F473344
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 660 | 355 | 1320 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300031247|Ga0265340_10050248|Ga0265340_100502482 |
| Length | 246 |
| Sequence | VGEKQVPTPADIAKARPSPSGPVVRPSTGEAQPSPPARSRVVIAEDEALIRLDLKETLHELGYEVVGEAGDGEQAVALAQELRPDLVILDVKMPVLDGISAAQRIAAARIAPVVILTAFSQRDLIERARDAGAMAYLVKPFSAADLMPAIEMALSRYAEAAALGAEVSNLTEQLATRKVLDRAKGILQSTRQLSEPQAFRWIQQSAMDQRVSMRAIADAVIATATPSAAPEPGSATGNDARPPIRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 62 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 89 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 90 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Metagenome | Unclassified |
| 92 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 132 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 133 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 135 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 136 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 139 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 142 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 143 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 145 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 146 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 147 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 149 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 151 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 154 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 163 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 164 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 166 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 171 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 176 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 194 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 195 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 196 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 197 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 198 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 199 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 200 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 201 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 202 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 203 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 204 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 205 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 206 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 207 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 208 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 209 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 210 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 211 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 215 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 216 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 217 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 218 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 265 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 266 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 270 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 271 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 274 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 275 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 276 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 277 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 278 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 312 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 315 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 323 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 326 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 327 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 328 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 329 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 330 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 331 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 332 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 333 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 334 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 335 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 336 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 337 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 338 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 339 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 340 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 341 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 342 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 343 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 344 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 345 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 346 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 347 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 348 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 349 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 350 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 351 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 352 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 353 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 354 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 355 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.79 |
| Metatranscriptomes | 1.52 |
| Isolates | 4.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 4.7 |
| Nodule | 0.45 |
| Rhizoplane | 5.45 |
| Rhizosphere | 81.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265340_10050248 | 3300031247 | Bacteria | 2023 |
| 2 | LJNas_1003596 | 3300000546 | Bacteria | 1774 |
| 3 | JGI25406J46586_10001203 | 3300003203 | Bacteria | 12170 |
| 4 | JGI25406J46586_10048222 | 3300003203 | Bacteria | 1446 |
| 5 | JGI25404J52841_10002182 | 3300003659 | Bacteria | 3660 |
| 6 | Ga0070658_10027899 | 3300005327 | Bacteria | 4531 |
| 7 | Ga0070658_10108439 | 3300005327 | Bacteria | 2298 |
| 8 | Ga0070658_10255182 | 3300005327 | Bacteria | 1488 |
| 9 | Ga0070658_10418698 | 3300005327 | Bacteria | 1152 |
| 10 | Ga0070683_100098073 | 3300005329 | Bacteria | 2757 |
| 11 | Ga0070683_100416568 | 3300005329 | Bacteria | 1281 |
| 12 | Ga0070666_10006654 | 3300005335 | Bacteria | 7107 |
| 13 | Ga0070680_100007560 | 3300005336 | Bacteria | 8286 |
| 14 | Ga0070682_100200720 | 3300005337 | Bacteria | 1407 |
| 15 | Ga0070682_100258209 | 3300005337 | Bacteria | 1260 |
| 16 | Ga0068868_100466627 | 3300005338 | Bacteria | 1101 |
| 17 | Ga0070660_100041886 | 3300005339 | Bacteria | 3493 |
| 18 | Ga0070660_100328370 | 3300005339 | Bacteria | 1257 |
| 19 | Ga0070691_10158893 | 3300005341 | Bacteria | 1164 |
| 20 | Ga0070661_100258054 | 3300005344 | Bacteria | 1347 |
| 21 | Ga0070692_10067865 | 3300005345 | Bacteria | 1894 |
| 22 | Ga0070668_100121757 | 3300005347 | Bacteria | 2086 |
| 23 | Ga0070668_100596469 | 3300005347 | Bacteria | 966 |
| 24 | Ga0070675_100596941 | 3300005354 | Bacteria | 1001 |
| 25 | Ga0070671_100698028 | 3300005355 | Bacteria | 880 |
| 26 | Ga0070674_100343254 | 3300005356 | Bacteria | 1204 |
| 27 | Ga0070659_100552263 | 3300005366 | Bacteria | 986 |
| 28 | Ga0070667_100997248 | 3300005367 | Bacteria | 781 |
| 29 | Ga0070709_10203026 | 3300005434 | Bacteria | 1405 |
| 30 | Ga0070714_100003556 | 3300005435 | Bacteria | 11651 |
| 31 | Ga0070714_100004941 | 3300005435 | Bacteria | 10135 |
| 32 | Ga0070714_100012181 | 3300005435 | Bacteria | 6855 |
| 33 | Ga0070714_100040836 | 3300005435 | Bacteria | 3911 |
| 34 | Ga0070714_100511966 | 3300005435 | Bacteria | 1145 |
| 35 | Ga0070714_101110624 | 3300005435 | Bacteria | 771 |
| 36 | Ga0070713_100006155 | 3300005436 | Bacteria | 8291 |
| 37 | Ga0070713_100048478 | 3300005436 | Bacteria | 3497 |
| 38 | Ga0070713_100064371 | 3300005436 | Bacteria | 3077 |
| 39 | Ga0070713_100481029 | 3300005436 | Bacteria | 1170 |
| 40 | Ga0070710_10036555 | 3300005437 | Bacteria | 2685 |
| 41 | Ga0070710_10089311 | 3300005437 | Bacteria | 1815 |
| 42 | Ga0070711_100047637 | 3300005439 | Bacteria | 2928 |
| 43 | Ga0070700_100000007 | 3300005441 | Bacteria | 198866 |
| 44 | Ga0070694_100159277 | 3300005444 | Bacteria | 1655 |
| 45 | Ga0070708_100004824 | 3300005445 | Bacteria | 10634 |
| 46 | Ga0070708_100124979 | 3300005445 | Bacteria | 2376 |
| 47 | Ga0070708_100677670 | 3300005445 | Bacteria | 971 |
| 48 | Ga0070663_100092399 | 3300005455 | Bacteria | 2244 |
| 49 | Ga0070663_100225091 | 3300005455 | Bacteria | 1474 |
| 50 | Ga0070681_10006486 | 3300005458 | Bacteria | 11387 |
| 51 | Ga0070706_100002251 | 3300005467 | Bacteria | 19550 |
| 52 | Ga0070707_100003511 | 3300005468 | Bacteria | 14797 |
| 53 | Ga0070707_100279615 | 3300005468 | Bacteria | 1622 |
| 54 | Ga0070698_100044332 | 3300005471 | Bacteria | 4555 |
| 55 | Ga0070698_100407361 | 3300005471 | Bacteria | 1293 |
| 56 | Ga0070698_100732411 | 3300005471 | Bacteria | 931 |
| 57 | Ga0070679_100011786 | 3300005530 | Bacteria | 8337 |
| 58 | Ga0070679_100033404 | 3300005530 | Bacteria | 5094 |
| 59 | Ga0070679_100113269 | 3300005530 | Bacteria | 2698 |
| 60 | Ga0070684_100017540 | 3300005535 | Bacteria | 5879 |
| 61 | Ga0070684_100033118 | 3300005535 | Bacteria | 4409 |
| 62 | Ga0070684_100207714 | 3300005535 | Bacteria | 1785 |
| 63 | Ga0070684_100313032 | 3300005535 | Bacteria | 1442 |
| 64 | Ga0070684_100799584 | 3300005535 | Bacteria | 882 |
| 65 | Ga0070697_100011126 | 3300005536 | Bacteria | 7032 |
| 66 | Ga0070665_100005785 | 3300005548 | Bacteria | 12686 |
| 67 | Ga0070665_100017852 | 3300005548 | Bacteria | 7123 |
| 68 | Ga0070665_100154651 | 3300005548 | Bacteria | 2295 |
| 69 | Ga0070665_100803523 | 3300005548 | Bacteria | 954 |
| 70 | Ga0070665_100988194 | 3300005548 | Bacteria | 854 |
| 71 | Ga0070704_100026023 | 3300005549 | Bacteria | 3860 |
| 72 | Ga0068855_100009962 | 3300005563 | Bacteria | 11455 |
| 73 | Ga0070664_100320214 | 3300005564 | Bacteria | 1405 |
| 74 | Ga0068857_100507391 | 3300005577 | Bacteria | 1132 |
| 75 | Ga0068857_100690648 | 3300005577 | Bacteria | 969 |
| 76 | Ga0068854_100202304 | 3300005578 | Bacteria | 1562 |
| 77 | Ga0068856_100349262 | 3300005614 | Bacteria | 1498 |
| 78 | Ga0068856_100455271 | 3300005614 | Bacteria | 1300 |
| 79 | Ga0068852_100025365 | 3300005616 | Bacteria | 4803 |
| 80 | Ga0068859_100001215 | 3300005617 | Bacteria | 26280 |
| 81 | Ga0068864_100007963 | 3300005618 | Bacteria | 8733 |
| 82 | Ga0068863_100001488 | 3300005841 | Bacteria | 23229 |
| 83 | Ga0068863_100006413 | 3300005841 | Bacteria | 11537 |
| 84 | Ga0068863_100048862 | 3300005841 | Bacteria | 4011 |
| 85 | Ga0068858_100000014 | 3300005842 | Bacteria | 214686 |
| 86 | Ga0068858_100001815 | 3300005842 | Bacteria | 21735 |
| 87 | Ga0068858_100005406 | 3300005842 | Bacteria | 12513 |
| 88 | Ga0068860_100000124 | 3300005843 | Bacteria | 124227 |
| 89 | Ga0068860_100042277 | 3300005843 | Bacteria | 4353 |
| 90 | Ga0068862_100240954 | 3300005844 | Bacteria | 1644 |
| 91 | Ga0081455_10043262 | 3300005937 | Bacteria | 3942 |
| 92 | Ga0081455_10298029 | 3300005937 | Bacteria | 1158 |
| 93 | Ga0081540_1000322 | 3300005983 | Bacteria | 49507 |
| 94 | Ga0081540_1004915 | 3300005983 | Bacteria | 10063 |
| 95 | Ga0081540_1047957 | 3300005983 | Bacteria | 2143 |
| 96 | Ga0081539_10000775 | 3300005985 | Bacteria | 62812 |
| 97 | Ga0081539_10002336 | 3300005985 | Bacteria | 27290 |
| 98 | Ga0070717_10057262 | 3300006028 | Bacteria | 3222 |
| 99 | Ga0070717_10095173 | 3300006028 | Bacteria | 2520 |
| 100 | Ga0075365_10000795 | 3300006038 | Bacteria | 12929 |
| 101 | Ga0075365_10309195 | 3300006038 | Bacteria | 1113 |
| 102 | Ga0075363_100001054 | 3300006048 | Bacteria | 9942 |
| 103 | Ga0075363_100005975 | 3300006048 | Bacteria | 5489 |
| 104 | Ga0075363_100092788 | 3300006048 | Bacteria | 1663 |
| 105 | Ga0075363_100142181 | 3300006048 | Bacteria | 1352 |
| 106 | Ga0075364_10022410 | 3300006051 | Bacteria | 3988 |
| 107 | Ga0070715_10099112 | 3300006163 | Bacteria | 1356 |
| 108 | Ga0070712_100419791 | 3300006175 | Bacteria | 1108 |
| 109 | Ga0075367_10005490 | 3300006178 | Bacteria | 6305 |
| 110 | Ga0075367_10029838 | 3300006178 | Bacteria | 3123 |
| 111 | Ga0075367_10239202 | 3300006178 | Bacteria | 1138 |
| 112 | Ga0075369_10003960 | 3300006186 | Bacteria | 5432 |
| 113 | Ga0075370_10005188 | 3300006353 | Bacteria | 6440 |
| 114 | Ga0075370_10184179 | 3300006353 | Bacteria | 1229 |
| 115 | Ga0075428_100357482 | 3300006844 | Bacteria | 1567 |
| 116 | Ga0075428_100479952 | 3300006844 | Bacteria | 1331 |
| 117 | Ga0075436_100131726 | 3300006914 | Bacteria | 1753 |
| 118 | Ga0097620_100001215 | 3300006931 | Bacteria | 26280 |
| 119 | Ga0105240_10004243 | 3300009093 | Bacteria | 21922 |
| 120 | Ga0105240_10050695 | 3300009093 | Bacteria | 5231 |
| 121 | Ga0105240_10620936 | 3300009093 | Bacteria | 1188 |
| 122 | Ga0105245_10220167 | 3300009098 | Bacteria | 1831 |
| 123 | Ga0105245_10448336 | 3300009098 | Bacteria | 1298 |
| 124 | Ga0105245_10540573 | 3300009098 | Bacteria | 1186 |
| 125 | Ga0105247_10000049 | 3300009101 | Bacteria | 150328 |
| 126 | Ga0105247_10000553 | 3300009101 | Bacteria | 30418 |
| 127 | Ga0105247_10219623 | 3300009101 | Bacteria | 1286 |
| 128 | Ga0105243_10002999 | 3300009148 | Bacteria | 13943 |
| 129 | Ga0105243_10193470 | 3300009148 | Bacteria | 1778 |
| 130 | Ga0105248_10000132 | 3300009177 | Bacteria | 87051 |
| 131 | Ga0105248_10002822 | 3300009177 | Bacteria | 19282 |
| 132 | Ga0105237_10524263 | 3300009545 | Bacteria | 1191 |
| 133 | Ga0105238_10756640 | 3300009551 | Bacteria | 986 |
| 134 | Ga0105249_10039336 | 3300009553 | Bacteria | 4293 |
| 135 | Ga0099796_10140474 | 3300010159 | Bacteria | 943 |
| 136 | Ga0105239_10387256 | 3300010375 | Bacteria | 1581 |
| 137 | Ga0157371_10177507 | 3300013102 | Bacteria | 1523 |
| 138 | Ga0157370_10001477 | 3300013104 | Bacteria | 29096 |
| 139 | Ga0157370_10233803 | 3300013104 | Bacteria | 1701 |
| 140 | Ga0157370_10235748 | 3300013104 | Bacteria | 1693 |
| 141 | Ga0157370_10571275 | 3300013104 | Bacteria | 1036 |
| 142 | Ga0157369_10001670 | 3300013105 | Bacteria | 27062 |
| 143 | Ga0157369_10009536 | 3300013105 | Bacteria | 11102 |
| 144 | Ga0157369_10731887 | 3300013105 | Bacteria | 1018 |
| 145 | Ga0157369_10999222 | 3300013105 | Bacteria | 857 |
| 146 | Ga0157372_10000079 | 3300013307 | Bacteria | 100687 |
| 147 | Ga0157372_11047355 | 3300013307 | Bacteria | 944 |
| 148 | Ga0163163_10002140 | 3300014325 | Bacteria | 16690 |
| 149 | Ga0163163_10050223 | 3300014325 | Bacteria | 4107 |
| 150 | Ga0163163_10256614 | 3300014325 | Bacteria | 1799 |
| 151 | Ga0163163_10263774 | 3300014325 | Bacteria | 1773 |
| 152 | Ga0163163_10287399 | 3300014325 | Bacteria | 1696 |
| 153 | Ga0163163_10817901 | 3300014325 | Bacteria | 995 |
| 154 | Ga0157379_10030567 | 3300014968 | Bacteria | 4795 |
| 155 | Ga0157379_10188111 | 3300014968 | Bacteria | 1866 |
| 156 | Ga0157379_10948112 | 3300014968 | Bacteria | 818 |
| 157 | Ga0182005_1039425 | 3300015265 | Bacteria | 1285 |
| 158 | Ga0197907_10591287 | 3300020069 | Bacteria | 914 |
| 159 | Ga0206356_11054090 | 3300020070 | Bacteria | 3386 |
| 160 | Ga0206351_10643484 | 3300020077 | Bacteria | 752 |
| 161 | Ga0206350_11433914 | 3300020080 | Bacteria | 639 |
| 162 | Ga0206353_11083094 | 3300020082 | Bacteria | 2099 |
| 163 | Ga0154015_1062170 | 3300020610 | Bacteria | 1871 |
| 164 | Ga0154015_1360837 | 3300020610 | Bacteria | 1504 |
| 165 | Ga0213875_10000071 | 3300021388 | Bacteria | 120220 |
| 166 | Ga0213875_10013030 | 3300021388 | Bacteria | 4092 |
| 167 | Ga0224712_10025320 | 3300022467 | Bacteria | 2085 |
| 168 | Ga0224712_10114841 | 3300022467 | Bacteria | 1159 |
| 169 | Ga0228600_1006473 | 3300024123 | Bacteria | 873 |
| 170 | Ga0207692_10036671 | 3300025898 | Bacteria | 2393 |
| 171 | Ga0207692_10155061 | 3300025898 | Bacteria | 1315 |
| 172 | Ga0207710_10000035 | 3300025900 | Bacteria | 253729 |
| 173 | Ga0207710_10000073 | 3300025900 | Bacteria | 150308 |
| 174 | Ga0207680_10001339 | 3300025903 | Bacteria | 11647 |
| 175 | Ga0207705_10006949 | 3300025909 | Bacteria | 8360 |
| 176 | Ga0207705_10012507 | 3300025909 | Bacteria | 6129 |
| 177 | Ga0207705_10057919 | 3300025909 | Bacteria | 2795 |
| 178 | Ga0207684_10003086 | 3300025910 | Bacteria | 16463 |
| 179 | Ga0207707_10077049 | 3300025912 | Bacteria | 2910 |
| 180 | Ga0207695_10008901 | 3300025913 | Bacteria | 12500 |
| 181 | Ga0207695_10038436 | 3300025913 | Bacteria | 5152 |
| 182 | Ga0207693_10090382 | 3300025915 | Bacteria | 2400 |
| 183 | Ga0207663_10036742 | 3300025916 | Bacteria | 2948 |
| 184 | Ga0207663_10093191 | 3300025916 | Bacteria | 2004 |
| 185 | Ga0207660_10085477 | 3300025917 | Bacteria | 2327 |
| 186 | Ga0207660_10094134 | 3300025917 | Bacteria | 2226 |
| 187 | Ga0207657_10029172 | 3300025919 | Bacteria | 5026 |
| 188 | Ga0207657_10056699 | 3300025919 | Bacteria | 3379 |
| 189 | Ga0207652_10010333 | 3300025921 | Bacteria | 7519 |
| 190 | Ga0207652_10012218 | 3300025921 | Bacteria | 6938 |
| 191 | Ga0207652_10505135 | 3300025921 | Bacteria | 1088 |
| 192 | Ga0207646_10004059 | 3300025922 | Bacteria | 16158 |
| 193 | Ga0207646_10305022 | 3300025922 | Bacteria | 1438 |
| 194 | Ga0207694_10104405 | 3300025924 | Bacteria | 2248 |
| 195 | Ga0207659_10567249 | 3300025926 | Bacteria | 966 |
| 196 | Ga0207687_10269941 | 3300025927 | Bacteria | 1359 |
| 197 | Ga0207687_10284835 | 3300025927 | Bacteria | 1326 |
| 198 | Ga0207687_10471915 | 3300025927 | Bacteria | 1043 |
| 199 | Ga0207700_10007224 | 3300025928 | Bacteria | 6772 |
| 200 | Ga0207700_10009070 | 3300025928 | Bacteria | 6194 |
| 201 | Ga0207700_10378661 | 3300025928 | Bacteria | 1237 |
| 202 | Ga0207700_10388680 | 3300025928 | Bacteria | 1221 |
| 203 | Ga0207664_10000905 | 3300025929 | Bacteria | 20030 |
| 204 | Ga0207664_10005795 | 3300025929 | Bacteria | 8446 |
| 205 | Ga0207664_10015437 | 3300025929 | Bacteria | 5545 |
| 206 | Ga0207664_10161500 | 3300025929 | Bacteria | 1911 |
| 207 | Ga0207664_10175060 | 3300025929 | Bacteria | 1839 |
| 208 | Ga0207664_10335899 | 3300025929 | Bacteria | 1335 |
| 209 | Ga0207664_10390581 | 3300025929 | Bacteria | 1236 |
| 210 | Ga0207664_10681397 | 3300025929 | Bacteria | 924 |
| 211 | Ga0207690_10426920 | 3300025932 | Bacteria | 1061 |
| 212 | Ga0207690_10529222 | 3300025932 | Bacteria | 956 |
| 213 | Ga0207709_10003528 | 3300025935 | Bacteria | 9259 |
| 214 | Ga0207709_10323460 | 3300025935 | Bacteria | 1155 |
| 215 | Ga0207669_10037457 | 3300025937 | Bacteria | 2783 |
| 216 | Ga0207669_10533430 | 3300025937 | Bacteria | 944 |
| 217 | Ga0207665_10576352 | 3300025939 | Bacteria | 877 |
| 218 | Ga0207711_10000139 | 3300025941 | Bacteria | 77476 |
| 219 | Ga0207711_10001985 | 3300025941 | Bacteria | 18534 |
| 220 | Ga0207711_10056534 | 3300025941 | Bacteria | 3372 |
| 221 | Ga0207661_10034973 | 3300025944 | Bacteria | 3911 |
| 222 | Ga0207661_10092008 | 3300025944 | Bacteria | 2528 |
| 223 | Ga0207661_10246238 | 3300025944 | Bacteria | 1587 |
| 224 | Ga0207667_10020380 | 3300025949 | Bacteria | 7376 |
| 225 | Ga0207712_10032971 | 3300025961 | Bacteria | 3498 |
| 226 | Ga0207668_10033679 | 3300025972 | Bacteria | 3395 |
| 227 | Ga0207668_10515587 | 3300025972 | Bacteria | 1031 |
| 228 | Ga0207668_10565639 | 3300025972 | Bacteria | 987 |
| 229 | Ga0207668_10744639 | 3300025972 | Bacteria | 864 |
| 230 | Ga0207640_10224444 | 3300025981 | Bacteria | 1441 |
| 231 | Ga0207658_10142555 | 3300025986 | Bacteria | 1941 |
| 232 | Ga0207703_10000001 | 3300026035 | Bacteria | 822925 |
| 233 | Ga0207703_10000005 | 3300026035 | Bacteria | 506356 |
| 234 | Ga0207703_10010127 | 3300026035 | Bacteria | 7390 |
| 235 | Ga0207703_10073459 | 3300026035 | Bacteria | 2829 |
| 236 | Ga0207703_11085085 | 3300026035 | Bacteria | 769 |
| 237 | Ga0207678_10009232 | 3300026067 | Bacteria | 8677 |
| 238 | Ga0207678_10050234 | 3300026067 | Bacteria | 3603 |
| 239 | Ga0207708_10000006 | 3300026075 | Bacteria | 266916 |
| 240 | Ga0207702_10116074 | 3300026078 | Bacteria | 2388 |
| 241 | Ga0207702_10290604 | 3300026078 | Bacteria | 1548 |
| 242 | Ga0207702_10477570 | 3300026078 | Bacteria | 1213 |
| 243 | Ga0207641_10002336 | 3300026088 | Bacteria | 17570 |
| 244 | Ga0207641_10019942 | 3300026088 | Bacteria | 5503 |
| 245 | Ga0207641_10061132 | 3300026088 | Bacteria | 3212 |
| 246 | Ga0207674_10042871 | 3300026116 | Bacteria | 4669 |
| 247 | Ga0207674_10160121 | 3300026116 | Bacteria | 2205 |
| 248 | Ga0207674_10437989 | 3300026116 | Bacteria | 1263 |
| 249 | Ga0207674_10829589 | 3300026116 | Bacteria | 892 |
| 250 | Ga0207674_10851314 | 3300026116 | Bacteria | 879 |
| 251 | Ga0207674_11010344 | 3300026116 | Bacteria | 801 |
| 252 | Ga0207698_10072152 | 3300026142 | Bacteria | 2743 |
| 253 | Ga0207698_10122038 | 3300026142 | Bacteria | 2207 |
| 254 | Ga0268266_10007158 | 3300028379 | Bacteria | 10109 |
| 255 | Ga0268266_10015387 | 3300028379 | Bacteria | 6564 |
| 256 | Ga0268266_11021038 | 3300028379 | Bacteria | 800 |
| 257 | Ga0268265_10000036 | 3300028380 | Bacteria | 203278 |
| 258 | Ga0268264_10000027 | 3300028381 | Bacteria | 440852 |
| 259 | Ga0265326_10001843 | 3300028558 | Bacteria | 7269 |
| 260 | Ga0265319_1001655 | 3300028563 | Bacteria | 12897 |
| 261 | Ga0265334_10001004 | 3300028573 | Bacteria | 13903 |
| 262 | Ga0265318_10029363 | 3300028577 | Bacteria | 2144 |
| 263 | Ga0265323_10002194 | 3300028653 | Bacteria | 9100 |
| 264 | Ga0265322_10008706 | 3300028654 | Bacteria | 2955 |
| 265 | Ga0265336_10016413 | 3300028666 | Bacteria | 2421 |
| 266 | Ga0307515_10010194 | 3300028794 | Bacteria | 18048 |
| 267 | Ga0265338_10000375 | 3300028800 | Bacteria | 79976 |
| 268 | Ga0265338_10002853 | 3300028800 | Bacteria | 25261 |
| 269 | Ga0265338_10392240 | 3300028800 | Bacteria | 991 |
| 270 | Ga0265324_10015922 | 3300029957 | Bacteria | 2758 |
| 271 | Ga0307511_10140723 | 3300030521 | Bacteria | 1419 |
| 272 | Ga0316176_1120625 | 3300030732 | Bacteria | 1221 |
| 273 | Ga0265332_10020884 | 3300031238 | Bacteria | 2892 |
| 274 | Ga0265320_10004313 | 3300031240 | Bacteria | 9345 |
| 275 | Ga0265325_10036982 | 3300031241 | Bacteria | 2583 |
| 276 | Ga0265325_10164686 | 3300031241 | Bacteria | 1041 |
| 277 | Ga0265340_10018547 | 3300031247 | Bacteria | 3588 |
| 278 | Ga0265327_10000081 | 3300031251 | Bacteria | 205988 |
| 279 | Ga0265327_10022919 | 3300031251 | Bacteria | 3714 |
| 280 | Ga0265316_10024890 | 3300031344 | Bacteria | 5003 |
| 281 | Ga0307513_10000036 | 3300031456 | Bacteria | 180080 |
| 282 | Ga0307513_10540770 | 3300031456 | Bacteria | 878 |
| 283 | Ga0265313_10005443 | 3300031595 | Bacteria | 9368 |
| 284 | Ga0265313_10037699 | 3300031595 | Bacteria | 2414 |
| 285 | Ga0307508_10262837 | 3300031616 | Bacteria | 1320 |
| 286 | Ga0265314_10032072 | 3300031711 | Bacteria | 3870 |
| 287 | Ga0265342_10003186 | 3300031712 | Bacteria | 13649 |
| 288 | Ga0307516_10123274 | 3300031730 | Bacteria | 2379 |
| 289 | Ga0307405_10212608 | 3300031731 | Bacteria | 1413 |
| 290 | Ga0307413_10012439 | 3300031824 | Bacteria | 4237 |
| 291 | Ga0307413_10026265 | 3300031824 | Bacteria | 3207 |
| 292 | Ga0307413_10280386 | 3300031824 | Bacteria | 1253 |
| 293 | Ga0307413_10496477 | 3300031824 | Bacteria | 979 |
| 294 | Ga0307413_11028241 | 3300031824 | Bacteria | 708 |
| 295 | Ga0307406_10167012 | 3300031901 | Bacteria | 1589 |
| 296 | Ga0307406_10252023 | 3300031901 | Bacteria | 1330 |
| 297 | Ga0307406_10609275 | 3300031901 | Bacteria | 901 |
| 298 | Ga0307412_10133184 | 3300031911 | Bacteria | 1809 |
| 299 | Ga0307409_100010653 | 3300031995 | Bacteria | 5736 |
| 300 | Ga0307416_100237269 | 3300032002 | Bacteria | 1763 |
| 301 | Ga0307416_102137156 | 3300032002 | Bacteria | 661 |
| 302 | Ga0307411_10103101 | 3300032005 | Bacteria | 2023 |
| 303 | Ga0307415_100051048 | 3300032126 | Bacteria | 2805 |
| 304 | Ga0307415_100100210 | 3300032126 | Bacteria | 2122 |
| 305 | Ga0316215_1002023 | 3300033544 | Bacteria | 1917 |
| 306 | Ga0316214_1007121 | 3300033545 | Bacteria | 1488 |
| 307 | Ga0373948_0014186 | 3300034817 | Bacteria | 1449 |
| 308 | Ga0373926_0005546 | 3300035083 | Bacteria | 4162 |
| 309 | Ga0373928_0005646 | 3300035084 | Bacteria | 2395 |
| 310 | Ga0373934_0004588 | 3300035086 | Bacteria | 5105 |
| 311 | Ga0373934_0035503 | 3300035086 | Bacteria | 1962 |
| 312 | Ga0373944_0000868 | 3300035089 | Bacteria | 7447 |
| 313 | Ga0373923_0009102 | 3300035111 | Bacteria | 3572 |
| 314 | Ga0373936_0002982 | 3300035113 | Bacteria | 6332 |
| 315 | Ga0373936_0065118 | 3300035113 | Bacteria | 1494 |
| 316 | Ga0373945_0000716 | 3300035116 | Bacteria | 9648 |
| 317 | Ga0373945_0102013 | 3300035116 | Bacteria | 1124 |
| 318 | Ga0373953_0056556 | 3300035117 | Bacteria | 1595 |
| 319 | Ga0373954_0163288 | 3300035118 | Bacteria | 1090 |
| 320 | Ga0373956_0037647 | 3300035119 | Bacteria | 2138 |
| 321 | Ga0373957_0062774 | 3300035120 | Bacteria | 1442 |
| 322 | Ga0373943_0000130 | 3300035170 | Bacteria | 28625 |
| 323 | Ga0373943_0334106 | 3300035170 | Bacteria | 866 |
| 324 | Ga0373946_0001483 | 3300035171 | Bacteria | 8163 |
| 325 | Ga0373955_0006440 | 3300035172 | Bacteria | 5347 |
| 326 | Ga0373955_0329275 | 3300035172 | Bacteria | 923 |
| 327 | Ga0373942_0001479 | 3300035207 | Bacteria | 6048 |
| 328 | Ga0373962_0006085 | 3300035242 | Bacteria | 2918 |
| 329 | Ga0373962_0103802 | 3300035242 | Bacteria | 889 |
| 330 | Ga0373927_0003020 | 3300035695 | Bacteria | 12206 |
| 331 | Ga0373927_0055083 | 3300035695 | Bacteria | 2572 |
| 332 | Ga0373927_0085008 | 3300035695 | Bacteria | 2053 |
| 333 | Ga0373927_0426971 | 3300035695 | Bacteria | 875 |
| 334 | Ga0373933_0034278 | 3300035724 | Bacteria | 2957 |
| 335 | Ga0373933_0371932 | 3300035724 | Bacteria | 930 |
| 336 | Ga0373947_0000859 | 3300035725 | Bacteria | 18325 |
| 337 | Ga0373937_0004414 | 3300036401 | Bacteria | 11961 |
| 338 | Ga0373937_0476539 | 3300036401 | Bacteria | 1185 |
| 339 | Ga0372808_008069 | 3300036459 | Bacteria | 1453 |
| 340 | Ga0373925_0004821 | 3300037068 | Bacteria | 10159 |
| 341 | Ga0373925_0021089 | 3300037068 | Bacteria | 4746 |
| 342 | Ga0373925_0342678 | 3300037068 | Bacteria | 1212 |
| 343 | Ga0395899_0058596 | 3300037312 | Bacteria | 2840 |
| 344 | Ga0395900_0058712 | 3300037418 | Bacteria | 3960 |
| 345 | Ga0395900_0112385 | 3300037418 | Bacteria | 2797 |
| 346 | Ga0395900_0632069 | 3300037418 | Bacteria | 1009 |
| 347 | Ga0395898_0025326 | 3300037466 | Bacteria | 5980 |
| 348 | Ga0395898_0380295 | 3300037466 | Bacteria | 1346 |
| 349 | Ga0395905_0133341 | 3300037471 | Bacteria | 2336 |
| 350 | Ga0436364_0073643 | 3300037853 | Bacteria | 2179 |
| 351 | Ga0436364_0334702 | 3300037853 | Bacteria | 3125 |
| 352 | Ga0436364_0619304 | 3300037853 | Bacteria | 133320 |
| 353 | Ga0436364_0750281 | 3300037853 | Bacteria | 1345 |
| 354 | Ga0436364_0918298 | 3300037853 | Bacteria | 3123 |
| 355 | Ga0436364_1109937 | 3300037853 | Bacteria | 12880 |
| 356 | Ga0436364_1436887 | 3300037853 | Bacteria | 3267 |
| 357 | Ga0436364_1529512 | 3300037853 | Bacteria | 24693 |
| 358 | Ga0395901_0041064 | 3300038443 | Bacteria | 4793 |
| 359 | Ga0395901_0114657 | 3300038443 | Bacteria | 2830 |
| 360 | Ga0436365_0229080 | 3300039437 | Bacteria | 1827 |
| 361 | Ga0436365_0546973 | 3300039437 | Bacteria | 5175 |
| 362 | Ga0436361_1098832 | 3300039447 | Bacteria | 1220 |
| 363 | Ga0436363_1654893 | 3300039450 | Bacteria | 2699 |
| 364 | Ga0436362_0433029 | 3300039453 | Bacteria | 25820 |
| 365 | Ga0439436_0004777 | 3300041404 | Bacteria | 4157 |
| 366 | Ga0439439_0011527 | 3300041406 | Bacteria | 2129 |
| 367 | Ga0439461_0001648 | 3300041410 | Bacteria | 3472 |
| 368 | Ga0439466_0002122 | 3300041411 | Bacteria | 7761 |
| 369 | Ga0439466_0025984 | 3300041411 | Bacteria | 2039 |
| 370 | Ga0439465_0008854 | 3300041413 | Bacteria | 3171 |
| 371 | Ga0451843_1213717 | 3300041509 | Bacteria | 685 |
| 372 | Ga0451855_1355414 | 3300041511 | Bacteria | 1534 |
| 373 | Ga0451853_1711214 | 3300041512 | Bacteria | 2988 |
| 374 | Ga0439431_0000763 | 3300041997 | Bacteria | 6959 |
| 375 | Ga0439442_045320 | 3300042002 | Bacteria | 926 |
| 376 | Ga0439445_0003022 | 3300042004 | Bacteria | 3765 |
| 377 | Ga0439449_0010170 | 3300042007 | Bacteria | 3556 |
| 378 | Ga0439434_0002936 | 3300042435 | Bacteria | 4979 |
| 379 | Ga0466972_0011564 | 3300044658 | Bacteria | 4431 |
| 380 | Ga0466965_0037619 | 3300044683 | Bacteria | 2376 |
| 381 | Ga0466965_0330294 | 3300044683 | Bacteria | 832 |
| 382 | Ga0466966_0144511 | 3300044684 | Bacteria | 1452 |
| 383 | Ga0466963_0052001 | 3300044694 | Bacteria | 2717 |
| 384 | Ga0466963_0154485 | 3300044694 | Bacteria | 1595 |
| 385 | Ga0466963_0306592 | 3300044694 | Bacteria | 1117 |
| 386 | Ga0466970_0008163 | 3300044765 | Bacteria | 5256 |
| 387 | Ga0466970_0021385 | 3300044765 | Bacteria | 3369 |
| 388 | Ga0466970_0321283 | 3300044765 | Bacteria | 875 |
| 389 | Ga0466957_0024443 | 3300044842 | Bacteria | 3575 |
| 390 | Ga0466960_0014451 | 3300044901 | Bacteria | 3379 |
| 391 | Ga0466960_0064299 | 3300044901 | Bacteria | 1809 |
| 392 | Ga0466959_0006884 | 3300045049 | Bacteria | 7933 |
| 393 | Ga0466958_0267417 | 3300045836 | Bacteria | 1095 |
| 394 | Ga0466958_0330671 | 3300045836 | Bacteria | 980 |
| 395 | Ga0466967_0001549 | 3300045976 | Bacteria | 13465 |
| 396 | Ga0466967_0024659 | 3300045976 | Bacteria | 4949 |
| 397 | Ga0466967_0045503 | 3300045976 | Bacteria | 3814 |
| 398 | Ga0466967_0198934 | 3300045976 | Bacteria | 1897 |
| 399 | Ga0466967_0513890 | 3300045976 | Bacteria | 1176 |
| 400 | Ga0466967_0519447 | 3300045976 | Bacteria | 1170 |
| 401 | Ga0466967_0545779 | 3300045976 | Bacteria | 1141 |
| 402 | Ga0466967_0662351 | 3300045976 | Bacteria | 1033 |
| 403 | Ga0466967_0814580 | 3300045976 | Bacteria | 927 |
| 404 | Ga0466967_0902438 | 3300045976 | Bacteria | 879 |
| 405 | Ga0495592_0060084 | 3300046454 | Bacteria | 2797 |
| 406 | Ga0495592_0240872 | 3300046454 | Bacteria | 1200 |
| 407 | Ga0495641_0020614 | 3300046461 | Bacteria | 3337 |
| 408 | Ga0495651_0001625 | 3300046462 | Bacteria | 17408 |
| 409 | Ga0495651_0018640 | 3300046462 | Bacteria | 5377 |
| 410 | Ga0495653_0007099 | 3300046463 | Bacteria | 9183 |
| 411 | Ga0495653_0012007 | 3300046463 | Bacteria | 7071 |
| 412 | Ga0495653_0319723 | 3300046463 | Bacteria | 1006 |
| 413 | Ga0495582_0016149 | 3300046473 | Bacteria | 4091 |
| 414 | Ga0495664_0003273 | 3300046477 | Bacteria | 8804 |
| 415 | Ga0495664_0076885 | 3300046477 | Bacteria | 1998 |
| 416 | Ga0495664_0184767 | 3300046477 | Bacteria | 1264 |
| 417 | Ga0495594_0027564 | 3300046499 | Bacteria | 3062 |
| 418 | Ga0495607_0008802 | 3300046501 | Bacteria | 6871 |
| 419 | Ga0495608_0000820 | 3300046511 | Bacteria | 21754 |
| 420 | Ga0495608_0154135 | 3300046511 | Bacteria | 1463 |
| 421 | Ga0495618_0019630 | 3300046514 | Bacteria | 4160 |
| 422 | Ga0495618_0022673 | 3300046514 | Bacteria | 3879 |
| 423 | Ga0495618_0142483 | 3300046514 | Bacteria | 1533 |
| 424 | Ga0495628_0017435 | 3300046516 | Bacteria | 5979 |
| 425 | Ga0495628_0172777 | 3300046516 | Bacteria | 1638 |
| 426 | Ga0495628_0257882 | 3300046516 | Bacteria | 1300 |
| 427 | Ga0495630_0007824 | 3300046517 | Bacteria | 7655 |
| 428 | Ga0495648_0011573 | 3300046524 | Bacteria | 6636 |
| 429 | Ga0495652_0016462 | 3300046529 | Bacteria | 6614 |
| 430 | Ga0495652_0091995 | 3300046529 | Bacteria | 2479 |
| 431 | Ga0495652_0114343 | 3300046529 | Bacteria | 2165 |
| 432 | Ga0495652_0170812 | 3300046529 | Bacteria | 1678 |
| 433 | Ga0495665_0022445 | 3300046531 | Bacteria | 3394 |
| 434 | Ga0495640_0033366 | 3300046533 | Bacteria | 3657 |
| 435 | Ga0495640_0051682 | 3300046533 | Bacteria | 2824 |
| 436 | Ga0495640_0621776 | 3300046533 | Bacteria | 651 |
| 437 | Ga0495586_0203479 | 3300046535 | Bacteria | 1123 |
| 438 | Ga0495587_0046406 | 3300046536 | Bacteria | 2579 |
| 439 | Ga0495587_0142336 | 3300046536 | Bacteria | 1368 |
| 440 | Ga0495645_0017633 | 3300046543 | Bacteria | 5116 |
| 441 | Ga0495645_0078193 | 3300046543 | Bacteria | 2378 |
| 442 | Ga0495645_0181643 | 3300046543 | Bacteria | 1441 |
| 443 | Ga0495667_0003813 | 3300046559 | Bacteria | 10122 |
| 444 | Ga0495667_0005758 | 3300046559 | Bacteria | 8392 |
| 445 | Ga0495634_0010918 | 3300046642 | Bacteria | 6630 |
| 446 | Ga0495635_0002325 | 3300046663 | Bacteria | 12920 |
| 447 | Ga0495635_0005287 | 3300046663 | Bacteria | 8980 |
| 448 | Ga0495635_0075167 | 3300046663 | Bacteria | 2315 |
| 449 | Ga0495657_0008441 | 3300046675 | Bacteria | 7875 |
| 450 | Ga0495599_0156616 | 3300046678 | Bacteria | 1409 |
| 451 | Ga0495623_0399723 | 3300046679 | Bacteria | 739 |
| 452 | Ga0495646_0133572 | 3300046680 | Bacteria | 1395 |
| 453 | Ga0495624_0003787 | 3300046690 | Bacteria | 11174 |
| 454 | Ga0495624_0308699 | 3300046690 | Bacteria | 953 |
| 455 | Ga0495600_0000417 | 3300046809 | Bacteria | 21954 |
| 456 | Ga0495600_0131600 | 3300046809 | Bacteria | 1626 |
| 457 | Ga0495581_0018199 | 3300047315 | Bacteria | 4081 |
| 458 | Ga0495604_0119804 | 3300047317 | Bacteria | 1906 |
| 459 | Ga0495604_0161600 | 3300047317 | Bacteria | 1582 |
| 460 | Ga0495674_0004740 | 3300047319 | Bacteria | 13077 |
| 461 | Ga0495674_0006023 | 3300047319 | Bacteria | 11649 |
| 462 | Ga0495674_0196862 | 3300047319 | Bacteria | 1673 |
| 463 | Ga0495674_0248924 | 3300047319 | Bacteria | 1463 |
| 464 | Ga0495676_0163773 | 3300047321 | Bacteria | 1571 |
| 465 | Ga0495676_0248522 | 3300047321 | Bacteria | 1214 |
| 466 | Ga0495680_0013265 | 3300047322 | Bacteria | 7199 |
| 467 | Ga0495680_0031165 | 3300047322 | Bacteria | 4344 |
| 468 | Ga0495683_0000307 | 3300047323 | Bacteria | 41369 |
| 469 | Ga0495675_0433014 | 3300047444 | Bacteria | 763 |
| 470 | Ga0495684_0008594 | 3300047471 | Bacteria | 7904 |
| 471 | Ga0495684_0012523 | 3300047471 | Bacteria | 6536 |
| 472 | Ga0495593_0187831 | 3300047673 | Bacteria | 1040 |
| 473 | Ga0495593_0285844 | 3300047673 | Bacteria | 825 |
| 474 | Ga0495602_0009196 | 3300048088 | Bacteria | 10284 |
| 475 | Ga0495602_0062659 | 3300048088 | Bacteria | 3226 |
| 476 | Ga0495602_0222825 | 3300048088 | Bacteria | 1422 |
| 477 | Ga0495602_0433631 | 3300048088 | Bacteria | 931 |
| 478 | Ga0496100_0034211 | 3300048903 | Bacteria | 3187 |
| 479 | Ga0496101_0087550 | 3300048904 | Bacteria | 2312 |
| 480 | Ga0496101_0187317 | 3300048904 | Bacteria | 1596 |
| 481 | Ga0496101_0271512 | 3300048904 | Bacteria | 1324 |
| 482 | Ga0496102_0087660 | 3300048905 | Bacteria | 2876 |
| 483 | Ga0496102_0258259 | 3300048905 | Bacteria | 1642 |
| 484 | Ga0496102_0923121 | 3300048905 | Bacteria | 794 |
| 485 | Ga0496103_0167281 | 3300048906 | Bacteria | 1411 |
| 486 | Ga0496104_0004858 | 3300048907 | Bacteria | 11710 |
| 487 | Ga0496104_0487496 | 3300048907 | Bacteria | 1144 |
| 488 | Ga0496104_0871526 | 3300048907 | Bacteria | 806 |
| 489 | Ga0496105_0032739 | 3300048908 | Bacteria | 4267 |
| 490 | Ga0496106_0239492 | 3300048909 | Bacteria | 1450 |
| 491 | Ga0496107_0269642 | 3300048910 | Bacteria | 1267 |
| 492 | Ga0496108_0010895 | 3300048911 | Bacteria | 7380 |
| 493 | Ga0496108_0101447 | 3300048911 | Bacteria | 2455 |
| 494 | Ga0496108_0272968 | 3300048911 | Bacteria | 1472 |
| 495 | Ga0496108_0487448 | 3300048911 | Bacteria | 1077 |
| 496 | Ga0496109_0016313 | 3300048912 | Bacteria | 6492 |
| 497 | Ga0496109_0017171 | 3300048912 | Bacteria | 6338 |
| 498 | Ga0496110_0021350 | 3300048913 | Bacteria | 5479 |
| 499 | Ga0496110_0062483 | 3300048913 | Bacteria | 3289 |
| 500 | Ga0496110_0343015 | 3300048913 | Bacteria | 1361 |
| 501 | Ga0496111_0011388 | 3300048914 | Bacteria | 5989 |
| 502 | Ga0496111_0366615 | 3300048914 | Bacteria | 1066 |
| 503 | Ga0496112_0009059 | 3300048915 | Bacteria | 8941 |
| 504 | Ga0496112_0026126 | 3300048915 | Bacteria | 5614 |
| 505 | Ga0496112_0095227 | 3300048915 | Bacteria | 2948 |
| 506 | Ga0496112_0362170 | 3300048915 | Bacteria | 1392 |
| 507 | Ga0496112_0852810 | 3300048915 | Bacteria | 834 |
| 508 | Ga0496113_0009174 | 3300048916 | Bacteria | 6485 |
| 509 | Ga0496113_0010820 | 3300048916 | Bacteria | 6053 |
| 510 | Ga0496113_0329123 | 3300048916 | Bacteria | 1225 |
| 511 | Ga0496114_0071896 | 3300048917 | Bacteria | 2908 |
| 512 | Ga0496114_0115374 | 3300048917 | Bacteria | 2304 |
| 513 | Ga0496114_0251927 | 3300048917 | Bacteria | 1554 |
| 514 | Ga0496116_0000310 | 3300048919 | Bacteria | 81470 |
| 515 | Ga0496117_0024497 | 3300048920 | Bacteria | 4772 |
| 516 | Ga0496118_0021538 | 3300048921 | Bacteria | 5669 |
| 517 | Ga0496119_0001466 | 3300048922 | Bacteria | 28240 |
| 518 | Ga0496119_0009177 | 3300048922 | Bacteria | 8542 |
| 519 | Ga0496119_0044332 | 3300048922 | Bacteria | 2802 |
| 520 | Ga0496120_0002341 | 3300048923 | Bacteria | 19478 |
| 521 | Ga0496121_0015092 | 3300048924 | Bacteria | 8127 |
| 522 | Ga0496121_0041629 | 3300048924 | Bacteria | 4012 |
| 523 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 524 | Ga0496126_0008928 | 3300048929 | Bacteria | 10734 |
| 525 | Ga0496126_0164119 | 3300048929 | Bacteria | 1897 |
| 526 | Ga0501031_0171228 | 3300049568 | Bacteria | 1419 |
| 527 | Ga0501033_0479173 | 3300049570 | Bacteria | 862 |
| 528 | Ga0501034_0224573 | 3300049571 | Bacteria | 1829 |
| 529 | Ga0501034_0302219 | 3300049571 | Bacteria | 1537 |
| 530 | Ga0501034_0369402 | 3300049571 | Bacteria | 1361 |
| 531 | Ga0501036_0001795 | 3300049572 | Bacteria | 16659 |
| 532 | Ga0501036_0119546 | 3300049572 | Bacteria | 2225 |
| 533 | Ga0501036_0123681 | 3300049572 | Bacteria | 2185 |
| 534 | Ga0501036_0768558 | 3300049572 | Bacteria | 794 |
| 535 | Ga0501037_0027253 | 3300049573 | Bacteria | 4221 |
| 536 | Ga0501037_0078608 | 3300049573 | Bacteria | 2394 |
| 537 | Ga0501037_0261934 | 3300049573 | Bacteria | 1208 |
| 538 | Ga0501038_0022030 | 3300049574 | Bacteria | 5714 |
| 539 | Ga0501038_0085770 | 3300049574 | Bacteria | 2647 |
| 540 | Ga0501038_0322908 | 3300049574 | Bacteria | 1207 |
| 541 | Ga0501038_0349262 | 3300049574 | Bacteria | 1152 |
| 542 | Ga0501039_0025278 | 3300049575 | Bacteria | 4562 |
| 543 | Ga0501039_0539715 | 3300049575 | Bacteria | 915 |
| 544 | Ga0501041_0296031 | 3300049577 | Bacteria | 1019 |
| 545 | Ga0501042_0046091 | 3300049578 | Bacteria | 3108 |
| 546 | Ga0501042_0629886 | 3300049578 | Bacteria | 780 |
| 547 | Ga0501043_0014677 | 3300049579 | Bacteria | 6133 |
| 548 | Ga0501043_0512284 | 3300049579 | Bacteria | 895 |
| 549 | Ga0501046_0054853 | 3300049580 | Bacteria | 3133 |
| 550 | Ga0501047_0007046 | 3300049581 | Bacteria | 10554 |
| 551 | Ga0501047_0161145 | 3300049581 | Bacteria | 2115 |
| 552 | Ga0501047_0280814 | 3300049581 | Bacteria | 1510 |
| 553 | Ga0501047_0446416 | 3300049581 | Bacteria | 1123 |
| 554 | Ga0501048_0005497 | 3300049582 | Bacteria | 9642 |
| 555 | Ga0501048_0203869 | 3300049582 | Bacteria | 1402 |
| 556 | Ga0501067_0000719 | 3300049583 | Bacteria | 17849 |
| 557 | Ga0501067_0089514 | 3300049583 | Bacteria | 1708 |
| 558 | Ga0501068_0063291 | 3300049584 | Bacteria | 2250 |
| 559 | Ga0501068_0065105 | 3300049584 | Bacteria | 2218 |
| 560 | Ga0501068_0162720 | 3300049584 | Bacteria | 1407 |
| 561 | Ga0501069_0057175 | 3300049585 | Bacteria | 2174 |
| 562 | Ga0501069_0189476 | 3300049585 | Bacteria | 1190 |
| 563 | Ga0501069_0205059 | 3300049585 | Bacteria | 1143 |
| 564 | Ga0501069_0393388 | 3300049585 | Bacteria | 820 |
| 565 | Ga0501070_0012959 | 3300049586 | Bacteria | 7027 |
| 566 | Ga0501070_0287593 | 3300049586 | Bacteria | 1340 |
| 567 | Ga0501071_0110056 | 3300049587 | Bacteria | 2035 |
| 568 | Ga0501071_0131864 | 3300049587 | Bacteria | 1857 |
| 569 | Ga0501071_0206098 | 3300049587 | Bacteria | 1478 |
| 570 | Ga0501071_0242609 | 3300049587 | Bacteria | 1359 |
| 571 | Ga0501071_0394462 | 3300049587 | Bacteria | 1056 |
| 572 | Ga0501072_0018063 | 3300049588 | Bacteria | 5423 |
| 573 | Ga0501072_0380493 | 3300049588 | Bacteria | 1120 |
| 574 | Ga0501073_0008951 | 3300049589 | Bacteria | 7394 |
| 575 | Ga0501073_0009218 | 3300049589 | Bacteria | 7277 |
| 576 | Ga0501073_0357893 | 3300049589 | Bacteria | 1008 |
| 577 | Ga0501074_0001106 | 3300049590 | Bacteria | 17610 |
| 578 | Ga0501074_0013656 | 3300049590 | Bacteria | 5903 |
| 579 | Ga0501074_0085137 | 3300049590 | Bacteria | 2265 |
| 580 | Ga0501074_0227699 | 3300049590 | Bacteria | 1327 |
| 581 | Ga0501075_0024203 | 3300049591 | Bacteria | 4449 |
| 582 | Ga0501076_0106465 | 3300049592 | Bacteria | 2264 |
| 583 | Ga0501077_0034672 | 3300049593 | Bacteria | 3212 |
| 584 | Ga0501077_0257201 | 3300049593 | Bacteria | 1111 |
| 585 | Ga0501079_0018176 | 3300049741 | Bacteria | 5370 |
| 586 | Ga0501079_0099348 | 3300049741 | Bacteria | 2255 |
| 587 | Ga0501080_0098962 | 3300049742 | Bacteria | 2706 |
| 588 | Ga0501080_0230125 | 3300049742 | Bacteria | 1694 |
| 589 | Ga0501080_0417543 | 3300049742 | Bacteria | 1206 |
| 590 | Ga0501083_0329309 | 3300049744 | Bacteria | 993 |
| 591 | Ga0501035_0000279 | 3300049822 | Bacteria | 60584 |
| 592 | Ga0501035_0059930 | 3300049822 | Bacteria | 3390 |
| 593 | Ga0501044_0003828 | 3300049823 | Bacteria | 16888 |
| 594 | Ga0501044_0066316 | 3300049823 | Bacteria | 3681 |
| 595 | Ga0501044_0329654 | 3300049823 | Bacteria | 1449 |
| 596 | Ga0501044_0661914 | 3300049823 | Bacteria | 932 |
| 597 | Ga0501044_0696410 | 3300049823 | Bacteria | 902 |
| 598 | Ga0501045_0625179 | 3300049824 | Bacteria | 797 |
| 599 | nmdc:mga03683_12456_c1 | 3300050489 | Bacteria | 3107 |
| 600 | nmdc:mga03n38_122174_c1 | 3300050490 | Bacteria | 1281 |
| 601 | nmdc:mga03n38_158218_c1 | 3300050490 | Bacteria | 1145 |
| 602 | nmdc:mga03n38_340655_c1 | 3300050490 | Bacteria | 814 |
| 603 | nmdc:mga03n38_495_c1 | 3300050490 | Bacteria | 9900 |
| 604 | nmdc:mga00v17_154798_c1 | 3300050491 | Bacteria | 1474 |
| 605 | nmdc:mga00v17_16308_c1 | 3300050491 | Bacteria | 2700 |
| 606 | nmdc:mga00v17_195263_c1 | 3300050491 | Bacteria | 1308 |
| 607 | nmdc:mga0yw44_1796_c1 | 3300050492 | Bacteria | 8757 |
| 608 | nmdc:mga0yw44_195110_c1 | 3300050492 | Bacteria | 1336 |
| 609 | nmdc:mga0yw44_2268_c1 | 3300050492 | Bacteria | 8110 |
| 610 | nmdc:mga0yw44_239672_c1 | 3300050492 | Bacteria | 1205 |
| 611 | nmdc:mga0yw44_286051_c1 | 3300050492 | Bacteria | 1102 |
| 612 | nmdc:mga0yw44_338581_c1 | 3300050492 | Bacteria | 1012 |
| 613 | nmdc:mga07m45_150377_c1 | 3300050496 | Bacteria | 1350 |
| 614 | nmdc:mga07m45_21750_c1 | 3300050496 | Bacteria | 3496 |
| 615 | nmdc:mga07m45_410479_c1 | 3300050496 | Bacteria | 786 |
| 616 | nmdc:mga09592_649852_c1 | 3300050508 | Bacteria | 900 |
| 617 | nmdc:mga06r32_566977_c1 | 3300050510 | Bacteria | 1108 |
| 618 | nmdc:mga08y16_324108_c1 | 3300050511 | Bacteria | 1585 |
| 619 | nmdc:mga08x19_804373_c1 | 3300050514 | Bacteria | 668 |
| 620 | Ga0495601_0258270 | 3300053077 | Bacteria | 1137 |
| 621 | Ga0495655_0007260 | 3300053083 | Bacteria | 2052 |
| 622 | Ga0495655_0128270 | 3300053083 | Bacteria | 779 |
| 623 | Ga0495619_0007016 | 3300053085 | Bacteria | 7128 |
| 624 | Ga0500616_0006155 | 3300053153 | Bacteria | 7935 |
| 625 | Ga0501084_0111939 | 3300054114 | Bacteria | 2294 |
| 626 | Ga0501084_0153840 | 3300054114 | Bacteria | 1939 |
| 627 | Ga0501084_0611676 | 3300054114 | Bacteria | 920 |
| 628 | Ga0501082_0069726 | 3300060353 | Bacteria | 3027 |
| 629 | Ga0501082_0109390 | 3300060353 | Bacteria | 2392 |
| 630 | 2506866663 | 2506783011 | Bacteria | 5323186 |
| 631 | 2548694740 | 2547132424 | Bacteria | 8348532 |
| 632 | 2552107303 | 2551306166 | Bacteria | 9731570 |
| 633 | 2644518250 | 2643221692 | Bacteria | 7282860 |
| 634 | 2644635188 | 2643221715 | Bacteria | 6671032 |
| 635 | 2676487454 | 2675903059 | Bacteria | 8644972 |
| 636 | 2739239324 | 2738543011 | Bacteria | 5731169 |
| 637 | 2739366809 | 2738543034 | Bacteria | 6084756 |
| 638 | 2753268218 | 2751185782 | Bacteria | 11227053 |
| 639 | 2774905825 | 2773857933 | Bacteria | 5818019 |
| 640 | 2791914530 | 2791354901 | Bacteria | 8322202 |
| 641 | 2795796060 | 2795385472 | Bacteria | 6627535 |
| 642 | 2842137747 | 2842134933 | Bacteria | 5847019 |
| 643 | 2861523862 | 2861520306 | Bacteria | 8348283 |
| 644 | 2889302041 | 2889300758 | Bacteria | 5690814 |
| 645 | 2902803878 | 2902799365 | Bacteria | 5419524 |
| 646 | 2902812925 | 2902810491 | Bacteria | 6794147 |
| 647 | 2904769261 | 2904765812 | Bacteria | 5369154 |
| 648 | 2904772817 | 2904770941 | Bacteria | 5580202 |
| 649 | 2908814377 | 2908811453 | Bacteria | 5478616 |
| 650 | 2919422818 | 2919420072 | Bacteria | 5390363 |
| 651 | 2919434929 | 2919432681 | Bacteria | 5390474 |
| 652 | 2919718842 | 2919713450 | Bacteria | 7431245 |
| 653 | 2928147308 | 2928142448 | Bacteria | 5288925 |
| 654 | 2939748137 | 2939743619 | Bacteria | 5762299 |
| 655 | 2974317834 | 2974315732 | Bacteria | 4602776 |
| 656 | 2984526043 | 2984523437 | Bacteria | 4508481 |
| 657 | 3001120310 | 3001119090 | Bacteria | 3449530 |
| 658 | 8003862341 | 8003856774 | Bacteria | 7675274 |
| 659 | 8056059846 | 8056054917 | Bacteria | 5736694 |
| 660 | 8057572262 | 8057568493 | Bacteria | 7221719 |
| 661 | Ga0265340_10050248 | |||
| 662 | LJNas_1003596 | |||
| 663 | JGI25406J46586_10001203 | |||
| 664 | JGI25406J46586_10048222 | |||
| 665 | JGI25404J52841_10002182 | |||
| 666 | Ga0070658_10027899 | |||
| 667 | Ga0070658_10108439 | |||
| 668 | Ga0070658_10255182 | |||
| 669 | Ga0070658_10418698 | |||
| 670 | Ga0070683_100098073 | |||
| 671 | Ga0070683_100416568 | |||
| 672 | Ga0070666_10006654 | |||
| 673 | Ga0070680_100007560 | |||
| 674 | Ga0070682_100200720 | |||
| 675 | Ga0070682_100258209 | |||
| 676 | Ga0068868_100466627 | |||
| 677 | Ga0070660_100041886 | |||
| 678 | Ga0070660_100328370 | |||
| 679 | Ga0070691_10158893 | |||
| 680 | Ga0070661_100258054 | |||
| 681 | Ga0070692_10067865 | |||
| 682 | Ga0070668_100121757 | |||
| 683 | Ga0070668_100596469 | |||
| 684 | Ga0070675_100596941 | |||
| 685 | Ga0070671_100698028 | |||
| 686 | Ga0070674_100343254 | |||
| 687 | Ga0070659_100552263 | |||
| 688 | Ga0070667_100997248 | |||
| 689 | Ga0070709_10203026 | |||
| 690 | Ga0070714_100003556 | |||
| 691 | Ga0070714_100004941 | |||
| 692 | Ga0070714_100012181 | |||
| 693 | Ga0070714_100040836 | |||
| 694 | Ga0070714_100511966 | |||
| 695 | Ga0070714_101110624 | |||
| 696 | Ga0070713_100006155 | |||
| 697 | Ga0070713_100048478 | |||
| 698 | Ga0070713_100064371 | |||
| 699 | Ga0070713_100481029 | |||
| 700 | Ga0070710_10036555 | |||
| 701 | Ga0070710_10089311 | |||
| 702 | Ga0070711_100047637 | |||
| 703 | Ga0070700_100000007 | |||
| 704 | Ga0070694_100159277 | |||
| 705 | Ga0070708_100004824 | |||
| 706 | Ga0070708_100124979 | |||
| 707 | Ga0070708_100677670 | |||
| 708 | Ga0070663_100092399 | |||
| 709 | Ga0070663_100225091 | |||
| 710 | Ga0070681_10006486 | |||
| 711 | Ga0070706_100002251 | |||
| 712 | Ga0070707_100003511 | |||
| 713 | Ga0070707_100279615 | |||
| 714 | Ga0070698_100044332 | |||
| 715 | Ga0070698_100407361 | |||
| 716 | Ga0070698_100732411 | |||
| 717 | Ga0070679_100011786 | |||
| 718 | Ga0070679_100033404 | |||
| 719 | Ga0070679_100113269 | |||
| 720 | Ga0070684_100017540 | |||
| 721 | Ga0070684_100033118 | |||
| 722 | Ga0070684_100207714 | |||
| 723 | Ga0070684_100313032 | |||
| 724 | Ga0070684_100799584 | |||
| 725 | Ga0070697_100011126 | |||
| 726 | Ga0070665_100005785 | |||
| 727 | Ga0070665_100017852 | |||
| 728 | Ga0070665_100154651 | |||
| 729 | Ga0070665_100803523 | |||
| 730 | Ga0070665_100988194 | |||
| 731 | Ga0070704_100026023 | |||
| 732 | Ga0068855_100009962 | |||
| 733 | Ga0070664_100320214 | |||
| 734 | Ga0068857_100507391 | |||
| 735 | Ga0068857_100690648 | |||
| 736 | Ga0068854_100202304 | |||
| 737 | Ga0068856_100349262 | |||
| 738 | Ga0068856_100455271 | |||
| 739 | Ga0068852_100025365 | |||
| 740 | Ga0068859_100001215 | |||
| 741 | Ga0068864_100007963 | |||
| 742 | Ga0068863_100001488 | |||
| 743 | Ga0068863_100006413 | |||
| 744 | Ga0068863_100048862 | |||
| 745 | Ga0068858_100000014 | |||
| 746 | Ga0068858_100001815 | |||
| 747 | Ga0068858_100005406 | |||
| 748 | Ga0068860_100000124 | |||
| 749 | Ga0068860_100042277 | |||
| 750 | Ga0068862_100240954 | |||
| 751 | Ga0081455_10043262 | |||
| 752 | Ga0081455_10298029 | |||
| 753 | Ga0081540_1000322 | |||
| 754 | Ga0081540_1004915 | |||
| 755 | Ga0081540_1047957 | |||
| 756 | Ga0081539_10000775 | |||
| 757 | Ga0081539_10002336 | |||
| 758 | Ga0070717_10057262 | |||
| 759 | Ga0070717_10095173 | |||
| 760 | Ga0075365_10000795 | |||
| 761 | Ga0075365_10309195 | |||
| 762 | Ga0075363_100001054 | |||
| 763 | Ga0075363_100005975 | |||
| 764 | Ga0075363_100092788 | |||
| 765 | Ga0075363_100142181 | |||
| 766 | Ga0075364_10022410 | |||
| 767 | Ga0070715_10099112 | |||
| 768 | Ga0070712_100419791 | |||
| 769 | Ga0075367_10005490 | |||
| 770 | Ga0075367_10029838 | |||
| 771 | Ga0075367_10239202 | |||
| 772 | Ga0075369_10003960 | |||
| 773 | Ga0075370_10005188 | |||
| 774 | Ga0075370_10184179 | |||
| 775 | Ga0075428_100357482 | |||
| 776 | Ga0075428_100479952 | |||
| 777 | Ga0075436_100131726 | |||
| 778 | Ga0097620_100001215 | |||
| 779 | Ga0105240_10004243 | |||
| 780 | Ga0105240_10050695 | |||
| 781 | Ga0105240_10620936 | |||
| 782 | Ga0105245_10220167 | |||
| 783 | Ga0105245_10448336 | |||
| 784 | Ga0105245_10540573 | |||
| 785 | Ga0105247_10000049 | |||
| 786 | Ga0105247_10000553 | |||
| 787 | Ga0105247_10219623 | |||
| 788 | Ga0105243_10002999 | |||
| 789 | Ga0105243_10193470 | |||
| 790 | Ga0105248_10000132 | |||
| 791 | Ga0105248_10002822 | |||
| 792 | Ga0105237_10524263 | |||
| 793 | Ga0105238_10756640 | |||
| 794 | Ga0105249_10039336 | |||
| 795 | Ga0099796_10140474 | |||
| 796 | Ga0105239_10387256 | |||
| 797 | Ga0157371_10177507 | |||
| 798 | Ga0157370_10001477 | |||
| 799 | Ga0157370_10233803 | |||
| 800 | Ga0157370_10235748 | |||
| 801 | Ga0157370_10571275 | |||
| 802 | Ga0157369_10001670 | |||
| 803 | Ga0157369_10009536 | |||
| 804 | Ga0157369_10731887 | |||
| 805 | Ga0157369_10999222 | |||
| 806 | Ga0157372_10000079 | |||
| 807 | Ga0157372_11047355 | |||
| 808 | Ga0163163_10002140 | |||
| 809 | Ga0163163_10050223 | |||
| 810 | Ga0163163_10256614 | |||
| 811 | Ga0163163_10263774 | |||
| 812 | Ga0163163_10287399 | |||
| 813 | Ga0163163_10817901 | |||
| 814 | Ga0157379_10030567 | |||
| 815 | Ga0157379_10188111 | |||
| 816 | Ga0157379_10948112 | |||
| 817 | Ga0182005_1039425 | |||
| 818 | Ga0197907_10591287 | |||
| 819 | Ga0206356_11054090 | |||
| 820 | Ga0206351_10643484 | |||
| 821 | Ga0206350_11433914 | |||
| 822 | Ga0206353_11083094 | |||
| 823 | Ga0154015_1062170 | |||
| 824 | Ga0154015_1360837 | |||
| 825 | Ga0213875_10000071 | |||
| 826 | Ga0213875_10013030 | |||
| 827 | Ga0224712_10025320 | |||
| 828 | Ga0224712_10114841 | |||
| 829 | Ga0228600_1006473 | |||
| 830 | Ga0207692_10036671 | |||
| 831 | Ga0207692_10155061 | |||
| 832 | Ga0207710_10000035 | |||
| 833 | Ga0207710_10000073 | |||
| 834 | Ga0207680_10001339 | |||
| 835 | Ga0207705_10006949 | |||
| 836 | Ga0207705_10012507 | |||
| 837 | Ga0207705_10057919 | |||
| 838 | Ga0207684_10003086 | |||
| 839 | Ga0207707_10077049 | |||
| 840 | Ga0207695_10008901 | |||
| 841 | Ga0207695_10038436 | |||
| 842 | Ga0207693_10090382 | |||
| 843 | Ga0207663_10036742 | |||
| 844 | Ga0207663_10093191 | |||
| 845 | Ga0207660_10085477 | |||
| 846 | Ga0207660_10094134 | |||
| 847 | Ga0207657_10029172 | |||
| 848 | Ga0207657_10056699 | |||
| 849 | Ga0207652_10010333 | |||
| 850 | Ga0207652_10012218 | |||
| 851 | Ga0207652_10505135 | |||
| 852 | Ga0207646_10004059 | |||
| 853 | Ga0207646_10305022 | |||
| 854 | Ga0207694_10104405 | |||
| 855 | Ga0207659_10567249 | |||
| 856 | Ga0207687_10269941 | |||
| 857 | Ga0207687_10284835 | |||
| 858 | Ga0207687_10471915 | |||
| 859 | Ga0207700_10007224 | |||
| 860 | Ga0207700_10009070 | |||
| 861 | Ga0207700_10378661 | |||
| 862 | Ga0207700_10388680 | |||
| 863 | Ga0207664_10000905 | |||
| 864 | Ga0207664_10005795 | |||
| 865 | Ga0207664_10015437 | |||
| 866 | Ga0207664_10161500 | |||
| 867 | Ga0207664_10175060 | |||
| 868 | Ga0207664_10335899 | |||
| 869 | Ga0207664_10390581 | |||
| 870 | Ga0207664_10681397 | |||
| 871 | Ga0207690_10426920 | |||
| 872 | Ga0207690_10529222 | |||
| 873 | Ga0207709_10003528 | |||
| 874 | Ga0207709_10323460 | |||
| 875 | Ga0207669_10037457 | |||
| 876 | Ga0207669_10533430 | |||
| 877 | Ga0207665_10576352 | |||
| 878 | Ga0207711_10000139 | |||
| 879 | Ga0207711_10001985 | |||
| 880 | Ga0207711_10056534 | |||
| 881 | Ga0207661_10034973 | |||
| 882 | Ga0207661_10092008 | |||
| 883 | Ga0207661_10246238 | |||
| 884 | Ga0207667_10020380 | |||
| 885 | Ga0207712_10032971 | |||
| 886 | Ga0207668_10033679 | |||
| 887 | Ga0207668_10515587 | |||
| 888 | Ga0207668_10565639 | |||
| 889 | Ga0207668_10744639 | |||
| 890 | Ga0207640_10224444 | |||
| 891 | Ga0207658_10142555 | |||
| 892 | Ga0207703_10000001 | |||
| 893 | Ga0207703_10000005 | |||
| 894 | Ga0207703_10010127 | |||
| 895 | Ga0207703_10073459 | |||
| 896 | Ga0207703_11085085 | |||
| 897 | Ga0207678_10009232 | |||
| 898 | Ga0207678_10050234 | |||
| 899 | Ga0207708_10000006 | |||
| 900 | Ga0207702_10116074 | |||
| 901 | Ga0207702_10290604 | |||
| 902 | Ga0207702_10477570 | |||
| 903 | Ga0207641_10002336 | |||
| 904 | Ga0207641_10019942 | |||
| 905 | Ga0207641_10061132 | |||
| 906 | Ga0207674_10042871 | |||
| 907 | Ga0207674_10160121 | |||
| 908 | Ga0207674_10437989 | |||
| 909 | Ga0207674_10829589 | |||
| 910 | Ga0207674_10851314 | |||
| 911 | Ga0207674_11010344 | |||
| 912 | Ga0207698_10072152 | |||
| 913 | Ga0207698_10122038 | |||
| 914 | Ga0268266_10007158 | |||
| 915 | Ga0268266_10015387 | |||
| 916 | Ga0268266_11021038 | |||
| 917 | Ga0268265_10000036 | |||
| 918 | Ga0268264_10000027 | |||
| 919 | Ga0265326_10001843 | |||
| 920 | Ga0265319_1001655 | |||
| 921 | Ga0265334_10001004 | |||
| 922 | Ga0265318_10029363 | |||
| 923 | Ga0265323_10002194 | |||
| 924 | Ga0265322_10008706 | |||
| 925 | Ga0265336_10016413 | |||
| 926 | Ga0307515_10010194 | |||
| 927 | Ga0265338_10000375 | |||
| 928 | Ga0265338_10002853 | |||
| 929 | Ga0265338_10392240 | |||
| 930 | Ga0265324_10015922 | |||
| 931 | Ga0307511_10140723 | |||
| 932 | Ga0316176_1120625 | |||
| 933 | Ga0265332_10020884 | |||
| 934 | Ga0265320_10004313 | |||
| 935 | Ga0265325_10036982 | |||
| 936 | Ga0265325_10164686 | |||
| 937 | Ga0265340_10018547 | |||
| 938 | Ga0265327_10000081 | |||
| 939 | Ga0265327_10022919 | |||
| 940 | Ga0265316_10024890 | |||
| 941 | Ga0307513_10000036 | |||
| 942 | Ga0307513_10540770 | |||
| 943 | Ga0265313_10005443 | |||
| 944 | Ga0265313_10037699 | |||
| 945 | Ga0307508_10262837 | |||
| 946 | Ga0265314_10032072 | |||
| 947 | Ga0265342_10003186 | |||
| 948 | Ga0307516_10123274 | |||
| 949 | Ga0307405_10212608 | |||
| 950 | Ga0307413_10012439 | |||
| 951 | Ga0307413_10026265 | |||
| 952 | Ga0307413_10280386 | |||
| 953 | Ga0307413_10496477 | |||
| 954 | Ga0307413_11028241 | |||
| 955 | Ga0307406_10167012 | |||
| 956 | Ga0307406_10252023 | |||
| 957 | Ga0307406_10609275 | |||
| 958 | Ga0307412_10133184 | |||
| 959 | Ga0307409_100010653 | |||
| 960 | Ga0307416_100237269 | |||
| 961 | Ga0307416_102137156 | |||
| 962 | Ga0307411_10103101 | |||
| 963 | Ga0307415_100051048 | |||
| 964 | Ga0307415_100100210 | |||
| 965 | Ga0316215_1002023 | |||
| 966 | Ga0316214_1007121 | |||
| 967 | Ga0373948_0014186 | |||
| 968 | Ga0373926_0005546 | |||
| 969 | Ga0373928_0005646 | |||
| 970 | Ga0373934_0004588 | |||
| 971 | Ga0373934_0035503 | |||
| 972 | Ga0373944_0000868 | |||
| 973 | Ga0373923_0009102 | |||
| 974 | Ga0373936_0002982 | |||
| 975 | Ga0373936_0065118 | |||
| 976 | Ga0373945_0000716 | |||
| 977 | Ga0373945_0102013 | |||
| 978 | Ga0373953_0056556 | |||
| 979 | Ga0373954_0163288 | |||
| 980 | Ga0373956_0037647 | |||
| 981 | Ga0373957_0062774 | |||
| 982 | Ga0373943_0000130 | |||
| 983 | Ga0373943_0334106 | |||
| 984 | Ga0373946_0001483 | |||
| 985 | Ga0373955_0006440 | |||
| 986 | Ga0373955_0329275 | |||
| 987 | Ga0373942_0001479 | |||
| 988 | Ga0373962_0006085 | |||
| 989 | Ga0373962_0103802 | |||
| 990 | Ga0373927_0003020 | |||
| 991 | Ga0373927_0055083 | |||
| 992 | Ga0373927_0085008 | |||
| 993 | Ga0373927_0426971 | |||
| 994 | Ga0373933_0034278 | |||
| 995 | Ga0373933_0371932 | |||
| 996 | Ga0373947_0000859 | |||
| 997 | Ga0373937_0004414 | |||
| 998 | Ga0373937_0476539 | |||
| 999 | Ga0372808_008069 | |||
| 1000 | Ga0373925_0004821 | |||
| 1001 | Ga0373925_0021089 | |||
| 1002 | Ga0373925_0342678 | |||
| 1003 | Ga0395899_0058596 | |||
| 1004 | Ga0395900_0058712 | |||
| 1005 | Ga0395900_0112385 | |||
| 1006 | Ga0395900_0632069 | |||
| 1007 | Ga0395898_0025326 | |||
| 1008 | Ga0395898_0380295 | |||
| 1009 | Ga0395905_0133341 | |||
| 1010 | Ga0436364_0073643 | |||
| 1011 | Ga0436364_0334702 | |||
| 1012 | Ga0436364_0619304 | |||
| 1013 | Ga0436364_0750281 | |||
| 1014 | Ga0436364_0918298 | |||
| 1015 | Ga0436364_1109937 | |||
| 1016 | Ga0436364_1436887 | |||
| 1017 | Ga0436364_1529512 | |||
| 1018 | Ga0395901_0041064 | |||
| 1019 | Ga0395901_0114657 | |||
| 1020 | Ga0436365_0229080 | |||
| 1021 | Ga0436365_0546973 | |||
| 1022 | Ga0436361_1098832 | |||
| 1023 | Ga0436363_1654893 | |||
| 1024 | Ga0436362_0433029 | |||
| 1025 | Ga0439436_0004777 | |||
| 1026 | Ga0439439_0011527 | |||
| 1027 | Ga0439461_0001648 | |||
| 1028 | Ga0439466_0002122 | |||
| 1029 | Ga0439466_0025984 | |||
| 1030 | Ga0439465_0008854 | |||
| 1031 | Ga0451843_1213717 | |||
| 1032 | Ga0451855_1355414 | |||
| 1033 | Ga0451853_1711214 | |||
| 1034 | Ga0439431_0000763 | |||
| 1035 | Ga0439442_045320 | |||
| 1036 | Ga0439445_0003022 | |||
| 1037 | Ga0439449_0010170 | |||
| 1038 | Ga0439434_0002936 | |||
| 1039 | Ga0466972_0011564 | |||
| 1040 | Ga0466965_0037619 | |||
| 1041 | Ga0466965_0330294 | |||
| 1042 | Ga0466966_0144511 | |||
| 1043 | Ga0466963_0052001 | |||
| 1044 | Ga0466963_0154485 | |||
| 1045 | Ga0466963_0306592 | |||
| 1046 | Ga0466970_0008163 | |||
| 1047 | Ga0466970_0021385 | |||
| 1048 | Ga0466970_0321283 | |||
| 1049 | Ga0466957_0024443 | |||
| 1050 | Ga0466960_0014451 | |||
| 1051 | Ga0466960_0064299 | |||
| 1052 | Ga0466959_0006884 | |||
| 1053 | Ga0466958_0267417 | |||
| 1054 | Ga0466958_0330671 | |||
| 1055 | Ga0466967_0001549 | |||
| 1056 | Ga0466967_0024659 | |||
| 1057 | Ga0466967_0045503 | |||
| 1058 | Ga0466967_0198934 | |||
| 1059 | Ga0466967_0513890 | |||
| 1060 | Ga0466967_0519447 | |||
| 1061 | Ga0466967_0545779 | |||
| 1062 | Ga0466967_0662351 | |||
| 1063 | Ga0466967_0814580 | |||
| 1064 | Ga0466967_0902438 | |||
| 1065 | Ga0495592_0060084 | |||
| 1066 | Ga0495592_0240872 | |||
| 1067 | Ga0495641_0020614 | |||
| 1068 | Ga0495651_0001625 | |||
| 1069 | Ga0495651_0018640 | |||
| 1070 | Ga0495653_0007099 | |||
| 1071 | Ga0495653_0012007 | |||
| 1072 | Ga0495653_0319723 | |||
| 1073 | Ga0495582_0016149 | |||
| 1074 | Ga0495664_0003273 | |||
| 1075 | Ga0495664_0076885 | |||
| 1076 | Ga0495664_0184767 | |||
| 1077 | Ga0495594_0027564 | |||
| 1078 | Ga0495607_0008802 | |||
| 1079 | Ga0495608_0000820 | |||
| 1080 | Ga0495608_0154135 | |||
| 1081 | Ga0495618_0019630 | |||
| 1082 | Ga0495618_0022673 | |||
| 1083 | Ga0495618_0142483 | |||
| 1084 | Ga0495628_0017435 | |||
| 1085 | Ga0495628_0172777 | |||
| 1086 | Ga0495628_0257882 | |||
| 1087 | Ga0495630_0007824 | |||
| 1088 | Ga0495648_0011573 | |||
| 1089 | Ga0495652_0016462 | |||
| 1090 | Ga0495652_0091995 | |||
| 1091 | Ga0495652_0114343 | |||
| 1092 | Ga0495652_0170812 | |||
| 1093 | Ga0495665_0022445 | |||
| 1094 | Ga0495640_0033366 | |||
| 1095 | Ga0495640_0051682 | |||
| 1096 | Ga0495640_0621776 | |||
| 1097 | Ga0495586_0203479 | |||
| 1098 | Ga0495587_0046406 | |||
| 1099 | Ga0495587_0142336 | |||
| 1100 | Ga0495645_0017633 | |||
| 1101 | Ga0495645_0078193 | |||
| 1102 | Ga0495645_0181643 | |||
| 1103 | Ga0495667_0003813 | |||
| 1104 | Ga0495667_0005758 | |||
| 1105 | Ga0495634_0010918 | |||
| 1106 | Ga0495635_0002325 | |||
| 1107 | Ga0495635_0005287 | |||
| 1108 | Ga0495635_0075167 | |||
| 1109 | Ga0495657_0008441 | |||
| 1110 | Ga0495599_0156616 | |||
| 1111 | Ga0495623_0399723 | |||
| 1112 | Ga0495646_0133572 | |||
| 1113 | Ga0495624_0003787 | |||
| 1114 | Ga0495624_0308699 | |||
| 1115 | Ga0495600_0000417 | |||
| 1116 | Ga0495600_0131600 | |||
| 1117 | Ga0495581_0018199 | |||
| 1118 | Ga0495604_0119804 | |||
| 1119 | Ga0495604_0161600 | |||
| 1120 | Ga0495674_0004740 | |||
| 1121 | Ga0495674_0006023 | |||
| 1122 | Ga0495674_0196862 | |||
| 1123 | Ga0495674_0248924 | |||
| 1124 | Ga0495676_0163773 | |||
| 1125 | Ga0495676_0248522 | |||
| 1126 | Ga0495680_0013265 | |||
| 1127 | Ga0495680_0031165 | |||
| 1128 | Ga0495683_0000307 | |||
| 1129 | Ga0495675_0433014 | |||
| 1130 | Ga0495684_0008594 | |||
| 1131 | Ga0495684_0012523 | |||
| 1132 | Ga0495593_0187831 | |||
| 1133 | Ga0495593_0285844 | |||
| 1134 | Ga0495602_0009196 | |||
| 1135 | Ga0495602_0062659 | |||
| 1136 | Ga0495602_0222825 | |||
| 1137 | Ga0495602_0433631 | |||
| 1138 | Ga0496100_0034211 | |||
| 1139 | Ga0496101_0087550 | |||
| 1140 | Ga0496101_0187317 | |||
| 1141 | Ga0496101_0271512 | |||
| 1142 | Ga0496102_0087660 | |||
| 1143 | Ga0496102_0258259 | |||
| 1144 | Ga0496102_0923121 | |||
| 1145 | Ga0496103_0167281 | |||
| 1146 | Ga0496104_0004858 | |||
| 1147 | Ga0496104_0487496 | |||
| 1148 | Ga0496104_0871526 | |||
| 1149 | Ga0496105_0032739 | |||
| 1150 | Ga0496106_0239492 | |||
| 1151 | Ga0496107_0269642 | |||
| 1152 | Ga0496108_0010895 | |||
| 1153 | Ga0496108_0101447 | |||
| 1154 | Ga0496108_0272968 | |||
| 1155 | Ga0496108_0487448 | |||
| 1156 | Ga0496109_0016313 | |||
| 1157 | Ga0496109_0017171 | |||
| 1158 | Ga0496110_0021350 | |||
| 1159 | Ga0496110_0062483 | |||
| 1160 | Ga0496110_0343015 | |||
| 1161 | Ga0496111_0011388 | |||
| 1162 | Ga0496111_0366615 | |||
| 1163 | Ga0496112_0009059 | |||
| 1164 | Ga0496112_0026126 | |||
| 1165 | Ga0496112_0095227 | |||
| 1166 | Ga0496112_0362170 | |||
| 1167 | Ga0496112_0852810 | |||
| 1168 | Ga0496113_0009174 | |||
| 1169 | Ga0496113_0010820 | |||
| 1170 | Ga0496113_0329123 | |||
| 1171 | Ga0496114_0071896 | |||
| 1172 | Ga0496114_0115374 | |||
| 1173 | Ga0496114_0251927 | |||
| 1174 | Ga0496116_0000310 | |||
| 1175 | Ga0496117_0024497 | |||
| 1176 | Ga0496118_0021538 | |||
| 1177 | Ga0496119_0001466 | |||
| 1178 | Ga0496119_0009177 | |||
| 1179 | Ga0496119_0044332 | |||
| 1180 | Ga0496120_0002341 | |||
| 1181 | Ga0496121_0015092 | |||
| 1182 | Ga0496121_0041629 | |||
| 1183 | Ga0496126_0000006 | |||
| 1184 | Ga0496126_0008928 | |||
| 1185 | Ga0496126_0164119 | |||
| 1186 | Ga0501031_0171228 | |||
| 1187 | Ga0501033_0479173 | |||
| 1188 | Ga0501034_0224573 | |||
| 1189 | Ga0501034_0302219 | |||
| 1190 | Ga0501034_0369402 | |||
| 1191 | Ga0501036_0001795 | |||
| 1192 | Ga0501036_0119546 | |||
| 1193 | Ga0501036_0123681 | |||
| 1194 | Ga0501036_0768558 | |||
| 1195 | Ga0501037_0027253 | |||
| 1196 | Ga0501037_0078608 | |||
| 1197 | Ga0501037_0261934 | |||
| 1198 | Ga0501038_0022030 | |||
| 1199 | Ga0501038_0085770 | |||
| 1200 | Ga0501038_0322908 | |||
| 1201 | Ga0501038_0349262 | |||
| 1202 | Ga0501039_0025278 | |||
| 1203 | Ga0501039_0539715 | |||
| 1204 | Ga0501041_0296031 | |||
| 1205 | Ga0501042_0046091 | |||
| 1206 | Ga0501042_0629886 | |||
| 1207 | Ga0501043_0014677 | |||
| 1208 | Ga0501043_0512284 | |||
| 1209 | Ga0501046_0054853 | |||
| 1210 | Ga0501047_0007046 | |||
| 1211 | Ga0501047_0161145 | |||
| 1212 | Ga0501047_0280814 | |||
| 1213 | Ga0501047_0446416 | |||
| 1214 | Ga0501048_0005497 | |||
| 1215 | Ga0501048_0203869 | |||
| 1216 | Ga0501067_0000719 | |||
| 1217 | Ga0501067_0089514 | |||
| 1218 | Ga0501068_0063291 | |||
| 1219 | Ga0501068_0065105 | |||
| 1220 | Ga0501068_0162720 | |||
| 1221 | Ga0501069_0057175 | |||
| 1222 | Ga0501069_0189476 | |||
| 1223 | Ga0501069_0205059 | |||
| 1224 | Ga0501069_0393388 | |||
| 1225 | Ga0501070_0012959 | |||
| 1226 | Ga0501070_0287593 | |||
| 1227 | Ga0501071_0110056 | |||
| 1228 | Ga0501071_0131864 | |||
| 1229 | Ga0501071_0206098 | |||
| 1230 | Ga0501071_0242609 | |||
| 1231 | Ga0501071_0394462 | |||
| 1232 | Ga0501072_0018063 | |||
| 1233 | Ga0501072_0380493 | |||
| 1234 | Ga0501073_0008951 | |||
| 1235 | Ga0501073_0009218 | |||
| 1236 | Ga0501073_0357893 | |||
| 1237 | Ga0501074_0001106 | |||
| 1238 | Ga0501074_0013656 | |||
| 1239 | Ga0501074_0085137 | |||
| 1240 | Ga0501074_0227699 | |||
| 1241 | Ga0501075_0024203 | |||
| 1242 | Ga0501076_0106465 | |||
| 1243 | Ga0501077_0034672 | |||
| 1244 | Ga0501077_0257201 | |||
| 1245 | Ga0501079_0018176 | |||
| 1246 | Ga0501079_0099348 | |||
| 1247 | Ga0501080_0098962 | |||
| 1248 | Ga0501080_0230125 | |||
| 1249 | Ga0501080_0417543 | |||
| 1250 | Ga0501083_0329309 | |||
| 1251 | Ga0501035_0000279 | |||
| 1252 | Ga0501035_0059930 | |||
| 1253 | Ga0501044_0003828 | |||
| 1254 | Ga0501044_0066316 | |||
| 1255 | Ga0501044_0329654 | |||
| 1256 | Ga0501044_0661914 | |||
| 1257 | Ga0501044_0696410 | |||
| 1258 | Ga0501045_0625179 | |||
| 1259 | nmdc:mga03683_12456_c1 | |||
| 1260 | nmdc:mga03n38_122174_c1 | |||
| 1261 | nmdc:mga03n38_158218_c1 | |||
| 1262 | nmdc:mga03n38_340655_c1 | |||
| 1263 | nmdc:mga03n38_495_c1 | |||
| 1264 | nmdc:mga00v17_154798_c1 | |||
| 1265 | nmdc:mga00v17_16308_c1 | |||
| 1266 | nmdc:mga00v17_195263_c1 | |||
| 1267 | nmdc:mga0yw44_1796_c1 | |||
| 1268 | nmdc:mga0yw44_195110_c1 | |||
| 1269 | nmdc:mga0yw44_2268_c1 | |||
| 1270 | nmdc:mga0yw44_239672_c1 | |||
| 1271 | nmdc:mga0yw44_286051_c1 | |||
| 1272 | nmdc:mga0yw44_338581_c1 | |||
| 1273 | nmdc:mga07m45_150377_c1 | |||
| 1274 | nmdc:mga07m45_21750_c1 | |||
| 1275 | nmdc:mga07m45_410479_c1 | |||
| 1276 | nmdc:mga09592_649852_c1 | |||
| 1277 | nmdc:mga06r32_566977_c1 | |||
| 1278 | nmdc:mga08y16_324108_c1 | |||
| 1279 | nmdc:mga08x19_804373_c1 | |||
| 1280 | Ga0495601_0258270 | |||
| 1281 | Ga0495655_0007260 | |||
| 1282 | Ga0495655_0128270 | |||
| 1283 | Ga0495619_0007016 | |||
| 1284 | Ga0500616_0006155 | |||
| 1285 | Ga0501084_0111939 | |||
| 1286 | Ga0501084_0153840 | |||
| 1287 | Ga0501084_0611676 | |||
| 1288 | Ga0501082_0069726 | |||
| 1289 | Ga0501082_0109390 | |||
| 1290 | 2506866663 | |||
| 1291 | 2548694740 | |||
| 1292 | 2552107303 | |||
| 1293 | 2644518250 | |||
| 1294 | 2644635188 | |||
| 1295 | 2676487454 | |||
| 1296 | 2739239324 | |||
| 1297 | 2739366809 | |||
| 1298 | 2753268218 | |||
| 1299 | 2774905825 | |||
| 1300 | 2791914530 | |||
| 1301 | 2795796060 | |||
| 1302 | 2842137747 | |||
| 1303 | 2861523862 | |||
| 1304 | 2889302041 | |||
| 1305 | 2902803878 | |||
| 1306 | 2902812925 | |||
| 1307 | 2904769261 | |||
| 1308 | 2904772817 | |||
| 1309 | 2908814377 | |||
| 1310 | 2919422818 | |||
| 1311 | 2919434929 | |||
| 1312 | 2919718842 | |||
| 1313 | 2928147308 | |||
| 1314 | 2939748137 | |||
| 1315 | 2974317834 | |||
| 1316 | 2984526043 | |||
| 1317 | 3001120310 | |||
| 1318 | 8003862341 | |||
| 1319 | 8056059846 | |||
| 1320 | 8057572262 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7od9-assembly1.cif.gz_B | crystal structure of activated chey fused to the c-terminal domain of chef | 0.9679 | 10 | 121 |
| 6ekh-assembly1.cif.gz_Y | crystal structure of activated chey from methanoccocus maripaludis | 0.9564 | 11 | 124 |
| 7ve6-assembly1.cif.gz_B | n-terminal domain of vrar | 0.9451 | 13 | 124 |
| 3hzh-assembly1.cif.gz_A | crystal structure of the chex-chey-bef3-mg+2 complex from borrelia burgdorferi | 0.9394 | 7 | 123 |
| 5hm6-assembly1.cif.gz_A | n-terminal domain of bfmr from acinetobacter baumannii | 0.9369 | 10 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGM3_143_205_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 1.014 | 142 | 197 | 1.10.10.10 |
| 1s8nA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9993 | 143 | 198 | 1.10.10.10 |
| 1sd5A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9981 | 144 | 198 | 1.10.10.10 |
| 1qo0E02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9803 | 150 | 191 | 1.10.10.10 |
| 1qo0D02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9783 | 150 | 193 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A656KWU8-F1-model_v4 | deleted | 0.9958 | 11 | 136 |
|
| AF-A0A1L5L2D7-F1-model_v4 | Response regulator receiver domain | 0.9887 | 9 | 115 |
GO:0000160
|
| AF-A0A358D4B7-F1-model_v4 | Response regulatory domain-containing protein | 0.9877 | 9 | 114 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7W1TLL1-F1-model_v4 | Response regulator | 0.9864 | 11 | 196 |
GO:0000156
GO:0000976 GO:0003723 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7X6ENQ6-F1-model_v4 | deleted | 0.9852 | 8 | 114 |
|