970 |
| 633 | Ga0501235_041491 | 3300049669 | Bacteria | 1053 |
| 634 | Ga0501236_052909 | 3300049670 | Bacteria | 702 |
| 635 | Ga0501079_0115180 | 3300049741 | Bacteria | 2089 |
| 636 | Ga0501079_0830511 | 3300049741 | Bacteria | 728 |
| 637 | Ga0501080_0558138 | 3300049742 | Bacteria | 1019 |
| 638 | Ga0501080_0641415 | 3300049742 | Bacteria | 940 |
| 639 | Ga0501081_0008365 | 3300049743 | Bacteria | 6714 |
| 640 | Ga0501035_0009197 | 3300049822 | Bacteria | 9187 |
| 641 | Ga0501044_1120227 | 3300049823 | Bacteria | 656 |
| 642 | Ga0501045_0002981 | 3300049824 | Bacteria | 11579 |
| 643 | Ga0501045_0021552 | 3300049824 | Bacteria | 4610 |
| 644 | Ga0501045_0610145 | 3300049824 | Bacteria | 808 |
| 645 | nmdc:mga0qj67_798761_c1 | 3300050509 | Bacteria | 747 |
| 646 | nmdc:mga0rr50_1435996_c1 | 3300050513 | Bacteria | 584 |
| 647 | nmdc:mga08x19_227697_c1 | 3300050514 | Bacteria | 1282 |
| 648 | Ga0495601_0491163 | 3300053077 | Bacteria | 793 |
| 649 | Ga0495601_0692188 | 3300053077 | Bacteria | 651 |
| 650 | Ga0500583_0143337 | 3300053092 | Bacteria | 1188 |
| 651 | Ga0500556_0000435 | 3300053104 | Bacteria | 29836 |
| 652 | Ga0500595_085442 | 3300053119 | Bacteria | 919 |
| 653 | Ga0500559_0105731 | 3300053136 | Bacteria | 1301 |
| 654 | Ga0500639_093651 | 3300053163 | Bacteria | 1492 |
| 655 | Ga0500636_0293846 | 3300053177 | Bacteria | 804 |
| 656 | Ga0500637_0027480 | 3300053178 | Bacteria | 3142 |
| 657 | Ga0500637_0228468 | 3300053178 | Bacteria | 1049 |
| 658 | Ga0501084_0156561 | 3300054114 | Bacteria | 1921 |
| 659 | Ga0501082_0003701 | 3300060353 | Bacteria | 13355 |
| 660 | Ga0501082_0996662 | 3300060353 | Bacteria | 733 |
| 661 | Ga0530510_0016026 | 3300061734 | Bacteria | 5297 |
| 662 | Ga0530510_0024869 | 3300061734 | Bacteria | 4279 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003323 | rootH1_10007647 | rootH1_1000764742 | 122 |
| 2 | 3300037588 | Ga0316581_0039519 | Ga0316581_0039519_915_1286 | 122 |
| 3 | 3300049667 | Ga0501230_033332 | Ga0501230_033332_218_586 | 122 |
| 4 | 3300049669 | Ga0501235_041491 | Ga0501235_041491_387_755 | 122 |
| 5 | 3300035113 | Ga0373936_0024444 | Ga0373936_0024444_834_1244 | 123 |
| 6 | 3300035398 | Ga0316574_0100816 | Ga0316574_0100816_1355_1726 | 123 |
| 7 | 3300005435 | Ga0070714_100001058 | Ga0070714_10000105812 | 125 |
| 8 | 3300007788 | Ga0099795_10000053 | Ga0099795_1000005323 | 125 |
| 9 | 3300010159 | Ga0099796_10000096 | Ga0099796_100000969 | 125 |
| 10 | 3300013306 | Ga0163162_12193624 | Ga0163162_121936241 | 125 |
| 11 | 3300025906 | Ga0207699_10023052 | Ga0207699_100230522 | 125 |
| 12 | 3300025916 | Ga0207663_10032699 | Ga0207663_100326994 | 125 |
| 13 | 3300025929 | Ga0207664_10000874 | Ga0207664_1000087413 | 125 |
| 14 | 3300027512 | Ga0209179_1000082 | Ga0209179_100008210 | 125 |
| 15 | 3300028558 | Ga0265326_10012329 | Ga0265326_100123293 | 125 |
| 16 | 3300028573 | Ga0265334_10000008 | Ga0265334_10000008169 | 125 |
| 17 | 3300031241 | Ga0265325_10097684 | Ga0265325_100976842 | 125 |
| 18 | 3300031507 | Ga0307509_10957217 | Ga0307509_109572172 | 125 |
| 19 | 3300031595 | Ga0265313_10000076 | Ga0265313_1000007630 | 125 |
| 20 | 3300033180 | Ga0307510_10136839 | Ga0307510_101368392 | 125 |
| 21 | 3300035724 | Ga0373933_0563253 | Ga0373933_0563253_278_655 | 125 |
| 22 | 3300036401 | Ga0373937_1249198 | Ga0373937_1249198_108_485 | 125 |
| 23 | 3300039447 | Ga0436361_0120662 | Ga0436361_0120662_173_550 | 125 |
| 24 | 3300048904 | Ga0496101_0281931 | Ga0496101_0281931_237_614 | 125 |
| 25 | 3300048908 | Ga0496105_0002839 | Ga0496105_0002839_5073_5450 | 125 |
| 26 | 3300048910 | Ga0496107_0241397 | Ga0496107_0241397_361_738 | 125 |
| 27 | 3300048918 | Ga0496115_0019223 | Ga0496115_0019223_507_884 | 125 |
| 28 | 3300003316 | rootH1_10068542 | rootH1_100685422 | 126 |
| 29 | 3300003322 | rootL2_10097826 | rootL2_100978265 | 126 |
| 30 | 3300003323 | rootH1_10058373 | rootH1_100583735 | 126 |
| 31 | 3300005293 | Ga0065715_10274377 | Ga0065715_102743771 | 126 |
| 32 | 3300005293 | Ga0065715_10546729 | Ga0065715_105467292 | 126 |
| 33 | 3300005329 | Ga0070683_100056107 | Ga0070683_1000561073 | 126 |
| 34 | 3300005330 | Ga0070690_100021042 | Ga0070690_1000210424 | 126 |
| 35 | 3300005331 | Ga0070670_100369788 | Ga0070670_1003697882 | 126 |
| 36 | 3300005334 | Ga0068869_100651659 | Ga0068869_1006516592 | 126 |
| 37 | 3300005334 | Ga0068869_101533201 | Ga0068869_1015332012 | 126 |
| 38 | 3300005335 | Ga0070666_10000496 | Ga0070666_1000049620 | 126 |
| 39 | 3300005335 | Ga0070666_10474594 | Ga0070666_104745942 | 126 |
| 40 | 3300005335 | Ga0070666_10510933 | Ga0070666_105109332 | 126 |
| 41 | 3300005336 | Ga0070680_100085388 | Ga0070680_1000853883 | 126 |
| 42 | 3300005337 | Ga0070682_100017839 | Ga0070682_1000178393 | 126 |
| 43 | 3300005337 | Ga0070682_100041944 | Ga0070682_1000419443 | 126 |
| 44 | 3300005338 | Ga0068868_100013762 | Ga0068868_1000137627 | 126 |
| 45 | 3300005344 | Ga0070661_100468504 | Ga0070661_1004685041 | 126 |
| 46 | 3300005345 | Ga0070692_10565581 | Ga0070692_105655812 | 126 |
| 47 | 3300005354 | Ga0070675_100069351 | Ga0070675_1000693513 | 126 |
| 48 | 3300005355 | Ga0070671_100006552 | Ga0070671_1000065524 | 126 |
| 49 | 3300005355 | Ga0070671_100009932 | Ga0070671_1000099322 | 126 |
| 50 | 3300005355 | Ga0070671_100087408 | Ga0070671_1000874082 | 126 |
| 51 | 3300005364 | Ga0070673_100079390 | Ga0070673_1000793903 | 126 |
| 52 | 3300005367 | Ga0070667_100000008 | Ga0070667_10000000870 | 126 |
| 53 | 3300005367 | Ga0070667_100006624 | Ga0070667_1000066247 | 126 |
| 54 | 3300005367 | Ga0070667_100012080 | Ga0070667_1000120804 | 126 |
| 55 | 3300005434 | Ga0070709_10054960 | Ga0070709_100549604 | 126 |
| 56 | 3300005434 | Ga0070709_10065831 | Ga0070709_100658314 | 126 |
| 57 | 3300005434 | Ga0070709_10899790 | Ga0070709_108997901 | 126 |
| 58 | 3300005434 | Ga0070709_10899850 | Ga0070709_108998502 | 126 |
| 59 | 3300005435 | Ga0070714_100010004 | Ga0070714_1000100046 | 126 |
| 60 | 3300005435 | Ga0070714_101188271 | Ga0070714_1011882711 | 126 |
| 61 | 3300005435 | Ga0070714_101327145 | Ga0070714_1013271451 | 126 |
| 62 | 3300005436 | Ga0070713_100008095 | Ga0070713_1000080954 | 126 |
| 63 | 3300005436 | Ga0070713_100059740 | Ga0070713_1000597405 | 126 |
| 64 | 3300005436 | Ga0070713_100295524 | Ga0070713_1002955241 | 126 |
| 65 | 3300005437 | Ga0070710_10021966 | Ga0070710_100219663 | 126 |
| 66 | 3300005437 | Ga0070710_10644757 | Ga0070710_106447572 | 126 |
| 67 | 3300005439 | Ga0070711_100002891 | Ga0070711_1000028917 | 126 |
| 68 | 3300005439 | Ga0070711_100066663 | Ga0070711_1000666632 | 126 |
| 69 | 3300005439 | Ga0070711_100433988 | Ga0070711_1004339882 | 126 |
| 70 | 3300005455 | Ga0070663_100905617 | Ga0070663_1009056172 | 126 |
| 71 | 3300005456 | Ga0070678_100026325 | Ga0070678_1000263253 | 126 |
| 72 | 3300005456 | Ga0070678_100071437 | Ga0070678_1000714373 | 126 |
| 73 | 3300005457 | Ga0070662_100215378 | Ga0070662_1002153783 | 126 |
| 74 | 3300005458 | Ga0070681_10172655 | Ga0070681_101726553 | 126 |
| 75 | 3300005466 | Ga0070685_10259888 | Ga0070685_102598882 | 126 |
| 76 | 3300005466 | Ga0070685_10681015 | Ga0070685_106810152 | 126 |
| 77 | 3300005468 | Ga0070707_101909595 | Ga0070707_1019095952 | 126 |
| 78 | 3300005530 | Ga0070679_100026728 | Ga0070679_1000267286 | 126 |
| 79 | 3300005535 | Ga0070684_100223202 | Ga0070684_1002232022 | 126 |
| 80 | 3300005539 | Ga0068853_100715760 | Ga0068853_1007157602 | 126 |
| 81 | 3300005543 | Ga0070672_100283766 | Ga0070672_1002837662 | 126 |
| 82 | 3300005544 | Ga0070686_100009034 | Ga0070686_1000090344 | 126 |
| 83 | 3300005544 | Ga0070686_101254600 | Ga0070686_1012546002 | 126 |
| 84 | 3300005545 | Ga0070695_100489788 | Ga0070695_1004897882 | 126 |
| 85 | 3300005546 | Ga0070696_100029592 | Ga0070696_1000295923 | 126 |
| 86 | 3300005546 | Ga0070696_100833338 | Ga0070696_1008333382 | 126 |
| 87 | 3300005547 | Ga0070693_100086897 | Ga0070693_1000868972 | 126 |
| 88 | 3300005548 | Ga0070665_100000509 | Ga0070665_10000050930 | 126 |
| 89 | 3300005548 | Ga0070665_100012054 | Ga0070665_1000120549 | 126 |
| 90 | 3300005548 | Ga0070665_100016149 | Ga0070665_1000161492 | 126 |
| 91 | 3300005548 | Ga0070665_100052877 | Ga0070665_1000528773 | 126 |
| 92 | 3300005548 | Ga0070665_100559379 | Ga0070665_1005593792 | 126 |
| 93 | 3300005548 | Ga0070665_100673819 | Ga0070665_1006738192 | 126 |
| 94 | 3300005548 | Ga0070665_100825421 | Ga0070665_1008254211 | 126 |
| 95 | 3300005548 | Ga0070665_101789584 | Ga0070665_1017895841 | 126 |
| 96 | 3300005549 | Ga0070704_100056014 | Ga0070704_1000560145 | 126 |
| 97 | 3300005549 | Ga0070704_100069596 | Ga0070704_1000695962 | 126 |
| 98 | 3300005563 | Ga0068855_100009767 | Ga0068855_1000097677 | 126 |
| 99 | 3300005563 | Ga0068855_100455056 | Ga0068855_1004550563 | 126 |
| 100 | 3300005577 | Ga0068857_100093293 | Ga0068857_1000932932 | 126 |
| 101 | 3300005577 | Ga0068857_101972854 | Ga0068857_1019728541 | 126 |
| 102 | 3300005578 | Ga0068854_100610584 | Ga0068854_1006105842 | 126 |
| 103 | 3300005614 | Ga0068856_100061084 | Ga0068856_1000610845 | 126 |
| 104 | 3300005614 | Ga0068856_100153668 | Ga0068856_1001536682 | 126 |
| 105 | 3300005614 | Ga0068856_100336918 | Ga0068856_1003369183 | 126 |
| 106 | 3300005617 | Ga0068859_100045726 | Ga0068859_1000457264 | 126 |
| 107 | 3300005617 | Ga0068859_100115509 | Ga0068859_1001155094 | 126 |
| 108 | 3300005618 | Ga0068864_100357948 | Ga0068864_1003579482 | 126 |
| 109 | 3300005618 | Ga0068864_101531421 | Ga0068864_1015314212 | 126 |
| 110 | 3300005718 | Ga0068866_10279753 | Ga0068866_102797531 | 126 |
| 111 | 3300005719 | Ga0068861_100216007 | Ga0068861_1002160073 | 126 |
| 112 | 3300005834 | Ga0068851_10391698 | Ga0068851_103916982 | 126 |
| 113 | 3300005840 | Ga0068870_10658442 | Ga0068870_106584422 | 126 |
| 114 | 3300005841 | Ga0068863_100002484 | Ga0068863_1000024849 | 126 |
| 115 | 3300005841 | Ga0068863_100006983 | Ga0068863_1000069837 | 126 |
| 116 | 3300005841 | Ga0068863_100061192 | Ga0068863_1000611922 | 126 |
| 117 | 3300005841 | Ga0068863_100115021 | Ga0068863_1001150213 | 126 |
| 118 | 3300005842 | Ga0068858_100000598 | Ga0068858_10000059825 | 126 |
| 119 | 3300005842 | Ga0068858_100002641 | Ga0068858_10000264111 | 126 |
| 120 | 3300005842 | Ga0068858_100009281 | Ga0068858_1000092816 | 126 |
| 121 | 3300005843 | Ga0068860_100000771 | Ga0068860_10000077124 | 126 |
| 122 | 3300005843 | Ga0068860_100088174 | Ga0068860_1000881744 | 126 |
| 123 | 3300005844 | Ga0068862_100007748 | Ga0068862_1000077485 | 126 |
| 124 | 3300005844 | Ga0068862_101141804 | Ga0068862_1011418042 | 126 |
| 125 | 3300005844 | Ga0068862_102788672 | Ga0068862_1027886722 | 126 |
| 126 | 3300006028 | Ga0070717_10186734 | Ga0070717_101867342 | 126 |
| 127 | 3300006163 | Ga0070715_10000669 | Ga0070715_100006697 | 126 |
| 128 | 3300006173 | Ga0070716_100001421 | Ga0070716_1000014213 | 126 |
| 129 | 3300006173 | Ga0070716_100002786 | Ga0070716_1000027869 | 126 |
| 130 | 3300006173 | Ga0070716_100867530 | Ga0070716_1008675302 | 126 |
| 131 | 3300006175 | Ga0070712_100000683 | Ga0070712_10000068310 | 126 |
| 132 | 3300006175 | Ga0070712_100085173 | Ga0070712_1000851732 | 126 |
| 133 | 3300006175 | Ga0070712_100097881 | Ga0070712_1000978813 | 126 |
| 134 | 3300006237 | Ga0097621_100009247 | Ga0097621_1000092476 | 126 |
| 135 | 3300006237 | Ga0097621_100111692 | Ga0097621_1001116922 | 126 |
| 136 | 3300006237 | Ga0097621_100136303 | Ga0097621_1001363031 | 126 |
| 137 | 3300006358 | Ga0068871_100015422 | Ga0068871_1000154227 | 126 |
| 138 | 3300006358 | Ga0068871_100029484 | Ga0068871_1000294843 | 126 |
| 139 | 3300006358 | Ga0068871_100177815 | Ga0068871_1001778152 | 126 |
| 140 | 3300006846 | Ga0075430_101069096 | Ga0075430_1010690961 | 126 |
| 141 | 3300006881 | Ga0068865_100009034 | Ga0068865_1000090347 | 126 |
| 142 | 3300006881 | Ga0068865_100454400 | Ga0068865_1004544002 | 126 |
| 143 | 3300006931 | Ga0097620_100045727 | Ga0097620_1000457274 | 126 |
| 144 | 3300006931 | Ga0097620_100115501 | Ga0097620_1001155014 | 126 |
| 145 | 3300007076 | Ga0075435_101133228 | Ga0075435_1011332282 | 126 |
| 146 | 3300007265 | Ga0099794_10178257 | Ga0099794_101782572 | 126 |
| 147 | 3300007788 | Ga0099795_10028291 | Ga0099795_100282912 | 126 |
| 148 | 3300009092 | Ga0105250_10016067 | Ga0105250_100160672 | 126 |
| 149 | 3300009093 | Ga0105240_10008483 | Ga0105240_1000848310 | 126 |
| 150 | 3300009093 | Ga0105240_10015651 | Ga0105240_100156514 | 126 |
| 151 | 3300009093 | Ga0105240_10038444 | Ga0105240_100384446 | 126 |
| 152 | 3300009093 | Ga0105240_10045312 | Ga0105240_100453126 | 126 |
| 153 | 3300009093 | Ga0105240_10073560 | Ga0105240_100735605 | 126 |
| 154 | 3300009093 | Ga0105240_10092604 | Ga0105240_100926041 | 126 |
| 155 | 3300009093 | Ga0105240_10459398 | Ga0105240_104593983 | 126 |
| 156 | 3300009093 | Ga0105240_10491127 | Ga0105240_104911272 | 126 |
| 157 | 3300009093 | Ga0105240_10981577 | Ga0105240_109815772 | 126 |
| 158 | 3300009098 | Ga0105245_10005446 | Ga0105245_100054467 | 126 |
| 159 | 3300009101 | Ga0105247_10000091 | Ga0105247_100000918 | 126 |
| 160 | 3300009101 | Ga0105247_10008379 | Ga0105247_100083794 | 126 |
| 161 | 3300009101 | Ga0105247_10016824 | Ga0105247_100168246 | 126 |
| 162 | 3300009148 | Ga0105243_10333340 | Ga0105243_103333402 | 126 |
| 163 | 3300009174 | Ga0105241_10009602 | Ga0105241_100096027 | 126 |
| 164 | 3300009174 | Ga0105241_10467969 | Ga0105241_104679693 | 126 |
| 165 | 3300009176 | Ga0105242_10000422 | Ga0105242_1000042211 | 126 |
| 166 | 3300009177 | Ga0105248_10008369 | Ga0105248_100083693 | 126 |
| 167 | 3300009177 | Ga0105248_10054897 | Ga0105248_100548973 | 126 |
| 168 | 3300009177 | Ga0105248_10287866 | Ga0105248_102878662 | 126 |
| 169 | 3300009177 | Ga0105248_10678430 | Ga0105248_106784302 | 126 |
| 170 | 3300009177 | Ga0105248_11905637 | Ga0105248_119056372 | 126 |
| 171 | 3300009177 | Ga0105248_12041989 | Ga0105248_120419892 | 126 |
| 172 | 3300009545 | Ga0105237_10013318 | Ga0105237_100133182 | 126 |
| 173 | 3300009545 | Ga0105237_10125028 | Ga0105237_101250283 | 126 |
| 174 | 3300009545 | Ga0105237_10161390 | Ga0105237_101613902 | 126 |
| 175 | 3300009545 | Ga0105237_10293186 | Ga0105237_102931862 | 126 |
| 176 | 3300009545 | Ga0105237_10561974 | Ga0105237_105619742 | 126 |
| 177 | 3300009545 | Ga0105237_10564881 | Ga0105237_105648812 | 126 |
| 178 | 3300009545 | Ga0105237_10818779 | Ga0105237_108187792 | 126 |
| 179 | 3300009551 | Ga0105238_10115276 | Ga0105238_101152762 | 126 |
| 180 | 3300009551 | Ga0105238_10301421 | Ga0105238_103014212 | 126 |
| 181 | 3300009551 | Ga0105238_10395259 | Ga0105238_103952593 | 126 |
| 182 | 3300009551 | Ga0105238_10506396 | Ga0105238_105063961 | 126 |
| 183 | 3300009551 | Ga0105238_10600600 | Ga0105238_106006002 | 126 |
| 184 | 3300009551 | Ga0105238_11958410 | Ga0105238_119584102 | 126 |
| 185 | 3300009553 | Ga0105249_10040291 | Ga0105249_100402916 | 126 |
| 186 | 3300009553 | Ga0105249_10078018 | Ga0105249_100780182 | 126 |
| 187 | 3300009553 | Ga0105249_10327642 | Ga0105249_103276423 | 126 |
| 188 | 3300010159 | Ga0099796_10000234 | Ga0099796_100002342 | 126 |
| 189 | 3300010159 | Ga0099796_10000788 | Ga0099796_100007885 | 126 |
| 190 | 3300010159 | Ga0099796_10081714 | Ga0099796_100817142 | 126 |
| 191 | 3300010375 | Ga0105239_10008715 | Ga0105239_100087159 | 126 |
| 192 | 3300010375 | Ga0105239_10263262 | Ga0105239_102632623 | 126 |
| 193 | 3300010375 | Ga0105239_11034085 | Ga0105239_110340851 | 126 |
| 194 | 3300011119 | Ga0105246_10623892 | Ga0105246_106238922 | 126 |
| 195 | 3300011119 | Ga0105246_11194654 | Ga0105246_111946542 | 126 |
| 196 | 3300013104 | Ga0157370_10474616 | Ga0157370_104746162 | 126 |
| 197 | 3300013105 | Ga0157369_10117693 | Ga0157369_101176934 | 126 |
| 198 | 3300013105 | Ga0157369_11435456 | Ga0157369_114354561 | 126 |
| 199 | 3300013296 | Ga0157374_10001660 | Ga0157374_1000166013 | 126 |
| 200 | 3300013296 | Ga0157374_11157299 | Ga0157374_111572992 | 126 |
| 201 | 3300013296 | Ga0157374_12556355 | Ga0157374_125563551 | 126 |
| 202 | 3300013297 | Ga0157378_10002030 | Ga0157378_1000203011 | 126 |
| 203 | 3300013306 | Ga0163162_10009296 | Ga0163162_100092965 | 126 |
| 204 | 3300013306 | Ga0163162_10217056 | Ga0163162_102170563 | 126 |
| 205 | 3300013306 | Ga0163162_10290810 | Ga0163162_102908103 | 126 |
| 206 | 3300013307 | Ga0157372_10386511 | Ga0157372_103865113 | 126 |
| 207 | 3300013307 | Ga0157372_11172816 | Ga0157372_111728161 | 126 |
| 208 | 3300013308 | Ga0157375_10037041 | Ga0157375_100370412 | 126 |
| 209 | 3300013308 | Ga0157375_11195254 | Ga0157375_111952541 | 126 |
| 210 | 3300014325 | Ga0163163_10024106 | Ga0163163_100241064 | 126 |
| 211 | 3300014325 | Ga0163163_10026466 | Ga0163163_100264666 | 126 |
| 212 | 3300014325 | Ga0163163_10156437 | Ga0163163_101564372 | 126 |
| 213 | 3300014325 | Ga0163163_10529621 | Ga0163163_105296212 | 126 |
| 214 | 3300014325 | Ga0163163_10603908 | Ga0163163_106039082 | 126 |
| 215 | 3300014325 | Ga0163163_11025766 | Ga0163163_110257662 | 126 |
| 216 | 3300014325 | Ga0163163_11494964 | Ga0163163_114949642 | 126 |
| 217 | 3300014326 | Ga0157380_10248974 | Ga0157380_102489743 | 126 |
| 218 | 3300014326 | Ga0157380_10490984 | Ga0157380_104909842 | 126 |
| 219 | 3300014326 | Ga0157380_11260793 | Ga0157380_112607932 | 126 |
| 220 | 3300014968 | Ga0157379_10010805 | Ga0157379_100108058 | 126 |
| 221 | 3300014968 | Ga0157379_10050000 | Ga0157379_100500002 | 126 |
| 222 | 3300014968 | Ga0157379_10105843 | Ga0157379_101058432 | 126 |
| 223 | 3300014968 | Ga0157379_10210143 | Ga0157379_102101433 | 126 |
| 224 | 3300014968 | Ga0157379_10456076 | Ga0157379_104560761 | 126 |
| 225 | 3300014968 | Ga0157379_10549876 | Ga0157379_105498762 | 126 |
| 226 | 3300014969 | Ga0157376_10072368 | Ga0157376_100723685 | 126 |
| 227 | 3300014969 | Ga0157376_10622690 | Ga0157376_106226902 | 126 |
| 228 | 3300014969 | Ga0157376_11143678 | Ga0157376_111436782 | 126 |
| 229 | 3300014969 | Ga0157376_11393544 | Ga0157376_113935442 | 126 |
| 230 | 3300021358 | Ga0213873_10006485 | Ga0213873_100064853 | 126 |
| 231 | 3300021361 | Ga0213872_10089217 | Ga0213872_100892172 | 126 |
| 232 | 3300021377 | Ga0213874_10004025 | Ga0213874_100040255 | 126 |
| 233 | 3300021377 | Ga0213874_10041085 | Ga0213874_100410853 | 126 |
| 234 | 3300021384 | Ga0213876_10119970 | Ga0213876_101199702 | 126 |
| 235 | 3300024227 | Ga0228598_1022414 | Ga0228598_10224142 | 126 |
| 236 | 3300024227 | Ga0228598_1040467 | Ga0228598_10404672 | 126 |
| 237 | 3300025898 | Ga0207692_10106771 | Ga0207692_101067712 | 126 |
| 238 | 3300025898 | Ga0207692_10879259 | Ga0207692_108792592 | 126 |
| 239 | 3300025898 | Ga0207692_11092995 | Ga0207692_110929951 | 126 |
| 240 | 3300025900 | Ga0207710_10000241 | Ga0207710_1000024134 | 126 |
| 241 | 3300025903 | Ga0207680_10062362 | Ga0207680_100623622 | 126 |
| 242 | 3300025903 | Ga0207680_10089478 | Ga0207680_100894782 | 126 |
| 243 | 3300025903 | Ga0207680_10113706 | Ga0207680_101137062 | 126 |
| 244 | 3300025904 | Ga0207647_10232343 | Ga0207647_102323432 | 126 |
| 245 | 3300025905 | Ga0207685_10003015 | Ga0207685_100030152 | 126 |
| 246 | 3300025908 | Ga0207643_10619436 | Ga0207643_106194362 | 126 |
| 247 | 3300025911 | Ga0207654_10123384 | Ga0207654_101233843 | 126 |
| 248 | 3300025911 | Ga0207654_10173594 | Ga0207654_101735941 | 126 |
| 249 | 3300025913 | Ga0207695_10031349 | Ga0207695_100313494 | 126 |
| 250 | 3300025913 | Ga0207695_10034473 | Ga0207695_100344736 | 126 |
| 251 | 3300025913 | Ga0207695_10036099 | Ga0207695_100360991 | 126 |
| 252 | 3300025913 | Ga0207695_10041050 | Ga0207695_100410501 | 126 |
| 253 | 3300025913 | Ga0207695_10056994 | Ga0207695_100569945 | 126 |
| 254 | 3300025913 | Ga0207695_10057161 | Ga0207695_100571615 | 126 |
| 255 | 3300025913 | Ga0207695_10151702 | Ga0207695_101517021 | 126 |
| 256 | 3300025913 | Ga0207695_10620050 | Ga0207695_106200502 | 126 |
| 257 | 3300025914 | Ga0207671_10048805 | Ga0207671_100488052 | 126 |
| 258 | 3300025914 | Ga0207671_10049864 | Ga0207671_100498643 | 126 |
| 259 | 3300025914 | Ga0207671_10142780 | Ga0207671_101427803 | 126 |
| 260 | 3300025914 | Ga0207671_10153228 | Ga0207671_101532282 | 126 |
| 261 | 3300025914 | Ga0207671_10222867 | Ga0207671_102228673 | 126 |
| 262 | 3300025914 | Ga0207671_10398133 | Ga0207671_103981332 | 126 |
| 263 | 3300025915 | Ga0207693_10000226 | Ga0207693_1000022636 | 126 |
| 264 | 3300025915 | Ga0207693_10067112 | Ga0207693_100671123 | 126 |
| 265 | 3300025915 | Ga0207693_10079827 | Ga0207693_100798272 | 126 |
| 266 | 3300025916 | Ga0207663_10018125 | Ga0207663_100181253 | 126 |
| 267 | 3300025917 | Ga0207660_10072608 | Ga0207660_100726083 | 126 |
| 268 | 3300025919 | Ga0207657_11505194 | Ga0207657_115051941 | 126 |
| 269 | 3300025920 | Ga0207649_10419336 | Ga0207649_104193361 | 126 |
| 270 | 3300025921 | Ga0207652_10147649 | Ga0207652_101476493 | 126 |
| 271 | 3300025923 | Ga0207681_11403294 | Ga0207681_114032942 | 126 |
| 272 | 3300025924 | Ga0207694_10269179 | Ga0207694_102691793 | 126 |
| 273 | 3300025924 | Ga0207694_10349415 | Ga0207694_103494151 | 126 |
| 274 | 3300025924 | Ga0207694_10544415 | Ga0207694_105444152 | 126 |
| 275 | 3300025924 | Ga0207694_11290486 | Ga0207694_112904862 | 126 |
| 276 | 3300025925 | Ga0207650_10056637 | Ga0207650_100566373 | 126 |
| 277 | 3300025925 | Ga0207650_10546897 | Ga0207650_105468972 | 126 |
| 278 | 3300025927 | Ga0207687_10052745 | Ga0207687_100527454 | 126 |
| 279 | 3300025928 | Ga0207700_10167822 | Ga0207700_101678222 | 126 |
| 280 | 3300025928 | Ga0207700_10537608 | Ga0207700_105376083 | 126 |
| 281 | 3300025929 | Ga0207664_10015495 | Ga0207664_100154952 | 126 |
| 282 | 3300025929 | Ga0207664_10974918 | Ga0207664_109749182 | 126 |
| 283 | 3300025931 | Ga0207644_10008547 | Ga0207644_100085474 | 126 |
| 284 | 3300025931 | Ga0207644_10020441 | Ga0207644_100204416 | 126 |
| 285 | 3300025931 | Ga0207644_10510840 | Ga0207644_105108402 | 126 |
| 286 | 3300025933 | Ga0207706_10314391 | Ga0207706_103143912 | 126 |
| 287 | 3300025934 | Ga0207686_10059540 | Ga0207686_100595402 | 126 |
| 288 | 3300025935 | Ga0207709_10225783 | Ga0207709_102257832 | 126 |
| 289 | 3300025938 | Ga0207704_10036138 | Ga0207704_100361382 | 126 |
| 290 | 3300025938 | Ga0207704_10344661 | Ga0207704_103446612 | 126 |
| 291 | 3300025939 | Ga0207665_10002356 | Ga0207665_100023564 | 126 |
| 292 | 3300025939 | Ga0207665_10033438 | Ga0207665_100334383 | 126 |
| 293 | 3300025939 | Ga0207665_10751449 | Ga0207665_107514492 | 126 |
| 294 | 3300025940 | Ga0207691_10503296 | Ga0207691_105032962 | 126 |
| 295 | 3300025941 | Ga0207711_10183538 | Ga0207711_101835383 | 126 |
| 296 | 3300025941 | Ga0207711_10455496 | Ga0207711_104554962 | 126 |
| 297 | 3300025941 | Ga0207711_10817891 | Ga0207711_108178911 | 126 |
| 298 | 3300025942 | Ga0207689_10395332 | Ga0207689_103953322 | 126 |
| 299 | 3300025942 | Ga0207689_11037869 | Ga0207689_110378692 | 126 |
| 300 | 3300025944 | Ga0207661_10204781 | Ga0207661_102047812 | 126 |
| 301 | 3300025945 | Ga0207679_11061650 | Ga0207679_110616502 | 126 |
| 302 | 3300025949 | Ga0207667_10216074 | Ga0207667_102160743 | 126 |
| 303 | 3300025949 | Ga0207667_10978395 | Ga0207667_109783951 | 126 |
| 304 | 3300025960 | Ga0207651_10043010 | Ga0207651_100430102 | 126 |
| 305 | 3300025960 | Ga0207651_10233363 | Ga0207651_102333632 | 126 |
| 306 | 3300025961 | Ga0207712_10051998 | Ga0207712_100519982 | 126 |
| 307 | 3300025961 | Ga0207712_10066477 | Ga0207712_100664774 | 126 |
| 308 | 3300025961 | Ga0207712_10343241 | Ga0207712_103432412 | 126 |
| 309 | 3300025981 | Ga0207640_10086854 | Ga0207640_100868542 | 126 |
| 310 | 3300025986 | Ga0207658_10000030 | Ga0207658_1000003098 | 126 |
| 311 | 3300025986 | Ga0207658_10010121 | Ga0207658_100101214 | 126 |
| 312 | 3300025986 | Ga0207658_10360988 | Ga0207658_103609882 | 126 |
| 313 | 3300025986 | Ga0207658_11162855 | Ga0207658_111628552 | 126 |
| 314 | 3300026023 | Ga0207677_10136030 | Ga0207677_101360303 | 126 |
| 315 | 3300026035 | Ga0207703_10000729 | Ga0207703_1000072914 | 126 |
| 316 | 3300026035 | Ga0207703_10007683 | Ga0207703_100076832 | 126 |
| 317 | 3300026035 | Ga0207703_10040071 | Ga0207703_100400715 | 126 |
| 318 | 3300026035 | Ga0207703_10068599 | Ga0207703_100685993 | 126 |
| 319 | 3300026035 | Ga0207703_10153572 | Ga0207703_101535723 | 126 |
| 320 | 3300026035 | Ga0207703_10921714 | Ga0207703_109217142 | 126 |
| 321 | 3300026067 | Ga0207678_10010212 | Ga0207678_100102129 | 126 |
| 322 | 3300026078 | Ga0207702_10022988 | Ga0207702_100229883 | 126 |
| 323 | 3300026078 | Ga0207702_10158952 | Ga0207702_101589522 | 126 |
| 324 | 3300026078 | Ga0207702_10161499 | Ga0207702_101614993 | 126 |
| 325 | 3300026088 | Ga0207641_10009315 | Ga0207641_100093156 | 126 |
| 326 | 3300026088 | Ga0207641_10107245 | Ga0207641_101072453 | 126 |
| 327 | 3300026089 | Ga0207648_10713900 | Ga0207648_107139002 | 126 |
| 328 | 3300026095 | Ga0207676_10705310 | Ga0207676_107053101 | 126 |
| 329 | 3300026116 | Ga0207674_10286362 | Ga0207674_102863622 | 126 |
| 330 | 3300026116 | Ga0207674_10532590 | Ga0207674_105325902 | 126 |
| 331 | 3300026118 | Ga0207675_100551123 | Ga0207675_1005511231 | 126 |
| 332 | 3300026118 | Ga0207675_100818170 | Ga0207675_1008181702 | 126 |
| 333 | 3300026121 | Ga0207683_10001388 | Ga0207683_1000138816 | 126 |
| 334 | 3300026121 | Ga0207683_10193010 | Ga0207683_101930101 | 126 |
| 335 | 3300026142 | Ga0207698_11005606 | Ga0207698_110056061 | 126 |
| 336 | 3300026142 | Ga0207698_12721621 | Ga0207698_127216211 | 126 |
| 337 | 3300027512 | Ga0209179_1008935 | Ga0209179_10089353 | 126 |
| 338 | 3300027512 | Ga0209179_1028474 | Ga0209179_10284743 | 126 |
| 339 | 3300027671 | Ga0209588_1057613 | Ga0209588_10576131 | 126 |
| 340 | 3300027671 | Ga0209588_1156333 | Ga0209588_11563332 | 126 |
| 341 | 3300028379 | Ga0268266_10000246 | Ga0268266_1000024683 | 126 |
| 342 | 3300028379 | Ga0268266_10002398 | Ga0268266_1000239812 | 126 |
| 343 | 3300028379 | Ga0268266_10020953 | Ga0268266_100209537 | 126 |
| 344 | 3300028379 | Ga0268266_10024656 | Ga0268266_100246567 | 126 |
| 345 | 3300028379 | Ga0268266_10096007 | Ga0268266_100960073 | 126 |
| 346 | 3300028379 | Ga0268266_11375179 | Ga0268266_113751791 | 126 |
| 347 | 3300028379 | Ga0268266_11809325 | Ga0268266_118093251 | 126 |
| 348 | 3300028379 | Ga0268266_12221136 | Ga0268266_122211361 | 126 |
| 349 | 3300028380 | Ga0268265_10005087 | Ga0268265_100050876 | 126 |
| 350 | 3300028381 | Ga0268264_10000102 | Ga0268264_10000102158 | 126 |
| 351 | 3300028381 | Ga0268264_10312907 | Ga0268264_103129072 | 126 |
| 352 | 3300028381 | Ga0268264_10352465 | Ga0268264_103524652 | 126 |
| 353 | 3300028558 | Ga0265326_10030252 | Ga0265326_100302522 | 126 |
| 354 | 3300028563 | Ga0265319_1008703 | Ga0265319_10087033 | 126 |
| 355 | 3300028573 | Ga0265334_10001247 | Ga0265334_100012477 | 126 |
| 356 | 3300028577 | Ga0265318_10000270 | Ga0265318_1000027049 | 126 |
| 357 | 3300028800 | Ga0265338_10072217 | Ga0265338_100722173 | 126 |
| 358 | 3300029957 | Ga0265324_10073170 | Ga0265324_100731701 | 126 |
| 359 | 3300030521 | Ga0307511_10001554 | Ga0307511_100015547 | 126 |
| 360 | 3300030521 | Ga0307511_10009601 | Ga0307511_100096019 | 126 |
| 361 | 3300030521 | Ga0307511_10197524 | Ga0307511_101975242 | 126 |
| 362 | 3300030760 | Ga0265762_1024288 | Ga0265762_10242882 | 126 |
| 363 | 3300030760 | Ga0265762_1035755 | Ga0265762_10357552 | 126 |
| 364 | 3300030760 | Ga0265762_1180486 | Ga0265762_11804862 | 126 |
| 365 | 3300030763 | Ga0265763_1007554 | Ga0265763_10075542 | 126 |
| 366 | 3300031090 | Ga0265760_10296819 | Ga0265760_102968192 | 126 |
| 367 | 3300031090 | Ga0265760_10352984 | Ga0265760_103529842 | 126 |
| 368 | 3300031235 | Ga0265330_10005661 | Ga0265330_100056613 | 126 |
| 369 | 3300031235 | Ga0265330_10389805 | Ga0265330_103898052 | 126 |
| 370 | 3300031238 | Ga0265332_10002814 | Ga0265332_100028145 | 126 |
| 371 | 3300031239 | Ga0265328_10008403 | Ga0265328_100084035 | 126 |
| 372 | 3300031239 | Ga0265328_10097463 | Ga0265328_100974632 | 126 |
| 373 | 3300031239 | Ga0265328_10143577 | Ga0265328_101435772 | 126 |
| 374 | 3300031240 | Ga0265320_10020396 | Ga0265320_100203964 | 126 |
| 375 | 3300031241 | Ga0265325_10005394 | Ga0265325_100053946 | 126 |
| 376 | 3300031242 | Ga0265329_10026312 | Ga0265329_100263122 | 126 |
| 377 | 3300031247 | Ga0265340_10044851 | Ga0265340_100448512 | 126 |
| 378 | 3300031249 | Ga0265339_10014987 | Ga0265339_100149875 | 126 |
| 379 | 3300031250 | Ga0265331_10003147 | Ga0265331_100031476 | 126 |
| 380 | 3300031250 | Ga0265331_10012515 | Ga0265331_100125154 | 126 |
| 381 | 3300031344 | Ga0265316_10057269 | Ga0265316_100572693 | 126 |
| 382 | 3300031456 | Ga0307513_10025617 | Ga0307513_100256175 | 126 |
| 383 | 3300031456 | Ga0307513_10046215 | Ga0307513_100462153 | 126 |
| 384 | 3300031507 | Ga0307509_10000005 | Ga0307509_10000005284 | 126 |
| 385 | 3300031548 | Ga0307408_100814932 | Ga0307408_1008149321 | 126 |
| 386 | 3300031595 | Ga0265313_10000653 | Ga0265313_1000065325 | 126 |
| 387 | 3300031649 | Ga0307514_10202814 | Ga0307514_102028142 | 126 |
| 388 | 3300031665 | Ga0316575_10006773 | Ga0316575_100067734 | 126 |
| 389 | 3300031665 | Ga0316575_10107083 | Ga0316575_101070832 | 126 |
| 390 | 3300031665 | Ga0316575_10149683 | Ga0316575_101496832 | 126 |
| 391 | 3300031691 | Ga0316579_10068564 | Ga0316579_100685643 | 126 |
| 392 | 3300031691 | Ga0316579_10086156 | Ga0316579_100861563 | 126 |
| 393 | 3300031711 | Ga0265314_10013166 | Ga0265314_100131663 | 126 |
| 394 | 3300031712 | Ga0265342_10022958 | Ga0265342_100229585 | 126 |
| 395 | 3300031712 | Ga0265342_10051007 | Ga0265342_100510073 | 126 |
| 396 | 3300031727 | Ga0316576_10000552 | Ga0316576_1000055213 | 126 |
| 397 | 3300031727 | Ga0316576_10003801 | Ga0316576_100038013 | 126 |
| 398 | 3300031727 | Ga0316576_10018182 | Ga0316576_100181823 | 126 |
| 399 | 3300031727 | Ga0316576_10045118 | Ga0316576_100451184 | 126 |
| 400 | 3300031728 | Ga0316578_10000053 | Ga0316578_1000005312 | 126 |
| 401 | 3300031728 | Ga0316578_10060124 | Ga0316578_100601243 | 126 |
| 402 | 3300031728 | Ga0316578_10196595 | Ga0316578_101965952 | 126 |
| 403 | 3300031730 | Ga0307516_10000067 | Ga0307516_1000006712 | 126 |
| 404 | 3300031733 | Ga0316577_10008728 | Ga0316577_100087285 | 126 |
| 405 | 3300031733 | Ga0316577_10038625 | Ga0316577_100386254 | 126 |
| 406 | 3300031733 | Ga0316577_10596612 | Ga0316577_105966121 | 126 |
| 407 | 3300031824 | Ga0307413_10007351 | Ga0307413_100073514 | 126 |
| 408 | 3300031852 | Ga0307410_10026652 | Ga0307410_100266525 | 126 |
| 409 | 3300031852 | Ga0307410_10078830 | Ga0307410_100788302 | 126 |
| 410 | 3300031901 | Ga0307406_10145767 | Ga0307406_101457672 | 126 |
| 411 | 3300031903 | Ga0307407_10239307 | Ga0307407_102393072 | 126 |
| 412 | 3300031995 | Ga0307409_100278134 | Ga0307409_1002781342 | 126 |
| 413 | 3300032002 | Ga0307416_100583715 | Ga0307416_1005837152 | 126 |
| 414 | 3300032004 | Ga0307414_10186707 | Ga0307414_101867072 | 126 |
| 415 | 3300032005 | Ga0307411_10021443 | Ga0307411_100214433 | 126 |
| 416 | 3300032005 | Ga0307411_10103834 | Ga0307411_101038342 | 126 |
| 417 | 3300032126 | Ga0307415_100287594 | Ga0307415_1002875942 | 126 |
| 418 | 3300032133 | Ga0316583_10003601 | Ga0316583_100036016 | 126 |
| 419 | 3300032133 | Ga0316583_10033063 | Ga0316583_100330631 | 126 |
| 420 | 3300032139 | Ga0316580_10001292 | Ga0316580_100012926 | 126 |
| 421 | 3300032139 | Ga0316580_10035903 | Ga0316580_100359032 | 126 |
| 422 | 3300033179 | Ga0307507_10301114 | Ga0307507_103011142 | 126 |
| 423 | 3300033180 | Ga0307510_10000006 | Ga0307510_10000006485 | 126 |
| 424 | 3300033180 | Ga0307510_10016283 | Ga0307510_100162835 | 126 |
| 425 | 3300033524 | Ga0316592_1053336 | Ga0316592_10533362 | 126 |
| 426 | 3300033541 | Ga0316596_1069078 | Ga0316596_10690782 | 126 |
| 427 | 3300035089 | Ga0373944_0209135 | Ga0373944_0209135_121_501 | 126 |
| 428 | 3300035111 | Ga0373923_0346475 | Ga0373923_0346475_50_430 | 126 |
| 429 | 3300035113 | Ga0373936_0006275 | Ga0373936_0006275_2192_2572 | 126 |
| 430 | 3300035117 | Ga0373953_0122611 | Ga0373953_0122611_346_726 | 126 |
| 431 | 3300035117 | Ga0373953_0223088 | Ga0373953_0223088_319_699 | 126 |
| 432 | 3300035118 | Ga0373954_0144513 | Ga0373954_0144513_18_404 | 126 |
| 433 | 3300035118 | Ga0373954_0255660 | Ga0373954_0255660_33_413 | 126 |
| 434 | 3300035119 | Ga0373956_0624983 | Ga0373956_0624983_20_400 | 126 |
| 435 | 3300035170 | Ga0373943_0184512 | Ga0373943_0184512_469_849 | 126 |
| 436 | 3300035171 | Ga0373946_0050344 | Ga0373946_0050344_603_983 | 126 |
| 437 | 3300035172 | Ga0373955_0009589 | Ga0373955_0009589_932_1312 | 126 |
| 438 | 3300035398 | Ga0316574_0004214 | Ga0316574_0004214_1287_1670 | 126 |
| 439 | 3300035398 | Ga0316574_0280881 | Ga0316574_0280881_405_785 | 126 |
| 440 | 3300035398 | Ga0316574_0496866 | Ga0316574_0496866_186_566 | 126 |
| 441 | 3300035398 | Ga0316574_0497290 | Ga0316574_0497290_241_624 | 126 |
| 442 | 3300035695 | Ga0373927_0000001 | Ga0373927_0000001_985742_986128 | 126 |
| 443 | 3300035695 | Ga0373927_0024652 | Ga0373927_0024652_1310_1690 | 126 |
| 444 | 3300035724 | Ga0373933_0024810 | Ga0373933_0024810_86_472 | 126 |
| 445 | 3300036401 | Ga0373937_0033162 | Ga0373937_0033162_3253_3633 | 126 |
| 446 | 3300036401 | Ga0373937_0100177 | Ga0373937_0100177_392_772 | 126 |
| 447 | 3300036401 | Ga0373937_0606769 | Ga0373937_0606769_127_507 | 126 |
| 448 | 3300036401 | Ga0373937_1581660 | Ga0373937_1581660_190_570 | 126 |
| 449 | 3300036647 | Ga0316582_0041787 | Ga0316582_0041787_1772_2155 | 126 |
| 450 | 3300036647 | Ga0316582_0441116 | Ga0316582_0441116_257_640 | 126 |
| 451 | 3300036647 | Ga0316582_0993999 | Ga0316582_0993999_126_506 | 126 |
| 452 | 3300036712 | Ga0316584_0007920 | Ga0316584_0007920_2522_2905 | 126 |
| 453 | 3300036712 | Ga0316584_0119501 | Ga0316584_0119501_1262_1645 | 126 |
| 454 | 3300036712 | Ga0316584_0123095 | Ga0316584_0123095_961_1341 | 126 |
| 455 | 3300036712 | Ga0316584_0397858 | Ga0316584_0397858_118_501 | 126 |
| 456 | 3300036712 | Ga0316584_0705824 | Ga0316584_0705824_106_486 | 126 |
| 457 | 3300036712 | Ga0316584_1102681 | Ga0316584_1102681_22_405 | 126 |
| 458 | 3300037068 | Ga0373925_0017486 | Ga0373925_0017486_3480_3860 | 126 |
| 459 | 3300037068 | Ga0373925_0352726 | Ga0373925_0352726_217_645 | 126 |
| 460 | 3300037853 | Ga0436364_0938232 | Ga0436364_0938232_852_1232 | 126 |
| 461 | 3300037853 | Ga0436364_1079144 | Ga0436364_1079144_140_520 | 126 |
| 462 | 3300038727 | Ga0400491_16032 | Ga0400491_16032_805_1188 | 126 |
| 463 | 3300039062 | Ga0400483_074789 | Ga0400483_074789_389_772 | 126 |
| 464 | 3300039062 | Ga0400483_229164 | Ga0400483_229164_132_515 | 126 |
| 465 | 3300039437 | Ga0436365_0344571 | Ga0436365_0344571_444_824 | 126 |
| 466 | 3300039437 | Ga0436365_0919918 | Ga0436365_0919918_1517_1897 | 126 |
| 467 | 3300039437 | Ga0436365_1734234 | Ga0436365_1734234_1437_1826 | 126 |
| 468 | 3300039437 | Ga0436365_1803492 | Ga0436365_1803492_63_491 | 126 |
| 469 | 3300039438 | Ga0436360_1015686 | Ga0436360_1015686_5420_5800 | 126 |
| 470 | 3300039438 | Ga0436360_1292859 | Ga0436360_1292859_1218_1598 | 126 |
| 471 | 3300039447 | Ga0436361_0159837 | Ga0436361_0159837_76_456 | 126 |
| 472 | 3300039447 | Ga0436361_0537095 | Ga0436361_0537095_40_420 | 126 |
| 473 | 3300039447 | Ga0436361_1027302 | Ga0436361_1027302_790_1170 | 126 |
| 474 | 3300039447 | Ga0436361_1066456 | Ga0436361_1066456_276_704 | 126 |
| 475 | 3300039450 | Ga0436363_0082299 | Ga0436363_0082299_120_503 | 126 |
| 476 | 3300039450 | Ga0436363_0122034 | Ga0436363_0122034_423_803 | 126 |
| 477 | 3300039450 | Ga0436363_0397597 | Ga0436363_0397597_343_726 | 126 |
| 478 | 3300039450 | Ga0436363_0502379 | Ga0436363_0502379_1306_1686 | 126 |
| 479 | 3300039450 | Ga0436363_0581112 | Ga0436363_0581112_1935_2315 | 126 |
| 480 | 3300039450 | Ga0436363_0658005 | Ga0436363_0658005_145_534 | 126 |
| 481 | 3300039450 | Ga0436363_1395368 | Ga0436363_1395368_5103_5483 | 126 |
| 482 | 3300039453 | Ga0436362_0056993 | Ga0436362_0056993_235_615 | 126 |
| 483 | 3300039453 | Ga0436362_0580586 | Ga0436362_0580586_514_894 | 126 |
| 484 | 3300039453 | Ga0436362_1153707 | Ga0436362_1153707_116_496 | 126 |
| 485 | 3300041410 | Ga0439461_0208873 | Ga0439461_0208873_32_412 | 126 |
| 486 | 3300041486 | Ga0451807_0242516 | Ga0451807_0242516_157_537 | 126 |
| 487 | 3300041486 | Ga0451807_1950251 | Ga0451807_1950251_425_805 | 126 |
| 488 | 3300041494 | Ga0451837_1278518 | Ga0451837_1278518_577_957 | 126 |
| 489 | 3300041496 | Ga0451839_1122753 | Ga0451839_1122753_23_403 | 126 |
| 490 | 3300042876 | Ga0451577_0044972 | Ga0451577_0044972_348_731 | 126 |
| 491 | 3300042876 | Ga0451577_0687840 | Ga0451577_0687840_460_843 | 126 |
| 492 | 3300044656 | Ga0466969_0045492 | Ga0466969_0045492_1076_1456 | 126 |
| 493 | 3300044673 | Ga0453683_0115177 | Ga0453683_0115177_873_1256 | 126 |
| 494 | 3300044712 | Ga0453684_0302454 | Ga0453684_0302454_1023_1406 | 126 |
| 495 | 3300044712 | Ga0453684_0363767 | Ga0453684_0363767_526_927 | 126 |
| 496 | 3300044712 | Ga0453684_2277349 | Ga0453684_2277349_145_528 | 126 |
| 497 | 3300044765 | Ga0466970_0710502 | Ga0466970_0710502_179_559 | 126 |
| 498 | 3300045049 | Ga0466959_0118566 | Ga0466959_0118566_901_1281 | 126 |
| 499 | 3300045049 | Ga0466959_0419556 | Ga0466959_0419556_229_609 | 126 |
| 500 | 3300045051 | Ga0451576_0027268 | Ga0451576_0027268_1350_1751 | 126 |
| 501 | 3300045051 | Ga0451576_0046467 | Ga0451576_0046467_1590_1973 | 126 |
| 502 | 3300045051 | Ga0451576_1437657 | Ga0451576_1437657_100_483 | 126 |
| 503 | 3300045836 | Ga0466958_1083395 | Ga0466958_1083395_130_510 | 126 |
| 504 | 3300046454 | Ga0495592_0692973 | Ga0495592_0692973_145_525 | 126 |
| 505 | 3300046459 | Ga0495629_0306552 | Ga0495629_0306552_84_464 | 126 |
| 506 | 3300046460 | Ga0495638_0035712 | Ga0495638_0035712_206_586 | 126 |
| 507 | 3300046462 | Ga0495651_0292860 | Ga0495651_0292860_670_1050 | 126 |
| 508 | 3300046472 | Ga0495580_0008063 | Ga0495580_0008063_2363_2743 | 126 |
| 509 | 3300046472 | Ga0495580_0018491 | Ga0495580_0018491_3613_3993 | 126 |
| 510 | 3300046472 | Ga0495580_0699807 | Ga0495580_0699807_10_390 | 126 |
| 511 | 3300046473 | Ga0495582_0599047 | Ga0495582_0599047_19_399 | 126 |
| 512 | 3300046475 | Ga0495639_0243221 | Ga0495639_0243221_26_406 | 126 |
| 513 | 3300046476 | Ga0495662_0103530 | Ga0495662_0103530_289_669 | 126 |
| 514 | 3300046507 | Ga0495606_0122533 | Ga0495606_0122533_695_1075 | 126 |
| 515 | 3300046511 | Ga0495608_0379504 | Ga0495608_0379504_121_501 | 126 |
| 516 | 3300046511 | Ga0495608_0787034 | Ga0495608_0787034_118_498 | 126 |
| 517 | 3300046513 | Ga0495616_0257846 | Ga0495616_0257846_210_590 | 126 |
| 518 | 3300046515 | Ga0495620_0179583 | Ga0495620_0179583_160_549 | 126 |
| 519 | 3300046516 | Ga0495628_0070403 | Ga0495628_0070403_1657_2037 | 126 |
| 520 | 3300046517 | Ga0495630_0359276 | Ga0495630_0359276_43_426 | 126 |
| 521 | 3300046519 | Ga0495632_0066473 | Ga0495632_0066473_997_1377 | 126 |
| 522 | 3300046524 | Ga0495648_0322295 | Ga0495648_0322295_114_494 | 126 |
| 523 | 3300046531 | Ga0495665_0048657 | Ga0495665_0048657_734_1114 | 126 |
| 524 | 3300046533 | Ga0495640_0528408 | Ga0495640_0528408_303_683 | 126 |
| 525 | 3300046535 | Ga0495586_0025330 | Ga0495586_0025330_1264_1647 | 126 |
| 526 | 3300046536 | Ga0495587_0011965 | Ga0495587_0011965_1327_1707 | 126 |
| 527 | 3300046536 | Ga0495587_0191151 | Ga0495587_0191151_364_744 | 126 |
| 528 | 3300046538 | Ga0495609_0060384 | Ga0495609_0060384_326_706 | 126 |
| 529 | 3300046543 | Ga0495645_0305479 | Ga0495645_0305479_134_514 | 126 |
| 530 | 3300046616 | Ga0495668_0210018 | Ga0495668_0210018_510_890 | 126 |
| 531 | 3300046642 | Ga0495634_0264579 | Ga0495634_0264579_165_545 | 126 |
| 532 | 3300046660 | Ga0495625_0009758 | Ga0495625_0009758_5931_6311 | 126 |
| 533 | 3300046660 | Ga0495625_0427819 | Ga0495625_0427819_328_708 | 126 |
| 534 | 3300046675 | Ga0495657_0568867 | Ga0495657_0568867_247_627 | 126 |
| 535 | 3300046680 | Ga0495646_0582992 | Ga0495646_0582992_118_498 | 126 |
| 536 | 3300046683 | Ga0495658_0106897 | Ga0495658_0106897_80_463 | 126 |
| 537 | 3300046684 | Ga0495669_0179142 | Ga0495669_0179142_280_669 | 126 |
| 538 | 3300046692 | Ga0495671_0565932 | Ga0495671_0565932_75_470 | 126 |
| 539 | 3300047317 | Ga0495604_0267750 | Ga0495604_0267750_286_666 | 126 |
| 540 | 3300047319 | Ga0495674_0058164 | Ga0495674_0058164_2738_3118 | 126 |
| 541 | 3300047443 | Ga0495687_107510 | Ga0495687_107510_160_540 | 126 |
| 542 | 3300047443 | Ga0495687_179240 | Ga0495687_179240_247_627 | 126 |
| 543 | 3300047444 | Ga0495675_0301952 | Ga0495675_0301952_305_685 | 126 |
| 544 | 3300047470 | Ga0495681_0128683 | Ga0495681_0128683_365_754 | 126 |
| 545 | 3300047471 | Ga0495684_0498758 | Ga0495684_0498758_319_699 | 126 |
| 546 | 3300047472 | Ga0495686_0319465 | Ga0495686_0319465_340_747 | 126 |
| 547 | 3300048903 | Ga0496100_0098204 | Ga0496100_0098204_1580_1960 | 126 |
| 548 | 3300048903 | Ga0496100_0281525 | Ga0496100_0281525_31_411 | 126 |
| 549 | 3300048904 | Ga0496101_0042578 | Ga0496101_0042578_661_1041 | 126 |
| 550 | 3300048904 | Ga0496101_0276487 | Ga0496101_0276487_717_1112 | 126 |
| 551 | 3300048905 | Ga0496102_0025626 | Ga0496102_0025626_375_755 | 126 |
| 552 | 3300048905 | Ga0496102_0059027 | Ga0496102_0059027_1276_1656 | 126 |
| 553 | 3300048905 | Ga0496102_0094373 | Ga0496102_0094373_855_1235 | 126 |
| 554 | 3300048905 | Ga0496102_0115092 | Ga0496102_0115092_1203_1583 | 126 |
| 555 | 3300048905 | Ga0496102_0620808 | Ga0496102_0620808_335_730 | 126 |
| 556 | 3300048906 | Ga0496103_0031670 | Ga0496103_0031670_2536_2916 | 126 |
| 557 | 3300048906 | Ga0496103_0095347 | Ga0496103_0095347_1425_1805 | 126 |
| 558 | 3300048907 | Ga0496104_0096551 | Ga0496104_0096551_54_434 | 126 |
| 559 | 3300048907 | Ga0496104_0191881 | Ga0496104_0191881_1113_1508 | 126 |
| 560 | 3300048908 | Ga0496105_0022709 | Ga0496105_0022709_3392_3772 | 126 |
| 561 | 3300048909 | Ga0496106_0016627 | Ga0496106_0016627_3583_3963 | 126 |
| 562 | 3300048910 | Ga0496107_0011507 | Ga0496107_0011507_2883_3263 | 126 |
| 563 | 3300048911 | Ga0496108_0032625 | Ga0496108_0032625_2636_3016 | 126 |
| 564 | 3300048911 | Ga0496108_0209555 | Ga0496108_0209555_391_771 | 126 |
| 565 | 3300048912 | Ga0496109_0073684 | Ga0496109_0073684_656_1036 | 126 |
| 566 | 3300048912 | Ga0496109_0495713 | Ga0496109_0495713_432_812 | 126 |
| 567 | 3300048912 | Ga0496109_0766177 | Ga0496109_0766177_190_570 | 126 |
| 568 | 3300048913 | Ga0496110_0011389 | Ga0496110_0011389_6693_7073 | 126 |
| 569 | 3300048914 | Ga0496111_0705589 | Ga0496111_0705589_53_433 | 126 |
| 570 | 3300048915 | Ga0496112_0066822 | Ga0496112_0066822_563_943 | 126 |
| 571 | 3300048915 | Ga0496112_0083617 | Ga0496112_0083617_11_391 | 126 |
| 572 | 3300048915 | Ga0496112_0163655 | Ga0496112_0163655_264_644 | 126 |
| 573 | 3300048915 | Ga0496112_0613009 | Ga0496112_0613009_45_425 | 126 |
| 574 | 3300048917 | Ga0496114_0003309 | Ga0496114_0003309_4390_4770 | 126 |
| 575 | 3300048917 | Ga0496114_0296529 | Ga0496114_0296529_747_1127 | 126 |
| 576 | 3300048917 | Ga0496114_0545324 | Ga0496114_0545324_263_658 | 126 |
| 577 | 3300048918 | Ga0496115_0004612 | Ga0496115_0004612_6370_6750 | 126 |
| 578 | 3300048918 | Ga0496115_0534042 | Ga0496115_0534042_33_413 | 126 |
| 579 | 3300048919 | Ga0496116_0003851 | Ga0496116_0003851_1199_1579 | 126 |
| 580 | 3300048920 | Ga0496117_0000229 | Ga0496117_0000229_97354_97734 | 126 |
| 581 | 3300048921 | Ga0496118_0000016 | Ga0496118_0000016_491021_491401 | 126 |
| 582 | 3300048921 | Ga0496118_0007348 | Ga0496118_0007348_5184_5564 | 126 |
| 583 | 3300048922 | Ga0496119_0006549 | Ga0496119_0006549_6610_6990 | 126 |
| 584 | 3300048922 | Ga0496119_0010886 | Ga0496119_0010886_336_716 | 126 |
| 585 | 3300048923 | Ga0496120_0000839 | Ga0496120_0000839_3158_3538 | 126 |
| 586 | 3300048923 | Ga0496120_0023961 | Ga0496120_0023961_1260_1640 | 126 |
| 587 | 3300048924 | Ga0496121_0007867 | Ga0496121_0007867_10061_10441 | 126 |
| 588 | 3300048924 | Ga0496121_0070321 | Ga0496121_0070321_1736_2116 | 126 |
| 589 | 3300048927 | Ga0496124_0017163 | Ga0496124_0017163_1011_1391 | 126 |
| 590 | 3300048927 | Ga0496124_0534111 | Ga0496124_0534111_326_706 | 126 |
| 591 | 3300048928 | Ga0496125_0000353 | Ga0496125_0000353_70743_71123 | 126 |
| 592 | 3300048928 | Ga0496125_0020465 | Ga0496125_0020465_2313_2693 | 126 |
| 593 | 3300048929 | Ga0496126_0002458 | Ga0496126_0002458_340_720 | 126 |
| 594 | 3300048929 | Ga0496126_0047696 | Ga0496126_0047696_2126_2506 | 126 |
| 595 | 3300048929 | Ga0496126_0255807 | Ga0496126_0255807_299_682 | 126 |
| 596 | 3300049460 | Ga0495682_0364352 | Ga0495682_0364352_29_457 | 126 |
| 597 | 3300049569 | Ga0501032_0650307 | Ga0501032_0650307_237_629 | 126 |
| 598 | 3300049570 | Ga0501033_0195330 | Ga0501033_0195330_315_707 | 126 |
| 599 | 3300049570 | Ga0501033_0671763 | Ga0501033_0671763_22_414 | 126 |
| 600 | 3300049572 | Ga0501036_0003616 | Ga0501036_0003616_11134_11526 | 126 |
| 601 | 3300049572 | Ga0501036_0048011 | Ga0501036_0048011_414_806 | 126 |
| 602 | 3300049573 | Ga0501037_0352710 | Ga0501037_0352710_460_852 | 126 |
| 603 | 3300049573 | Ga0501037_0385669 | Ga0501037_0385669_68_460 | 126 |
| 604 | 3300049574 | Ga0501038_0002930 | Ga0501038_0002930_11089_11481 | 126 |
| 605 | 3300049574 | Ga0501038_0976909 | Ga0501038_0976909_117_509 | 126 |
| 606 | 3300049575 | Ga0501039_0032408 | Ga0501039_0032408_2670_3062 | 126 |
| 607 | 3300049576 | Ga0501040_0005143 | Ga0501040_0005143_1052_1444 | 126 |
| 608 | 3300049576 | Ga0501040_0127859 | Ga0501040_0127859_320_712 | 126 |
| 609 | 3300049577 | Ga0501041_0001297 | Ga0501041_0001297_7601_7993 | 126 |
| 610 | 3300049577 | Ga0501041_0144725 | Ga0501041_0144725_246_638 | 126 |
| 611 | 3300049578 | Ga0501042_0000439 | Ga0501042_0000439_7911_8303 | 126 |
| 612 | 3300049578 | Ga0501042_0191473 | Ga0501042_0191473_153_533 | 126 |
| 613 | 3300049578 | Ga0501042_0194922 | Ga0501042_0194922_56_448 | 126 |
| 614 | 3300049578 | Ga0501042_0198644 | Ga0501042_0198644_378_770 | 126 |
| 615 | 3300049579 | Ga0501043_0114979 | Ga0501043_0114979_774_1166 | 126 |
| 616 | 3300049580 | Ga0501046_0034962 | Ga0501046_0034962_3263_3655 | 126 |
| 617 | 3300049580 | Ga0501046_0063947 | Ga0501046_0063947_1075_1467 | 126 |
| 618 | 3300049581 | Ga0501047_0180441 | Ga0501047_0180441_16_399 | 126 |
| 619 | 3300049582 | Ga0501048_0003706 | Ga0501048_0003706_24_416 | 126 |
| 620 | 3300049582 | Ga0501048_0455787 | Ga0501048_0455787_325_717 | 126 |
| 621 | 3300049584 | Ga0501068_0021610 | Ga0501068_0021610_1278_1670 | 126 |
| 622 | 3300049584 | Ga0501068_0833571 | Ga0501068_0833571_175_567 | 126 |
| 623 | 3300049586 | Ga0501070_0895749 | Ga0501070_0895749_268_660 | 126 |
| 624 | 3300049587 | Ga0501071_0001933 | Ga0501071_0001933_872_1264 | 126 |
| 625 | 3300049587 | Ga0501071_1301684 | Ga0501071_1301684_153_533 | 126 |
| 626 | 3300049588 | Ga0501072_0001847 | Ga0501072_0001847_11088_11480 | 126 |
| 627 | 3300049588 | Ga0501072_0376478 | Ga0501072_0376478_149_541 | 126 |
| 628 | 3300049591 | Ga0501075_0014371 | Ga0501075_0014371_2615_3007 | 126 |
| 629 | 3300049592 | Ga0501076_0035786 | Ga0501076_0035786_1626_2018 | 126 |
| 630 | 3300049592 | Ga0501076_0094154 | Ga0501076_0094154_170_550 | 126 |
| 631 | 3300049592 | Ga0501076_0104895 | Ga0501076_0104895_537_929 | 126 |
| 632 | 3300049592 | Ga0501076_0257786 | Ga0501076_0257786_819_1211 | 126 |
| 633 | 3300049593 | Ga0501077_0005786 | Ga0501077_0005786_5842_6234 | 126 |
| 634 | 3300049670 | Ga0501236_052909 | Ga0501236_052909_20_421 | 126 |
| 635 | 3300049741 | Ga0501079_0115180 | Ga0501079_0115180_989_1381 | 126 |
| 636 | 3300049741 | Ga0501079_0830511 | Ga0501079_0830511_29_409 | 126 |
| 637 | 3300049742 | Ga0501080_0558138 | Ga0501080_0558138_611_1003 | 126 |
| 638 | 3300049742 | Ga0501080_0641415 | Ga0501080_0641415_370_762 | 126 |
| 639 | 3300049743 | Ga0501081_0008365 | Ga0501081_0008365_3090_3482 | 126 |
| 640 | 3300049822 | Ga0501035_0009197 | Ga0501035_0009197_6646_7038 | 126 |
| 641 | 3300049823 | Ga0501044_1120227 | Ga0501044_1120227_253_645 | 126 |
| 642 | 3300049824 | Ga0501045_0002981 | Ga0501045_0002981_24_416 | 126 |
| 643 | 3300049824 | Ga0501045_0021552 | Ga0501045_0021552_1654_2046 | 126 |
| 644 | 3300049824 | Ga0501045_0610145 | Ga0501045_0610145_232_612 | 126 |
| 645 | 3300050509 | nmdc:mga0qj67_798761_c1 | nmdc:mga0qj67_798761_c1_208_588 | 126 |
| 646 | 3300050513 | nmdc:mga0rr50_1435996_c1 | nmdc:mga0rr50_1435996_c1_11_391 | 126 |
| 647 | 3300050514 | nmdc:mga08x19_227697_c1 | nmdc:mga08x19_227697_c1_275_655 | 126 |
| 648 | 3300053077 | Ga0495601_0491163 | Ga0495601_0491163_214_594 | 126 |
| 649 | 3300053077 | Ga0495601_0692188 | Ga0495601_0692188_46_426 | 126 |
| 650 | 3300053092 | Ga0500583_0143337 | Ga0500583_0143337_13_393 | 126 |
| 651 | 3300053104 | Ga0500556_0000435 | Ga0500556_0000435_7583_7963 | 126 |
| 652 | 3300053119 | Ga0500595_085442 | Ga0500595_085442_317_697 | 126 |
| 653 | 3300053136 | Ga0500559_0105731 | Ga0500559_0105731_499_882 | 126 |
| 654 | 3300053163 | Ga0500639_093651 | Ga0500639_093651_861_1241 | 126 |
| 655 | 3300053177 | Ga0500636_0293846 | Ga0500636_0293846_294_674 | 126 |
| 656 | 3300053178 | Ga0500637_0027480 | Ga0500637_0027480_1933_2313 | 126 |
| 657 | 3300053178 | Ga0500637_0228468 | Ga0500637_0228468_651_1031 | 126 |
| 658 | 3300054114 | Ga0501084_0156561 | Ga0501084_0156561_123_515 | 126 |
| 659 | 3300060353 | Ga0501082_0003701 | Ga0501082_0003701_11929_12321 | 126 |
| 660 | 3300060353 | Ga0501082_0996662 | Ga0501082_0996662_76_456 | 126 |
| 661 | 3300061734 | Ga0530510_0016026 | Ga0530510_0016026_1061_1453 | 126 |
| 662 | 3300061734 | Ga0530510_0024869 | Ga0530510_0024869_3003_3395 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xq4-assembly1.cif.gz_A | crystal structure of the putative apaa protein from bordetella pertussis, northeast structural genomics target ber40 | 0.9758 | 3 | 124 |
| 2f1e-assembly1.cif.gz_A | solution structure of apag protein | 0.9725 | 6 | 120 |
| 1tza-assembly1.cif.gz_B | x-ray structure of northeast structural genomics consortium target sor45 | 0.9668 | 7 | 126 |
| 1xq4-assembly1.cif.gz_A | crystal structure of the putative apaa protein from bordetella pertussis, northeast structural genomics target ber40 | 0.9604 | 3 | 124 |
| 5hdw-assembly1.cif.gz_A | apag domain of fbxo3 | 0.9574 | 8 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q65XS0_164_295_2.60.40.1470 | Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain | 0.9895 | 8 | 120 | 2.60.40.1470 |
| 1xq4B00 | Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain | 0.9761 | 3 | 121 | 2.60.40.1470 |
| 2f1eA00 | Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain | 0.9725 | 6 | 120 | 2.60.40.1470 |
| 1tzaB00 | Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain | 0.966 | 7 | 126 | 2.60.40.1470 |
| 1xvsB00 | Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain | 0.9628 | 2 | 124 | 2.60.40.1470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534P798-F1-model_v4 | Co2+/Mg2+ efflux protein ApaG | 1.003 | 8 | 112 |
|
| AF-A0A554XN54-F1-model_v4 | Protein ApaG | 1.002 | 6 | 121 |
GO:0070987
|
| AF-A0A1A6DUG4-F1-model_v4 | Co2+/Mg2+ efflux protein ApaG | 1.002 | 6 | 121 |
GO:0070987
|
| AF-A0A498ELH1-F1-model_v4 | deleted | 1.001 | 3 | 123 |
|
| AF-A0A838N077-F1-model_v4 | Co2+/Mg2+ efflux protein ApaG | 1.001 | 8 | 120 |
GO:0070987
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar