F473344

General Info

Members Datasets Scaffolds Average Seq Length
660 355 1320 205

Family's Representative Sequence

Representative Sequence 3300031247|Ga0265340_10050248|Ga0265340_100502482
Length 246
Sequence VGEKQVPTPADIAKARPSPSGPVVRPSTGEAQPSPPARSRVVIAEDEALIRLDLKETLHELGYEVVGEAGDGEQAVALAQELRPDLVILDVKMPVLDGISAAQRIAAARIAPVVILTAFSQRDLIERARDAGAMAYLVKPFSAADLMPAIEMALSRYAEAAALGAEVSNLTEQLATRKVLDRAKGILQSTRQLSEPQAFRWIQQSAMDQRVSMRAIADAVIATATPSAAPEPGSATGNDARPPIRS

Samples

Sample ID Description Type Environment
1 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
132 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
135 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
136 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
137 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
142 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
163 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
164 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
198 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
199 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
200 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
201 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
202 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
203 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
204 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
205 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
206 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
207 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
208 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
209 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
237 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
248 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
274 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
275 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
276 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
277 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
278 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
295 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
300 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
314 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
323 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
324 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
325 2506783011 Frankia datiscae Dg1 Isolate Nodule
326 2547132424 Nocardia nova SH22a Isolate Unclassified
327 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
328 2643221692 Nocardia sp. Root136 Isolate Unclassified
329 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
330 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
331 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
332 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
333 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
334 2773857933 Frankia sp. BMG5.30 Isolate Nodule
335 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
336 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
337 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
338 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
339 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
340 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
341 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
342 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
343 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
344 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
345 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
346 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
347 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
348 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
349 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
350 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
351 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
352 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
353 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
354 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
355 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.79
Metatranscriptomes 1.52
Isolates 4.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 4.7
Nodule 0.45
Rhizoplane 5.45
Rhizosphere 81.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265340_10050248 3300031247 Bacteria 2023
2 LJNas_1003596 3300000546 Bacteria 1774
3 JGI25406J46586_10001203 3300003203 Bacteria 12170
4 JGI25406J46586_10048222 3300003203 Bacteria 1446
5 JGI25404J52841_10002182 3300003659 Bacteria 3660
6 Ga0070658_10027899 3300005327 Bacteria 4531
7 Ga0070658_10108439 3300005327 Bacteria 2298
8 Ga0070658_10255182 3300005327 Bacteria 1488
9 Ga0070658_10418698 3300005327 Bacteria 1152
10 Ga0070683_100098073 3300005329 Bacteria 2757
11 Ga0070683_100416568 3300005329 Bacteria 1281
12 Ga0070666_10006654 3300005335 Bacteria 7107
13 Ga0070680_100007560 3300005336 Bacteria 8286
14 Ga0070682_100200720 3300005337 Bacteria 1407
15 Ga0070682_100258209 3300005337 Bacteria 1260
16 Ga0068868_100466627 3300005338 Bacteria 1101
17 Ga0070660_100041886 3300005339 Bacteria 3493
18 Ga0070660_100328370 3300005339 Bacteria 1257
19 Ga0070691_10158893 3300005341 Bacteria 1164
20 Ga0070661_100258054 3300005344 Bacteria 1347
21 Ga0070692_10067865 3300005345 Bacteria 1894
22 Ga0070668_100121757 3300005347 Bacteria 2086
23 Ga0070668_100596469 3300005347 Bacteria 966
24 Ga0070675_100596941 3300005354 Bacteria 1001
25 Ga0070671_100698028 3300005355 Bacteria 880
26 Ga0070674_100343254 3300005356 Bacteria 1204
27 Ga0070659_100552263 3300005366 Bacteria 986
28 Ga0070667_100997248 3300005367 Bacteria 781
29 Ga0070709_10203026 3300005434 Bacteria 1405
30 Ga0070714_100003556 3300005435 Bacteria 11651
31 Ga0070714_100004941 3300005435 Bacteria 10135
32 Ga0070714_100012181 3300005435 Bacteria 6855
33 Ga0070714_100040836 3300005435 Bacteria 3911
34 Ga0070714_100511966 3300005435 Bacteria 1145
35 Ga0070714_101110624 3300005435 Bacteria 771
36 Ga0070713_100006155 3300005436 Bacteria 8291
37 Ga0070713_100048478 3300005436 Bacteria 3497
38 Ga0070713_100064371 3300005436 Bacteria 3077
39 Ga0070713_100481029 3300005436 Bacteria 1170
40 Ga0070710_10036555 3300005437 Bacteria 2685
41 Ga0070710_10089311 3300005437 Bacteria 1815
42 Ga0070711_100047637 3300005439 Bacteria 2928
43 Ga0070700_100000007 3300005441 Bacteria 198866
44 Ga0070694_100159277 3300005444 Bacteria 1655
45 Ga0070708_100004824 3300005445 Bacteria 10634
46 Ga0070708_100124979 3300005445 Bacteria 2376
47 Ga0070708_100677670 3300005445 Bacteria 971
48 Ga0070663_100092399 3300005455 Bacteria 2244
49 Ga0070663_100225091 3300005455 Bacteria 1474
50 Ga0070681_10006486 3300005458 Bacteria 11387
51 Ga0070706_100002251 3300005467 Bacteria 19550
52 Ga0070707_100003511 3300005468 Bacteria 14797
53 Ga0070707_100279615 3300005468 Bacteria 1622
54 Ga0070698_100044332 3300005471 Bacteria 4555
55 Ga0070698_100407361 3300005471 Bacteria 1293
56 Ga0070698_100732411 3300005471 Bacteria 931
57 Ga0070679_100011786 3300005530 Bacteria 8337
58 Ga0070679_100033404 3300005530 Bacteria 5094
59 Ga0070679_100113269 3300005530 Bacteria 2698
60 Ga0070684_100017540 3300005535 Bacteria 5879
61 Ga0070684_100033118 3300005535 Bacteria 4409
62 Ga0070684_100207714 3300005535 Bacteria 1785
63 Ga0070684_100313032 3300005535 Bacteria 1442
64 Ga0070684_100799584 3300005535 Bacteria 882
65 Ga0070697_100011126 3300005536 Bacteria 7032
66 Ga0070665_100005785 3300005548 Bacteria 12686
67 Ga0070665_100017852 3300005548 Bacteria 7123
68 Ga0070665_100154651 3300005548 Bacteria 2295
69 Ga0070665_100803523 3300005548 Bacteria 954
70 Ga0070665_100988194 3300005548 Bacteria 854
71 Ga0070704_100026023 3300005549 Bacteria 3860
72 Ga0068855_100009962 3300005563 Bacteria 11455
73 Ga0070664_100320214 3300005564 Bacteria 1405
74 Ga0068857_100507391 3300005577 Bacteria 1132
75 Ga0068857_100690648 3300005577 Bacteria 969
76 Ga0068854_100202304 3300005578 Bacteria 1562
77 Ga0068856_100349262 3300005614 Bacteria 1498
78 Ga0068856_100455271 3300005614 Bacteria 1300
79 Ga0068852_100025365 3300005616 Bacteria 4803
80 Ga0068859_100001215 3300005617 Bacteria 26280
81 Ga0068864_100007963 3300005618 Bacteria 8733
82 Ga0068863_100001488 3300005841 Bacteria 23229
83 Ga0068863_100006413 3300005841 Bacteria 11537
84 Ga0068863_100048862 3300005841 Bacteria 4011
85 Ga0068858_100000014 3300005842 Bacteria 214686
86 Ga0068858_100001815 3300005842 Bacteria 21735
87 Ga0068858_100005406 3300005842 Bacteria 12513
88 Ga0068860_100000124 3300005843 Bacteria 124227
89 Ga0068860_100042277 3300005843 Bacteria 4353
90 Ga0068862_100240954 3300005844 Bacteria 1644
91 Ga0081455_10043262 3300005937 Bacteria 3942
92 Ga0081455_10298029 3300005937 Bacteria 1158
93 Ga0081540_1000322 3300005983 Bacteria 49507
94 Ga0081540_1004915 3300005983 Bacteria 10063
95 Ga0081540_1047957 3300005983 Bacteria 2143
96 Ga0081539_10000775 3300005985 Bacteria 62812
97 Ga0081539_10002336 3300005985 Bacteria 27290
98 Ga0070717_10057262 3300006028 Bacteria 3222
99 Ga0070717_10095173 3300006028 Bacteria 2520
100 Ga0075365_10000795 3300006038 Bacteria 12929
101 Ga0075365_10309195 3300006038 Bacteria 1113
102 Ga0075363_100001054 3300006048 Bacteria 9942
103 Ga0075363_100005975 3300006048 Bacteria 5489
104 Ga0075363_100092788 3300006048 Bacteria 1663
105 Ga0075363_100142181 3300006048 Bacteria 1352
106 Ga0075364_10022410 3300006051 Bacteria 3988
107 Ga0070715_10099112 3300006163 Bacteria 1356
108 Ga0070712_100419791 3300006175 Bacteria 1108
109 Ga0075367_10005490 3300006178 Bacteria 6305
110 Ga0075367_10029838 3300006178 Bacteria 3123
111 Ga0075367_10239202 3300006178 Bacteria 1138
112 Ga0075369_10003960 3300006186 Bacteria 5432
113 Ga0075370_10005188 3300006353 Bacteria 6440
114 Ga0075370_10184179 3300006353 Bacteria 1229
115 Ga0075428_100357482 3300006844 Bacteria 1567
116 Ga0075428_100479952 3300006844 Bacteria 1331
117 Ga0075436_100131726 3300006914 Bacteria 1753
118 Ga0097620_100001215 3300006931 Bacteria 26280
119 Ga0105240_10004243 3300009093 Bacteria 21922
120 Ga0105240_10050695 3300009093 Bacteria 5231
121 Ga0105240_10620936 3300009093 Bacteria 1188
122 Ga0105245_10220167 3300009098 Bacteria 1831
123 Ga0105245_10448336 3300009098 Bacteria 1298
124 Ga0105245_10540573 3300009098 Bacteria 1186
125 Ga0105247_10000049 3300009101 Bacteria 150328
126 Ga0105247_10000553 3300009101 Bacteria 30418
127 Ga0105247_10219623 3300009101 Bacteria 1286
128 Ga0105243_10002999 3300009148 Bacteria 13943
129 Ga0105243_10193470 3300009148 Bacteria 1778
130 Ga0105248_10000132 3300009177 Bacteria 87051
131 Ga0105248_10002822 3300009177 Bacteria 19282
132 Ga0105237_10524263 3300009545 Bacteria 1191
133 Ga0105238_10756640 3300009551 Bacteria 986
134 Ga0105249_10039336 3300009553 Bacteria 4293
135 Ga0099796_10140474 3300010159 Bacteria 943
136 Ga0105239_10387256 3300010375 Bacteria 1581
137 Ga0157371_10177507 3300013102 Bacteria 1523
138 Ga0157370_10001477 3300013104 Bacteria 29096
139 Ga0157370_10233803 3300013104 Bacteria 1701
140 Ga0157370_10235748 3300013104 Bacteria 1693
141 Ga0157370_10571275 3300013104 Bacteria 1036
142 Ga0157369_10001670 3300013105 Bacteria 27062
143 Ga0157369_10009536 3300013105 Bacteria 11102
144 Ga0157369_10731887 3300013105 Bacteria 1018
145 Ga0157369_10999222 3300013105 Bacteria 857
146 Ga0157372_10000079 3300013307 Bacteria 100687
147 Ga0157372_11047355 3300013307 Bacteria 944
148 Ga0163163_10002140 3300014325 Bacteria 16690
149 Ga0163163_10050223 3300014325 Bacteria 4107
150 Ga0163163_10256614 3300014325 Bacteria 1799
151 Ga0163163_10263774 3300014325 Bacteria 1773
152 Ga0163163_10287399 3300014325 Bacteria 1696
153 Ga0163163_10817901 3300014325 Bacteria 995
154 Ga0157379_10030567 3300014968 Bacteria 4795
155 Ga0157379_10188111 3300014968 Bacteria 1866
156 Ga0157379_10948112 3300014968 Bacteria 818
157 Ga0182005_1039425 3300015265 Bacteria 1285
158 Ga0197907_10591287 3300020069 Bacteria 914
159 Ga0206356_11054090 3300020070 Bacteria 3386
160 Ga0206351_10643484 3300020077 Bacteria 752
161 Ga0206350_11433914 3300020080 Bacteria 639
162 Ga0206353_11083094 3300020082 Bacteria 2099
163 Ga0154015_1062170 3300020610 Bacteria 1871
164 Ga0154015_1360837 3300020610 Bacteria 1504
165 Ga0213875_10000071 3300021388 Bacteria 120220
166 Ga0213875_10013030 3300021388 Bacteria 4092
167 Ga0224712_10025320 3300022467 Bacteria 2085
168 Ga0224712_10114841 3300022467 Bacteria 1159
169 Ga0228600_1006473 3300024123 Bacteria 873
170 Ga0207692_10036671 3300025898 Bacteria 2393
171 Ga0207692_10155061 3300025898 Bacteria 1315
172 Ga0207710_10000035 3300025900 Bacteria 253729
173 Ga0207710_10000073 3300025900 Bacteria 150308
174 Ga0207680_10001339 3300025903 Bacteria 11647
175 Ga0207705_10006949 3300025909 Bacteria 8360
176 Ga0207705_10012507 3300025909 Bacteria 6129
177 Ga0207705_10057919 3300025909 Bacteria 2795
178 Ga0207684_10003086 3300025910 Bacteria 16463
179 Ga0207707_10077049 3300025912 Bacteria 2910
180 Ga0207695_10008901 3300025913 Bacteria 12500
181 Ga0207695_10038436 3300025913 Bacteria 5152
182 Ga0207693_10090382 3300025915 Bacteria 2400
183 Ga0207663_10036742 3300025916 Bacteria 2948
184 Ga0207663_10093191 3300025916 Bacteria 2004
185 Ga0207660_10085477 3300025917 Bacteria 2327
186 Ga0207660_10094134 3300025917 Bacteria 2226
187 Ga0207657_10029172 3300025919 Bacteria 5026
188 Ga0207657_10056699 3300025919 Bacteria 3379
189 Ga0207652_10010333 3300025921 Bacteria 7519
190 Ga0207652_10012218 3300025921 Bacteria 6938
191 Ga0207652_10505135 3300025921 Bacteria 1088
192 Ga0207646_10004059 3300025922 Bacteria 16158
193 Ga0207646_10305022 3300025922 Bacteria 1438
194 Ga0207694_10104405 3300025924 Bacteria 2248
195 Ga0207659_10567249 3300025926 Bacteria 966
196 Ga0207687_10269941 3300025927 Bacteria 1359
197 Ga0207687_10284835 3300025927 Bacteria 1326
198 Ga0207687_10471915 3300025927 Bacteria 1043
199 Ga0207700_10007224 3300025928 Bacteria 6772
200 Ga0207700_10009070 3300025928 Bacteria 6194
201 Ga0207700_10378661 3300025928 Bacteria 1237
202 Ga0207700_10388680 3300025928 Bacteria 1221
203 Ga0207664_10000905 3300025929 Bacteria 20030
204 Ga0207664_10005795 3300025929 Bacteria 8446
205 Ga0207664_10015437 3300025929 Bacteria 5545
206 Ga0207664_10161500 3300025929 Bacteria 1911
207 Ga0207664_10175060 3300025929 Bacteria 1839
208 Ga0207664_10335899 3300025929 Bacteria 1335
209 Ga0207664_10390581 3300025929 Bacteria 1236
210 Ga0207664_10681397 3300025929 Bacteria 924
211 Ga0207690_10426920 3300025932 Bacteria 1061
212 Ga0207690_10529222 3300025932 Bacteria 956
213 Ga0207709_10003528 3300025935 Bacteria 9259
214 Ga0207709_10323460 3300025935 Bacteria 1155
215 Ga0207669_10037457 3300025937 Bacteria 2783
216 Ga0207669_10533430 3300025937 Bacteria 944
217 Ga0207665_10576352 3300025939 Bacteria 877
218 Ga0207711_10000139 3300025941 Bacteria 77476
219 Ga0207711_10001985 3300025941 Bacteria 18534
220 Ga0207711_10056534 3300025941 Bacteria 3372
221 Ga0207661_10034973 3300025944 Bacteria 3911
222 Ga0207661_10092008 3300025944 Bacteria 2528
223 Ga0207661_10246238 3300025944 Bacteria 1587
224 Ga0207667_10020380 3300025949 Bacteria 7376
225 Ga0207712_10032971 3300025961 Bacteria 3498
226 Ga0207668_10033679 3300025972 Bacteria 3395
227 Ga0207668_10515587 3300025972 Bacteria 1031
228 Ga0207668_10565639 3300025972 Bacteria 987
229 Ga0207668_10744639 3300025972 Bacteria 864
230 Ga0207640_10224444 3300025981 Bacteria 1441
231 Ga0207658_10142555 3300025986 Bacteria 1941
232 Ga0207703_10000001 3300026035 Bacteria 822925
233 Ga0207703_10000005 3300026035 Bacteria 506356
234 Ga0207703_10010127 3300026035 Bacteria 7390
235 Ga0207703_10073459 3300026035 Bacteria 2829
236 Ga0207703_11085085 3300026035 Bacteria 769
237 Ga0207678_10009232 3300026067 Bacteria 8677
238 Ga0207678_10050234 3300026067 Bacteria 3603
239 Ga0207708_10000006 3300026075 Bacteria 266916
240 Ga0207702_10116074 3300026078 Bacteria 2388
241 Ga0207702_10290604 3300026078 Bacteria 1548
242 Ga0207702_10477570 3300026078 Bacteria 1213
243 Ga0207641_10002336 3300026088 Bacteria 17570
244 Ga0207641_10019942 3300026088 Bacteria 5503
245 Ga0207641_10061132 3300026088 Bacteria 3212
246 Ga0207674_10042871 3300026116 Bacteria 4669
247 Ga0207674_10160121 3300026116 Bacteria 2205
248 Ga0207674_10437989 3300026116 Bacteria 1263
249 Ga0207674_10829589 3300026116 Bacteria 892
250 Ga0207674_10851314 3300026116 Bacteria 879
251 Ga0207674_11010344 3300026116 Bacteria 801
252 Ga0207698_10072152 3300026142 Bacteria 2743
253 Ga0207698_10122038 3300026142 Bacteria 2207
254 Ga0268266_10007158 3300028379 Bacteria 10109
255 Ga0268266_10015387 3300028379 Bacteria 6564
256 Ga0268266_11021038 3300028379 Bacteria 800
257 Ga0268265_10000036 3300028380 Bacteria 203278
258 Ga0268264_10000027 3300028381 Bacteria 440852
259 Ga0265326_10001843 3300028558 Bacteria 7269
260 Ga0265319_1001655 3300028563 Bacteria 12897
261 Ga0265334_10001004 3300028573 Bacteria 13903
262 Ga0265318_10029363 3300028577 Bacteria 2144
263 Ga0265323_10002194 3300028653 Bacteria 9100
264 Ga0265322_10008706 3300028654 Bacteria 2955
265 Ga0265336_10016413 3300028666 Bacteria 2421
266 Ga0307515_10010194 3300028794 Bacteria 18048
267 Ga0265338_10000375 3300028800 Bacteria 79976
268 Ga0265338_10002853 3300028800 Bacteria 25261
269 Ga0265338_10392240 3300028800 Bacteria 991
270 Ga0265324_10015922 3300029957 Bacteria 2758
271 Ga0307511_10140723 3300030521 Bacteria 1419
272 Ga0316176_1120625 3300030732 Bacteria 1221
273 Ga0265332_10020884 3300031238 Bacteria 2892
274 Ga0265320_10004313 3300031240 Bacteria 9345
275 Ga0265325_10036982 3300031241 Bacteria 2583
276 Ga0265325_10164686 3300031241 Bacteria 1041
277 Ga0265340_10018547 3300031247 Bacteria 3588
278 Ga0265327_10000081 3300031251 Bacteria 205988
279 Ga0265327_10022919 3300031251 Bacteria 3714
280 Ga0265316_10024890 3300031344 Bacteria 5003
281 Ga0307513_10000036 3300031456 Bacteria 180080
282 Ga0307513_10540770 3300031456 Bacteria 878
283 Ga0265313_10005443 3300031595 Bacteria 9368
284 Ga0265313_10037699 3300031595 Bacteria 2414
285 Ga0307508_10262837 3300031616 Bacteria 1320
286 Ga0265314_10032072 3300031711 Bacteria 3870
287 Ga0265342_10003186 3300031712 Bacteria 13649
288 Ga0307516_10123274 3300031730 Bacteria 2379
289 Ga0307405_10212608 3300031731 Bacteria 1413
290 Ga0307413_10012439 3300031824 Bacteria 4237
291 Ga0307413_10026265 3300031824 Bacteria 3207
292 Ga0307413_10280386 3300031824 Bacteria 1253
293 Ga0307413_10496477 3300031824 Bacteria 979
294 Ga0307413_11028241 3300031824 Bacteria 708
295 Ga0307406_10167012 3300031901 Bacteria 1589
296 Ga0307406_10252023 3300031901 Bacteria 1330
297 Ga0307406_10609275 3300031901 Bacteria 901
298 Ga0307412_10133184 3300031911 Bacteria 1809
299 Ga0307409_100010653 3300031995 Bacteria 5736
300 Ga0307416_100237269 3300032002 Bacteria 1763
301 Ga0307416_102137156 3300032002 Bacteria 661
302 Ga0307411_10103101 3300032005 Bacteria 2023
303 Ga0307415_100051048 3300032126 Bacteria 2805
304 Ga0307415_100100210 3300032126 Bacteria 2122
305 Ga0316215_1002023 3300033544 Bacteria 1917
306 Ga0316214_1007121 3300033545 Bacteria 1488
307 Ga0373948_0014186 3300034817 Bacteria 1449
308 Ga0373926_0005546 3300035083 Bacteria 4162
309 Ga0373928_0005646 3300035084 Bacteria 2395
310 Ga0373934_0004588 3300035086 Bacteria 5105
311 Ga0373934_0035503 3300035086 Bacteria 1962
312 Ga0373944_0000868 3300035089 Bacteria 7447
313 Ga0373923_0009102 3300035111 Bacteria 3572
314 Ga0373936_0002982 3300035113 Bacteria 6332
315 Ga0373936_0065118 3300035113 Bacteria 1494
316 Ga0373945_0000716 3300035116 Bacteria 9648
317 Ga0373945_0102013 3300035116 Bacteria 1124
318 Ga0373953_0056556 3300035117 Bacteria 1595
319 Ga0373954_0163288 3300035118 Bacteria 1090
320 Ga0373956_0037647 3300035119 Bacteria 2138
321 Ga0373957_0062774 3300035120 Bacteria 1442
322 Ga0373943_0000130 3300035170 Bacteria 28625
323 Ga0373943_0334106 3300035170 Bacteria 866
324 Ga0373946_0001483 3300035171 Bacteria 8163
325 Ga0373955_0006440 3300035172 Bacteria 5347
326 Ga0373955_0329275 3300035172 Bacteria 923
327 Ga0373942_0001479 3300035207 Bacteria 6048
328 Ga0373962_0006085 3300035242 Bacteria 2918
329 Ga0373962_0103802 3300035242 Bacteria 889
330 Ga0373927_0003020 3300035695 Bacteria 12206
331 Ga0373927_0055083 3300035695 Bacteria 2572
332 Ga0373927_0085008 3300035695 Bacteria 2053
333 Ga0373927_0426971 3300035695 Bacteria 875
334 Ga0373933_0034278 3300035724 Bacteria 2957
335 Ga0373933_0371932 3300035724 Bacteria 930
336 Ga0373947_0000859 3300035725 Bacteria 18325
337 Ga0373937_0004414 3300036401 Bacteria 11961
338 Ga0373937_0476539 3300036401 Bacteria 1185
339 Ga0372808_008069 3300036459 Bacteria 1453
340 Ga0373925_0004821 3300037068 Bacteria 10159
341 Ga0373925_0021089 3300037068 Bacteria 4746
342 Ga0373925_0342678 3300037068 Bacteria 1212
343 Ga0395899_0058596 3300037312 Bacteria 2840
344 Ga0395900_0058712 3300037418 Bacteria 3960
345 Ga0395900_0112385 3300037418 Bacteria 2797
346 Ga0395900_0632069 3300037418 Bacteria 1009
347 Ga0395898_0025326 3300037466 Bacteria 5980
348 Ga0395898_0380295 3300037466 Bacteria 1346
349 Ga0395905_0133341 3300037471 Bacteria 2336
350 Ga0436364_0073643 3300037853 Bacteria 2179
351 Ga0436364_0334702 3300037853 Bacteria 3125
352 Ga0436364_0619304 3300037853 Bacteria 133320
353 Ga0436364_0750281 3300037853 Bacteria 1345
354 Ga0436364_0918298 3300037853 Bacteria 3123
355 Ga0436364_1109937 3300037853 Bacteria 12880
356 Ga0436364_1436887 3300037853 Bacteria 3267
357 Ga0436364_1529512 3300037853 Bacteria 24693
358 Ga0395901_0041064 3300038443 Bacteria 4793
359 Ga0395901_0114657 3300038443 Bacteria 2830
360 Ga0436365_0229080 3300039437 Bacteria 1827
361 Ga0436365_0546973 3300039437 Bacteria 5175
362 Ga0436361_1098832 3300039447 Bacteria 1220
363 Ga0436363_1654893 3300039450 Bacteria 2699
364 Ga0436362_0433029 3300039453 Bacteria 25820
365 Ga0439436_0004777 3300041404 Bacteria 4157
366 Ga0439439_0011527 3300041406 Bacteria 2129
367 Ga0439461_0001648 3300041410 Bacteria 3472
368 Ga0439466_0002122 3300041411 Bacteria 7761
369 Ga0439466_0025984 3300041411 Bacteria 2039
370 Ga0439465_0008854 3300041413 Bacteria 3171
371 Ga0451843_1213717 3300041509 Bacteria 685
372 Ga0451855_1355414 3300041511 Bacteria 1534
373 Ga0451853_1711214 3300041512 Bacteria 2988
374 Ga0439431_0000763 3300041997 Bacteria 6959
375 Ga0439442_045320 3300042002 Bacteria 926
376 Ga0439445_0003022 3300042004 Bacteria 3765
377 Ga0439449_0010170 3300042007 Bacteria 3556
378 Ga0439434_0002936 3300042435 Bacteria 4979
379 Ga0466972_0011564 3300044658 Bacteria 4431
380 Ga0466965_0037619 3300044683 Bacteria 2376
381 Ga0466965_0330294 3300044683 Bacteria 832
382 Ga0466966_0144511 3300044684 Bacteria 1452
383 Ga0466963_0052001 3300044694 Bacteria 2717
384 Ga0466963_0154485 3300044694 Bacteria 1595
385 Ga0466963_0306592 3300044694 Bacteria 1117
386 Ga0466970_0008163 3300044765 Bacteria 5256
387 Ga0466970_0021385 3300044765 Bacteria 3369
388 Ga0466970_0321283 3300044765 Bacteria 875
389 Ga0466957_0024443 3300044842 Bacteria 3575
390 Ga0466960_0014451 3300044901 Bacteria 3379
391 Ga0466960_0064299 3300044901 Bacteria 1809
392 Ga0466959_0006884 3300045049 Bacteria 7933
393 Ga0466958_0267417 3300045836 Bacteria 1095
394 Ga0466958_0330671 3300045836 Bacteria 980
395 Ga0466967_0001549 3300045976 Bacteria 13465
396 Ga0466967_0024659 3300045976 Bacteria 4949
397 Ga0466967_0045503 3300045976 Bacteria 3814
398 Ga0466967_0198934 3300045976 Bacteria 1897
399 Ga0466967_0513890 3300045976 Bacteria 1176
400 Ga0466967_0519447 3300045976 Bacteria 1170
401 Ga0466967_0545779 3300045976 Bacteria 1141
402 Ga0466967_0662351 3300045976 Bacteria 1033
403 Ga0466967_0814580 3300045976 Bacteria 927
404 Ga0466967_0902438 3300045976 Bacteria 879
405 Ga0495592_0060084 3300046454 Bacteria 2797
406 Ga0495592_0240872 3300046454 Bacteria 1200
407 Ga0495641_0020614 3300046461 Bacteria 3337
408 Ga0495651_0001625 3300046462 Bacteria 17408
409 Ga0495651_0018640 3300046462 Bacteria 5377
410 Ga0495653_0007099 3300046463 Bacteria 9183
411 Ga0495653_0012007 3300046463 Bacteria 7071
412 Ga0495653_0319723 3300046463 Bacteria 1006
413 Ga0495582_0016149 3300046473 Bacteria 4091
414 Ga0495664_0003273 3300046477 Bacteria 8804
415 Ga0495664_0076885 3300046477 Bacteria 1998
416 Ga0495664_0184767 3300046477 Bacteria 1264
417 Ga0495594_0027564 3300046499 Bacteria 3062
418 Ga0495607_0008802 3300046501 Bacteria 6871
419 Ga0495608_0000820 3300046511 Bacteria 21754
420 Ga0495608_0154135 3300046511 Bacteria 1463
421 Ga0495618_0019630 3300046514 Bacteria 4160
422 Ga0495618_0022673 3300046514 Bacteria 3879
423 Ga0495618_0142483 3300046514 Bacteria 1533
424 Ga0495628_0017435 3300046516 Bacteria 5979
425 Ga0495628_0172777 3300046516 Bacteria 1638
426 Ga0495628_0257882 3300046516 Bacteria 1300
427 Ga0495630_0007824 3300046517 Bacteria 7655
428 Ga0495648_0011573 3300046524 Bacteria 6636
429 Ga0495652_0016462 3300046529 Bacteria 6614
430 Ga0495652_0091995 3300046529 Bacteria 2479
431 Ga0495652_0114343 3300046529 Bacteria 2165
432 Ga0495652_0170812 3300046529 Bacteria 1678
433 Ga0495665_0022445 3300046531 Bacteria 3394
434 Ga0495640_0033366 3300046533 Bacteria 3657
435 Ga0495640_0051682 3300046533 Bacteria 2824
436 Ga0495640_0621776 3300046533 Bacteria 651
437 Ga0495586_0203479 3300046535 Bacteria 1123
438 Ga0495587_0046406 3300046536 Bacteria 2579
439 Ga0495587_0142336 3300046536 Bacteria 1368
440 Ga0495645_0017633 3300046543 Bacteria 5116
441 Ga0495645_0078193 3300046543 Bacteria 2378
442 Ga0495645_0181643 3300046543 Bacteria 1441
443 Ga0495667_0003813 3300046559 Bacteria 10122
444 Ga0495667_0005758 3300046559 Bacteria 8392
445 Ga0495634_0010918 3300046642 Bacteria 6630
446 Ga0495635_0002325 3300046663 Bacteria 12920
447 Ga0495635_0005287 3300046663 Bacteria 8980
448 Ga0495635_0075167 3300046663 Bacteria 2315
449 Ga0495657_0008441 3300046675 Bacteria 7875
450 Ga0495599_0156616 3300046678 Bacteria 1409
451 Ga0495623_0399723 3300046679 Bacteria 739
452 Ga0495646_0133572 3300046680 Bacteria 1395
453 Ga0495624_0003787 3300046690 Bacteria 11174
454 Ga0495624_0308699 3300046690 Bacteria 953
455 Ga0495600_0000417 3300046809 Bacteria 21954
456 Ga0495600_0131600 3300046809 Bacteria 1626
457 Ga0495581_0018199 3300047315 Bacteria 4081
458 Ga0495604_0119804 3300047317 Bacteria 1906
459 Ga0495604_0161600 3300047317 Bacteria 1582
460 Ga0495674_0004740 3300047319 Bacteria 13077
461 Ga0495674_0006023 3300047319 Bacteria 11649
462 Ga0495674_0196862 3300047319 Bacteria 1673
463 Ga0495674_0248924 3300047319 Bacteria 1463
464 Ga0495676_0163773 3300047321 Bacteria 1571
465 Ga0495676_0248522 3300047321 Bacteria 1214
466 Ga0495680_0013265 3300047322 Bacteria 7199
467 Ga0495680_0031165 3300047322 Bacteria 4344
468 Ga0495683_0000307 3300047323 Bacteria 41369
469 Ga0495675_0433014 3300047444 Bacteria 763
470 Ga0495684_0008594 3300047471 Bacteria 7904
471 Ga0495684_0012523 3300047471 Bacteria 6536
472 Ga0495593_0187831 3300047673 Bacteria 1040
473 Ga0495593_0285844 3300047673 Bacteria 825
474 Ga0495602_0009196 3300048088 Bacteria 10284
475 Ga0495602_0062659 3300048088 Bacteria 3226
476 Ga0495602_0222825 3300048088 Bacteria 1422
477 Ga0495602_0433631 3300048088 Bacteria 931
478 Ga0496100_0034211 3300048903 Bacteria 3187
479 Ga0496101_0087550 3300048904 Bacteria 2312
480 Ga0496101_0187317 3300048904 Bacteria 1596
481 Ga0496101_0271512 3300048904 Bacteria 1324
482 Ga0496102_0087660 3300048905 Bacteria 2876
483 Ga0496102_0258259 3300048905 Bacteria 1642
484 Ga0496102_0923121 3300048905 Bacteria 794
485 Ga0496103_0167281 3300048906 Bacteria 1411
486 Ga0496104_0004858 3300048907 Bacteria 11710
487 Ga0496104_0487496 3300048907 Bacteria 1144
488 Ga0496104_0871526 3300048907 Bacteria 806
489 Ga0496105_0032739 3300048908 Bacteria 4267
490 Ga0496106_0239492 3300048909 Bacteria 1450
491 Ga0496107_0269642 3300048910 Bacteria 1267
492 Ga0496108_0010895 3300048911 Bacteria 7380
493 Ga0496108_0101447 3300048911 Bacteria 2455
494 Ga0496108_0272968 3300048911 Bacteria 1472
495 Ga0496108_0487448 3300048911 Bacteria 1077
496 Ga0496109_0016313 3300048912 Bacteria 6492
497 Ga0496109_0017171 3300048912 Bacteria 6338
498 Ga0496110_0021350 3300048913 Bacteria 5479
499 Ga0496110_0062483 3300048913 Bacteria 3289
500 Ga0496110_0343015 3300048913 Bacteria 1361
501 Ga0496111_0011388 3300048914 Bacteria 5989
502 Ga0496111_0366615 3300048914 Bacteria 1066
503 Ga0496112_0009059 3300048915 Bacteria 8941
504 Ga0496112_0026126 3300048915 Bacteria 5614
505 Ga0496112_0095227 3300048915 Bacteria 2948
506 Ga0496112_0362170 3300048915 Bacteria 1392
507 Ga0496112_0852810 3300048915 Bacteria 834
508 Ga0496113_0009174 3300048916 Bacteria 6485
509 Ga0496113_0010820 3300048916 Bacteria 6053
510 Ga0496113_0329123 3300048916 Bacteria 1225
511 Ga0496114_0071896 3300048917 Bacteria 2908
512 Ga0496114_0115374 3300048917 Bacteria 2304
513 Ga0496114_0251927 3300048917 Bacteria 1554
514 Ga0496116_0000310 3300048919 Bacteria 81470
515 Ga0496117_0024497 3300048920 Bacteria 4772
516 Ga0496118_0021538 3300048921 Bacteria 5669
517 Ga0496119_0001466 3300048922 Bacteria 28240
518 Ga0496119_0009177 3300048922 Bacteria 8542
519 Ga0496119_0044332 3300048922 Bacteria 2802
520 Ga0496120_0002341 3300048923 Bacteria 19478
521 Ga0496121_0015092 3300048924 Bacteria 8127
522 Ga0496121_0041629 3300048924 Bacteria 4012
523 Ga0496126_0000006 3300048929 Bacteria 798804
524 Ga0496126_0008928 3300048929 Bacteria 10734
525 Ga0496126_0164119 3300048929 Bacteria 1897
526 Ga0501031_0171228 3300049568 Bacteria 1419
527 Ga0501033_0479173 3300049570 Bacteria 862
528 Ga0501034_0224573 3300049571 Bacteria 1829
529 Ga0501034_0302219 3300049571 Bacteria 1537
530 Ga0501034_0369402 3300049571 Bacteria 1361
531 Ga0501036_0001795 3300049572 Bacteria 16659
532 Ga0501036_0119546 3300049572 Bacteria 2225
533 Ga0501036_0123681 3300049572 Bacteria 2185
534 Ga0501036_0768558 3300049572 Bacteria 794
535 Ga0501037_0027253 3300049573 Bacteria 4221
536 Ga0501037_0078608 3300049573 Bacteria 2394
537 Ga0501037_0261934 3300049573 Bacteria 1208
538 Ga0501038_0022030 3300049574 Bacteria 5714
539 Ga0501038_0085770 3300049574 Bacteria 2647
540 Ga0501038_0322908 3300049574 Bacteria 1207
541 Ga0501038_0349262 3300049574 Bacteria 1152
542 Ga0501039_0025278 3300049575 Bacteria 4562
543 Ga0501039_0539715 3300049575 Bacteria 915
544 Ga0501041_0296031 3300049577 Bacteria 1019
545 Ga0501042_0046091 3300049578 Bacteria 3108
546 Ga0501042_0629886 3300049578 Bacteria 780
547 Ga0501043_0014677 3300049579 Bacteria 6133
548 Ga0501043_0512284 3300049579 Bacteria 895
549 Ga0501046_0054853 3300049580 Bacteria 3133
550 Ga0501047_0007046 3300049581 Bacteria 10554
551 Ga0501047_0161145 3300049581 Bacteria 2115
552 Ga0501047_0280814 3300049581 Bacteria 1510
553 Ga0501047_0446416 3300049581 Bacteria 1123
554 Ga0501048_0005497 3300049582 Bacteria 9642
555 Ga0501048_0203869 3300049582 Bacteria 1402
556 Ga0501067_0000719 3300049583 Bacteria 17849
557 Ga0501067_0089514 3300049583 Bacteria 1708
558 Ga0501068_0063291 3300049584 Bacteria 2250
559 Ga0501068_0065105 3300049584 Bacteria 2218
560 Ga0501068_0162720 3300049584 Bacteria 1407
561 Ga0501069_0057175 3300049585 Bacteria 2174
562 Ga0501069_0189476 3300049585 Bacteria 1190
563 Ga0501069_0205059 3300049585 Bacteria 1143
564 Ga0501069_0393388 3300049585 Bacteria 820
565 Ga0501070_0012959 3300049586 Bacteria 7027
566 Ga0501070_0287593 3300049586 Bacteria 1340
567 Ga0501071_0110056 3300049587 Bacteria 2035
568 Ga0501071_0131864 3300049587 Bacteria 1857
569 Ga0501071_0206098 3300049587 Bacteria 1478
570 Ga0501071_0242609 3300049587 Bacteria 1359
571 Ga0501071_0394462 3300049587 Bacteria 1056
572 Ga0501072_0018063 3300049588 Bacteria 5423
573 Ga0501072_0380493 3300049588 Bacteria 1120
574 Ga0501073_0008951 3300049589 Bacteria 7394
575 Ga0501073_0009218 3300049589 Bacteria 7277
576 Ga0501073_0357893 3300049589 Bacteria 1008
577 Ga0501074_0001106 3300049590 Bacteria 17610
578 Ga0501074_0013656 3300049590 Bacteria 5903
579 Ga0501074_0085137 3300049590 Bacteria 2265
580 Ga0501074_0227699 3300049590 Bacteria 1327
581 Ga0501075_0024203 3300049591 Bacteria 4449
582 Ga0501076_0106465 3300049592 Bacteria 2264
583 Ga0501077_0034672 3300049593 Bacteria 3212
584 Ga0501077_0257201 3300049593 Bacteria 1111
585 Ga0501079_0018176 3300049741 Bacteria 5370
586 Ga0501079_0099348 3300049741 Bacteria 2255
587 Ga0501080_0098962 3300049742 Bacteria 2706
588 Ga0501080_0230125 3300049742 Bacteria 1694
589 Ga0501080_0417543 3300049742 Bacteria 1206
590 Ga0501083_0329309 3300049744 Bacteria 993
591 Ga0501035_0000279 3300049822 Bacteria 60584
592 Ga0501035_0059930 3300049822 Bacteria 3390
593 Ga0501044_0003828 3300049823 Bacteria 16888
594 Ga0501044_0066316 3300049823 Bacteria 3681
595 Ga0501044_0329654 3300049823 Bacteria 1449
596 Ga0501044_0661914 3300049823 Bacteria 932
597 Ga0501044_0696410 3300049823 Bacteria 902
598 Ga0501045_0625179 3300049824 Bacteria 797
599 nmdc:mga03683_12456_c1 3300050489 Bacteria 3107
600 nmdc:mga03n38_122174_c1 3300050490 Bacteria 1281
601 nmdc:mga03n38_158218_c1 3300050490 Bacteria 1145
602 nmdc:mga03n38_340655_c1 3300050490 Bacteria 814
603 nmdc:mga03n38_495_c1 3300050490 Bacteria 9900
604 nmdc:mga00v17_154798_c1 3300050491 Bacteria 1474
605 nmdc:mga00v17_16308_c1 3300050491 Bacteria 2700
606 nmdc:mga00v17_195263_c1 3300050491 Bacteria 1308
607 nmdc:mga0yw44_1796_c1 3300050492 Bacteria 8757
608 nmdc:mga0yw44_195110_c1 3300050492 Bacteria 1336
609 nmdc:mga0yw44_2268_c1 3300050492 Bacteria 8110
610 nmdc:mga0yw44_239672_c1 3300050492 Bacteria 1205
611 nmdc:mga0yw44_286051_c1 3300050492 Bacteria 1102
612 nmdc:mga0yw44_338581_c1 3300050492 Bacteria 1012
613 nmdc:mga07m45_150377_c1 3300050496 Bacteria 1350
614 nmdc:mga07m45_21750_c1 3300050496 Bacteria 3496
615 nmdc:mga07m45_410479_c1 3300050496 Bacteria 786
616 nmdc:mga09592_649852_c1 3300050508 Bacteria 900
617 nmdc:mga06r32_566977_c1 3300050510 Bacteria 1108
618 nmdc:mga08y16_324108_c1 3300050511 Bacteria 1585
619 nmdc:mga08x19_804373_c1 3300050514 Bacteria 668
620 Ga0495601_0258270 3300053077 Bacteria 1137
621 Ga0495655_0007260 3300053083 Bacteria 2052
622 Ga0495655_0128270 3300053083 Bacteria 779
623 Ga0495619_0007016 3300053085 Bacteria 7128
624 Ga0500616_0006155 3300053153 Bacteria 7935
625 Ga0501084_0111939 3300054114 Bacteria 2294
626 Ga0501084_0153840 3300054114 Bacteria 1939
627 Ga0501084_0611676 3300054114 Bacteria 920
628 Ga0501082_0069726 3300060353 Bacteria 3027
629 Ga0501082_0109390 3300060353 Bacteria 2392
630 2506866663 2506783011 Bacteria 5323186
631 2548694740 2547132424 Bacteria 8348532
632 2552107303 2551306166 Bacteria 9731570
633 2644518250 2643221692 Bacteria 7282860
634 2644635188 2643221715 Bacteria 6671032
635 2676487454 2675903059 Bacteria 8644972
636 2739239324 2738543011 Bacteria 5731169
637 2739366809 2738543034 Bacteria 6084756
638 2753268218 2751185782 Bacteria 11227053
639 2774905825 2773857933 Bacteria 5818019
640 2791914530 2791354901 Bacteria 8322202
641 2795796060 2795385472 Bacteria 6627535
642 2842137747 2842134933 Bacteria 5847019
643 2861523862 2861520306 Bacteria 8348283
644 2889302041 2889300758 Bacteria 5690814
645 2902803878 2902799365 Bacteria 5419524
646 2902812925 2902810491 Bacteria 6794147
647 2904769261 2904765812 Bacteria 5369154
648 2904772817 2904770941 Bacteria 5580202
649 2908814377 2908811453 Bacteria 5478616
650 2919422818 2919420072 Bacteria 5390363
651 2919434929 2919432681 Bacteria 5390474
652 2919718842 2919713450 Bacteria 7431245
653 2928147308 2928142448 Bacteria 5288925
654 2939748137 2939743619 Bacteria 5762299
655 2974317834 2974315732 Bacteria 4602776
656 2984526043 2984523437 Bacteria 4508481
657 3001120310 3001119090 Bacteria 3449530
658 8003862341 8003856774 Bacteria 7675274
659 8056059846 8056054917 Bacteria 5736694
660 8057572262 8057568493 Bacteria 7221719
661 Ga0265340_10050248
662 LJNas_1003596
663 JGI25406J46586_10001203
664 JGI25406J46586_10048222
665 JGI25404J52841_10002182
666 Ga0070658_10027899
667 Ga0070658_10108439
668 Ga0070658_10255182
669 Ga0070658_10418698
670 Ga0070683_100098073
671 Ga0070683_100416568
672 Ga0070666_10006654
673 Ga0070680_100007560
674 Ga0070682_100200720
675 Ga0070682_100258209
676 Ga0068868_100466627
677 Ga0070660_100041886
678 Ga0070660_100328370
679 Ga0070691_10158893
680 Ga0070661_100258054
681 Ga0070692_10067865
682 Ga0070668_100121757
683 Ga0070668_100596469
684 Ga0070675_100596941
685 Ga0070671_100698028
686 Ga0070674_100343254
687 Ga0070659_100552263
688 Ga0070667_100997248
689 Ga0070709_10203026
690 Ga0070714_100003556
691 Ga0070714_100004941
692 Ga0070714_100012181
693 Ga0070714_100040836
694 Ga0070714_100511966
695 Ga0070714_101110624
696 Ga0070713_100006155
697 Ga0070713_100048478
698 Ga0070713_100064371
699 Ga0070713_100481029
700 Ga0070710_10036555
701 Ga0070710_10089311
702 Ga0070711_100047637
703 Ga0070700_100000007
704 Ga0070694_100159277
705 Ga0070708_100004824
706 Ga0070708_100124979
707 Ga0070708_100677670
708 Ga0070663_100092399
709 Ga0070663_100225091
710 Ga0070681_10006486
711 Ga0070706_100002251
712 Ga0070707_100003511
713 Ga0070707_100279615
714 Ga0070698_100044332
715 Ga0070698_100407361
716 Ga0070698_100732411
717 Ga0070679_100011786
718 Ga0070679_100033404
719 Ga0070679_100113269
720 Ga0070684_100017540
721 Ga0070684_100033118
722 Ga0070684_100207714
723 Ga0070684_100313032
724 Ga0070684_100799584
725 Ga0070697_100011126
726 Ga0070665_100005785
727 Ga0070665_100017852
728 Ga0070665_100154651
729 Ga0070665_100803523
730 Ga0070665_100988194
731 Ga0070704_100026023
732 Ga0068855_100009962
733 Ga0070664_100320214
734 Ga0068857_100507391
735 Ga0068857_100690648
736 Ga0068854_100202304
737 Ga0068856_100349262
738 Ga0068856_100455271
739 Ga0068852_100025365
740 Ga0068859_100001215
741 Ga0068864_100007963
742 Ga0068863_100001488
743 Ga0068863_100006413
744 Ga0068863_100048862
745 Ga0068858_100000014
746 Ga0068858_100001815
747 Ga0068858_100005406
748 Ga0068860_100000124
749 Ga0068860_100042277
750 Ga0068862_100240954
751 Ga0081455_10043262
752 Ga0081455_10298029
753 Ga0081540_1000322
754 Ga0081540_1004915
755 Ga0081540_1047957
756 Ga0081539_10000775
757 Ga0081539_10002336
758 Ga0070717_10057262
759 Ga0070717_10095173
760 Ga0075365_10000795
761 Ga0075365_10309195
762 Ga0075363_100001054
763 Ga0075363_100005975
764 Ga0075363_100092788
765 Ga0075363_100142181
766 Ga0075364_10022410
767 Ga0070715_10099112
768 Ga0070712_100419791
769 Ga0075367_10005490
770 Ga0075367_10029838
771 Ga0075367_10239202
772 Ga0075369_10003960
773 Ga0075370_10005188
774 Ga0075370_10184179
775 Ga0075428_100357482
776 Ga0075428_100479952
777 Ga0075436_100131726
778 Ga0097620_100001215
779 Ga0105240_10004243
780 Ga0105240_10050695
781 Ga0105240_10620936
782 Ga0105245_10220167
783 Ga0105245_10448336
784 Ga0105245_10540573
785 Ga0105247_10000049
786 Ga0105247_10000553
787 Ga0105247_10219623
788 Ga0105243_10002999
789 Ga0105243_10193470
790 Ga0105248_10000132
791 Ga0105248_10002822
792 Ga0105237_10524263
793 Ga0105238_10756640
794 Ga0105249_10039336
795 Ga0099796_10140474
796 Ga0105239_10387256
797 Ga0157371_10177507
798 Ga0157370_10001477
799 Ga0157370_10233803
800 Ga0157370_10235748
801 Ga0157370_10571275
802 Ga0157369_10001670
803 Ga0157369_10009536
804 Ga0157369_10731887
805 Ga0157369_10999222
806 Ga0157372_10000079
807 Ga0157372_11047355
808 Ga0163163_10002140
809 Ga0163163_10050223
810 Ga0163163_10256614
811 Ga0163163_10263774
812 Ga0163163_10287399
813 Ga0163163_10817901
814 Ga0157379_10030567
815 Ga0157379_10188111
816 Ga0157379_10948112
817 Ga0182005_1039425
818 Ga0197907_10591287
819 Ga0206356_11054090
820 Ga0206351_10643484
821 Ga0206350_11433914
822 Ga0206353_11083094
823 Ga0154015_1062170
824 Ga0154015_1360837
825 Ga0213875_10000071
826 Ga0213875_10013030
827 Ga0224712_10025320
828 Ga0224712_10114841
829 Ga0228600_1006473
830 Ga0207692_10036671
831 Ga0207692_10155061
832 Ga0207710_10000035
833 Ga0207710_10000073
834 Ga0207680_10001339
835 Ga0207705_10006949
836 Ga0207705_10012507
837 Ga0207705_10057919
838 Ga0207684_10003086
839 Ga0207707_10077049
840 Ga0207695_10008901
841 Ga0207695_10038436
842 Ga0207693_10090382
843 Ga0207663_10036742
844 Ga0207663_10093191
845 Ga0207660_10085477
846 Ga0207660_10094134
847 Ga0207657_10029172
848 Ga0207657_10056699
849 Ga0207652_10010333
850 Ga0207652_10012218
851 Ga0207652_10505135
852 Ga0207646_10004059
853 Ga0207646_10305022
854 Ga0207694_10104405
855 Ga0207659_10567249
856 Ga0207687_10269941
857 Ga0207687_10284835
858 Ga0207687_10471915
859 Ga0207700_10007224
860 Ga0207700_10009070
861 Ga0207700_10378661
862 Ga0207700_10388680
863 Ga0207664_10000905
864 Ga0207664_10005795
865 Ga0207664_10015437
866 Ga0207664_10161500
867 Ga0207664_10175060
868 Ga0207664_10335899
869 Ga0207664_10390581
870 Ga0207664_10681397
871 Ga0207690_10426920
872 Ga0207690_10529222
873 Ga0207709_10003528
874 Ga0207709_10323460
875 Ga0207669_10037457
876 Ga0207669_10533430
877 Ga0207665_10576352
878 Ga0207711_10000139
879 Ga0207711_10001985
880 Ga0207711_10056534
881 Ga0207661_10034973
882 Ga0207661_10092008
883 Ga0207661_10246238
884 Ga0207667_10020380
885 Ga0207712_10032971
886 Ga0207668_10033679
887 Ga0207668_10515587
888 Ga0207668_10565639
889 Ga0207668_10744639
890 Ga0207640_10224444
891 Ga0207658_10142555
892 Ga0207703_10000001
893 Ga0207703_10000005
894 Ga0207703_10010127
895 Ga0207703_10073459
896 Ga0207703_11085085
897 Ga0207678_10009232
898 Ga0207678_10050234
899 Ga0207708_10000006
900 Ga0207702_10116074
901 Ga0207702_10290604
902 Ga0207702_10477570
903 Ga0207641_10002336
904 Ga0207641_10019942
905 Ga0207641_10061132
906 Ga0207674_10042871
907 Ga0207674_10160121
908 Ga0207674_10437989
909 Ga0207674_10829589
910 Ga0207674_10851314
911 Ga0207674_11010344
912 Ga0207698_10072152
913 Ga0207698_10122038
914 Ga0268266_10007158
915 Ga0268266_10015387
916 Ga0268266_11021038
917 Ga0268265_10000036
918 Ga0268264_10000027
919 Ga0265326_10001843
920 Ga0265319_1001655
921 Ga0265334_10001004
922 Ga0265318_10029363
923 Ga0265323_10002194
924 Ga0265322_10008706
925 Ga0265336_10016413
926 Ga0307515_10010194
927 Ga0265338_10000375
928 Ga0265338_10002853
929 Ga0265338_10392240
930 Ga0265324_10015922
931 Ga0307511_10140723
932 Ga0316176_1120625
933 Ga0265332_10020884
934 Ga0265320_10004313
935 Ga0265325_10036982
936 Ga0265325_10164686
937 Ga0265340_10018547
938 Ga0265327_10000081
939 Ga0265327_10022919
940 Ga0265316_10024890
941 Ga0307513_10000036
942 Ga0307513_10540770
943 Ga0265313_10005443
944 Ga0265313_10037699
945 Ga0307508_10262837
946 Ga0265314_10032072
947 Ga0265342_10003186
948 Ga0307516_10123274
949 Ga0307405_10212608
950 Ga0307413_10012439
951 Ga0307413_10026265
952 Ga0307413_10280386
953 Ga0307413_10496477
954 Ga0307413_11028241
955 Ga0307406_10167012
956 Ga0307406_10252023
957 Ga0307406_10609275
958 Ga0307412_10133184
959 Ga0307409_100010653
960 Ga0307416_100237269
961 Ga0307416_102137156
962 Ga0307411_10103101
963 Ga0307415_100051048
964 Ga0307415_100100210
965 Ga0316215_1002023
966 Ga0316214_1007121
967 Ga0373948_0014186
968 Ga0373926_0005546
969 Ga0373928_0005646
970 Ga0373934_0004588
971 Ga0373934_0035503
972 Ga0373944_0000868
973 Ga0373923_0009102
974 Ga0373936_0002982
975 Ga0373936_0065118
976 Ga0373945_0000716
977 Ga0373945_0102013
978 Ga0373953_0056556
979 Ga0373954_0163288
980 Ga0373956_0037647
981 Ga0373957_0062774
982 Ga0373943_0000130
983 Ga0373943_0334106
984 Ga0373946_0001483
985 Ga0373955_0006440
986 Ga0373955_0329275
987 Ga0373942_0001479
988 Ga0373962_0006085
989 Ga0373962_0103802
990 Ga0373927_0003020
991 Ga0373927_0055083
992 Ga0373927_0085008
993 Ga0373927_0426971
994 Ga0373933_0034278
995 Ga0373933_0371932
996 Ga0373947_0000859
997 Ga0373937_0004414
998 Ga0373937_0476539
999 Ga0372808_008069
1000 Ga0373925_0004821
1001 Ga0373925_0021089
1002 Ga0373925_0342678
1003 Ga0395899_0058596
1004 Ga0395900_0058712
1005 Ga0395900_0112385
1006 Ga0395900_0632069
1007 Ga0395898_0025326
1008 Ga0395898_0380295
1009 Ga0395905_0133341
1010 Ga0436364_0073643
1011 Ga0436364_0334702
1012 Ga0436364_0619304
1013 Ga0436364_0750281
1014 Ga0436364_0918298
1015 Ga0436364_1109937
1016 Ga0436364_1436887
1017 Ga0436364_1529512
1018 Ga0395901_0041064
1019 Ga0395901_0114657
1020 Ga0436365_0229080
1021 Ga0436365_0546973
1022 Ga0436361_1098832
1023 Ga0436363_1654893
1024 Ga0436362_0433029
1025 Ga0439436_0004777
1026 Ga0439439_0011527
1027 Ga0439461_0001648
1028 Ga0439466_0002122
1029 Ga0439466_0025984
1030 Ga0439465_0008854
1031 Ga0451843_1213717
1032 Ga0451855_1355414
1033 Ga0451853_1711214
1034 Ga0439431_0000763
1035 Ga0439442_045320
1036 Ga0439445_0003022
1037 Ga0439449_0010170
1038 Ga0439434_0002936
1039 Ga0466972_0011564
1040 Ga0466965_0037619
1041 Ga0466965_0330294
1042 Ga0466966_0144511
1043 Ga0466963_0052001
1044 Ga0466963_0154485
1045 Ga0466963_0306592
1046 Ga0466970_0008163
1047 Ga0466970_0021385
1048 Ga0466970_0321283
1049 Ga0466957_0024443
1050 Ga0466960_0014451
1051 Ga0466960_0064299
1052 Ga0466959_0006884
1053 Ga0466958_0267417
1054 Ga0466958_0330671
1055 Ga0466967_0001549
1056 Ga0466967_0024659
1057 Ga0466967_0045503
1058 Ga0466967_0198934
1059 Ga0466967_0513890
1060 Ga0466967_0519447
1061 Ga0466967_0545779
1062 Ga0466967_0662351
1063 Ga0466967_0814580
1064 Ga0466967_0902438
1065 Ga0495592_0060084
1066 Ga0495592_0240872
1067 Ga0495641_0020614
1068 Ga0495651_0001625
1069 Ga0495651_0018640
1070 Ga0495653_0007099
1071 Ga0495653_0012007
1072 Ga0495653_0319723
1073 Ga0495582_0016149
1074 Ga0495664_0003273
1075 Ga0495664_0076885
1076 Ga0495664_0184767
1077 Ga0495594_0027564
1078 Ga0495607_0008802
1079 Ga0495608_0000820
1080 Ga0495608_0154135
1081 Ga0495618_0019630
1082 Ga0495618_0022673
1083 Ga0495618_0142483
1084 Ga0495628_0017435
1085 Ga0495628_0172777
1086 Ga0495628_0257882
1087 Ga0495630_0007824
1088 Ga0495648_0011573
1089 Ga0495652_0016462
1090 Ga0495652_0091995
1091 Ga0495652_0114343
1092 Ga0495652_0170812
1093 Ga0495665_0022445
1094 Ga0495640_0033366
1095 Ga0495640_0051682
1096 Ga0495640_0621776
1097 Ga0495586_0203479
1098 Ga0495587_0046406
1099 Ga0495587_0142336
1100 Ga0495645_0017633
1101 Ga0495645_0078193
1102 Ga0495645_0181643
1103 Ga0495667_0003813
1104 Ga0495667_0005758
1105 Ga0495634_0010918
1106 Ga0495635_0002325
1107 Ga0495635_0005287
1108 Ga0495635_0075167
1109 Ga0495657_0008441
1110 Ga0495599_0156616
1111 Ga0495623_0399723
1112 Ga0495646_0133572
1113 Ga0495624_0003787
1114 Ga0495624_0308699
1115 Ga0495600_0000417
1116 Ga0495600_0131600
1117 Ga0495581_0018199
1118 Ga0495604_0119804
1119 Ga0495604_0161600
1120 Ga0495674_0004740
1121 Ga0495674_0006023
1122 Ga0495674_0196862
1123 Ga0495674_0248924
1124 Ga0495676_0163773
1125 Ga0495676_0248522
1126 Ga0495680_0013265
1127 Ga0495680_0031165
1128 Ga0495683_0000307
1129 Ga0495675_0433014
1130 Ga0495684_0008594
1131 Ga0495684_0012523
1132 Ga0495593_0187831
1133 Ga0495593_0285844
1134 Ga0495602_0009196
1135 Ga0495602_0062659
1136 Ga0495602_0222825
1137 Ga0495602_0433631
1138 Ga0496100_0034211
1139 Ga0496101_0087550
1140 Ga0496101_0187317
1141 Ga0496101_0271512
1142 Ga0496102_0087660
1143 Ga0496102_0258259
1144 Ga0496102_0923121
1145 Ga0496103_0167281
1146 Ga0496104_0004858
1147 Ga0496104_0487496
1148 Ga0496104_0871526
1149 Ga0496105_0032739
1150 Ga0496106_0239492
1151 Ga0496107_0269642
1152 Ga0496108_0010895
1153 Ga0496108_0101447
1154 Ga0496108_0272968
1155 Ga0496108_0487448
1156 Ga0496109_0016313
1157 Ga0496109_0017171
1158 Ga0496110_0021350
1159 Ga0496110_0062483
1160 Ga0496110_0343015
1161 Ga0496111_0011388
1162 Ga0496111_0366615
1163 Ga0496112_0009059
1164 Ga0496112_0026126
1165 Ga0496112_0095227
1166 Ga0496112_0362170
1167 Ga0496112_0852810
1168 Ga0496113_0009174
1169 Ga0496113_0010820
1170 Ga0496113_0329123
1171 Ga0496114_0071896
1172 Ga0496114_0115374
1173 Ga0496114_0251927
1174 Ga0496116_0000310
1175 Ga0496117_0024497
1176 Ga0496118_0021538
1177 Ga0496119_0001466
1178 Ga0496119_0009177
1179 Ga0496119_0044332
1180 Ga0496120_0002341
1181 Ga0496121_0015092
1182 Ga0496121_0041629
1183 Ga0496126_0000006
1184 Ga0496126_0008928
1185 Ga0496126_0164119
1186 Ga0501031_0171228
1187 Ga0501033_0479173
1188 Ga0501034_0224573
1189 Ga0501034_0302219
1190 Ga0501034_0369402
1191 Ga0501036_0001795
1192 Ga0501036_0119546
1193 Ga0501036_0123681
1194 Ga0501036_0768558
1195 Ga0501037_0027253
1196 Ga0501037_0078608
1197 Ga0501037_0261934
1198 Ga0501038_0022030
1199 Ga0501038_0085770
1200 Ga0501038_0322908
1201 Ga0501038_0349262
1202 Ga0501039_0025278
1203 Ga0501039_0539715
1204 Ga0501041_0296031
1205 Ga0501042_0046091
1206 Ga0501042_0629886
1207 Ga0501043_0014677
1208 Ga0501043_0512284
1209 Ga0501046_0054853
1210 Ga0501047_0007046
1211 Ga0501047_0161145
1212 Ga0501047_0280814
1213 Ga0501047_0446416
1214 Ga0501048_0005497
1215 Ga0501048_0203869
1216 Ga0501067_0000719
1217 Ga0501067_0089514
1218 Ga0501068_0063291
1219 Ga0501068_0065105
1220 Ga0501068_0162720
1221 Ga0501069_0057175
1222 Ga0501069_0189476
1223 Ga0501069_0205059
1224 Ga0501069_0393388
1225 Ga0501070_0012959
1226 Ga0501070_0287593
1227 Ga0501071_0110056
1228 Ga0501071_0131864
1229 Ga0501071_0206098
1230 Ga0501071_0242609
1231 Ga0501071_0394462
1232 Ga0501072_0018063
1233 Ga0501072_0380493
1234 Ga0501073_0008951
1235 Ga0501073_0009218
1236 Ga0501073_0357893
1237 Ga0501074_0001106
1238 Ga0501074_0013656
1239 Ga0501074_0085137
1240 Ga0501074_0227699
1241 Ga0501075_0024203
1242 Ga0501076_0106465
1243 Ga0501077_0034672
1244 Ga0501077_0257201
1245 Ga0501079_0018176
1246 Ga0501079_0099348
1247 Ga0501080_0098962
1248 Ga0501080_0230125
1249 Ga0501080_0417543
1250 Ga0501083_0329309
1251 Ga0501035_0000279
1252 Ga0501035_0059930
1253 Ga0501044_0003828
1254 Ga0501044_0066316
1255 Ga0501044_0329654
1256 Ga0501044_0661914
1257 Ga0501044_0696410
1258 Ga0501045_0625179
1259 nmdc:mga03683_12456_c1
1260 nmdc:mga03n38_122174_c1
1261 nmdc:mga03n38_158218_c1
1262 nmdc:mga03n38_340655_c1
1263 nmdc:mga03n38_495_c1
1264 nmdc:mga00v17_154798_c1
1265 nmdc:mga00v17_16308_c1
1266 nmdc:mga00v17_195263_c1
1267 nmdc:mga0yw44_1796_c1
1268 nmdc:mga0yw44_195110_c1
1269 nmdc:mga0yw44_2268_c1
1270 nmdc:mga0yw44_239672_c1
1271 nmdc:mga0yw44_286051_c1
1272 nmdc:mga0yw44_338581_c1
1273 nmdc:mga07m45_150377_c1
1274 nmdc:mga07m45_21750_c1
1275 nmdc:mga07m45_410479_c1
1276 nmdc:mga09592_649852_c1
1277 nmdc:mga06r32_566977_c1
1278 nmdc:mga08y16_324108_c1
1279 nmdc:mga08x19_804373_c1
1280 Ga0495601_0258270
1281 Ga0495655_0007260
1282 Ga0495655_0128270
1283 Ga0495619_0007016
1284 Ga0500616_0006155
1285 Ga0501084_0111939
1286 Ga0501084_0153840
1287 Ga0501084_0611676
1288 Ga0501082_0069726
1289 Ga0501082_0109390
1290 2506866663
1291 2548694740
1292 2552107303
1293 2644518250
1294 2644635188
1295 2676487454
1296 2739239324
1297 2739366809
1298 2753268218
1299 2774905825
1300 2791914530
1301 2795796060
1302 2842137747
1303 2861523862
1304 2889302041
1305 2902803878
1306 2902812925
1307 2904769261
1308 2904772817
1309 2908814377
1310 2919422818
1311 2919434929
1312 2919718842
1313 2928147308
1314 2939748137
1315 2974317834
1316 2984526043
1317 3001120310
1318 8003862341
1319 8056059846
1320 8057572262

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

41

151

0.97

PF03861

ANTAR

ANTAR domain

168

221

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7od9-assembly1.cif.gz_B crystal structure of activated chey fused to the c-terminal domain of chef 0.9679 10 121
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9564 11 124
7ve6-assembly1.cif.gz_B n-terminal domain of vrar 0.9451 13 124
3hzh-assembly1.cif.gz_A crystal structure of the chex-chey-bef3-mg+2 complex from borrelia burgdorferi 0.9394 7 123
5hm6-assembly1.cif.gz_A n-terminal domain of bfmr from acinetobacter baumannii 0.9369 10 128
ID Description Score Start End Superfamily
af_P9WGM3_143_205_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1.014 142 197 1.10.10.10
1s8nA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9993 143 198 1.10.10.10
1sd5A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9981 144 198 1.10.10.10
1qo0E02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9803 150 191 1.10.10.10
1qo0D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9783 150 193 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A656KWU8-F1-model_v4 deleted 0.9958 11 136
AF-A0A1L5L2D7-F1-model_v4 Response regulator receiver domain 0.9887 9 115 GO:0000160
AF-A0A358D4B7-F1-model_v4 Response regulatory domain-containing protein 0.9877 9 114 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7W1TLL1-F1-model_v4 Response regulator 0.9864 11 196 GO:0000156
GO:0000976
GO:0003723
GO:0005829
GO:0006355
GO:0032993
AF-A0A7X6ENQ6-F1-model_v4 deleted 0.9852 8 114

Map