F473316
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 660 | 346 | 652 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300005564|Ga0070664_100588136|Ga0070664_1005881362 |
| Length | 143 |
| Sequence | MIESISLVTVYCLDQSATRDFYVDHLGFEPRVDATMGEFRWVTIAHPSQPELEVTLMLPGPPLAPDAAAFIRSQLESGQMGGLGLRVDDCRKTAADLTKAGVTFIQEPSDRPYGVEAVIRDNTGNWLTLVEPKAFTQEDLKKF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 3 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 4 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 114 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 170 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 183 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 184 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 185 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 186 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 187 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 188 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 190 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 196 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 202 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 224 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 225 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 226 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 232 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 233 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 236 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 237 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 238 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 239 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 240 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 241 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 242 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 297 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 298 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 299 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 300 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 309 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 310 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 311 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 312 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 313 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 319 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 320 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 321 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 332 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 337 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 338 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 339 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 344 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 345 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 346 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.97 |
| Metatranscriptomes | 1.82 |
| Isolates | 1.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.12 |
| Nodule | 0.45 |
| Rhizoplane | 6.67 |
| Rhizosphere | 86.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10088469 | 3300002077 | Bacteria | 568 |
| 2 | JGI25406J46586_10047135 | 3300003203 | Bacteria | 1470 |
| 3 | JGI25406J46586_10069493 | 3300003203 | Bacteria | 1109 |
| 4 | JGI25406J46586_10114731 | 3300003203 | Bacteria | 796 |
| 5 | Ga0058861_12044538 | 3300004800 | Bacteria | 957 |
| 6 | Ga0070658_10445188 | 3300005327 | Bacteria | 1116 |
| 7 | Ga0070676_10234244 | 3300005328 | Bacteria | 1218 |
| 8 | Ga0070683_100004578 | 3300005329 | Bacteria | 11414 |
| 9 | Ga0070670_100540284 | 3300005331 | Bacteria | 1039 |
| 10 | Ga0068869_100008619 | 3300005334 | Bacteria | 6584 |
| 11 | Ga0070666_10859439 | 3300005335 | Bacteria | 670 |
| 12 | Ga0070680_100104608 | 3300005336 | Bacteria | 2352 |
| 13 | Ga0070682_100022080 | 3300005337 | Bacteria | 3765 |
| 14 | Ga0070682_100045776 | 3300005337 | Bacteria | 2713 |
| 15 | Ga0070682_100290382 | 3300005337 | Bacteria | 1196 |
| 16 | Ga0068868_100008936 | 3300005338 | Bacteria | 7188 |
| 17 | Ga0070660_100151329 | 3300005339 | Bacteria | 1866 |
| 18 | Ga0070660_101163086 | 3300005339 | Bacteria | 654 |
| 19 | Ga0070691_10149956 | 3300005341 | Bacteria | 1195 |
| 20 | Ga0070661_100004316 | 3300005344 | Bacteria | 9809 |
| 21 | Ga0070692_10201040 | 3300005345 | Bacteria | 1167 |
| 22 | Ga0070668_100011862 | 3300005347 | Bacteria | 6492 |
| 23 | Ga0070669_100301732 | 3300005353 | Bacteria | 1288 |
| 24 | Ga0070675_100004936 | 3300005354 | Bacteria | 10173 |
| 25 | Ga0070671_100603280 | 3300005355 | Bacteria | 949 |
| 26 | Ga0070674_100101872 | 3300005356 | Bacteria | 2093 |
| 27 | Ga0070674_100193779 | 3300005356 | Bacteria | 1565 |
| 28 | Ga0070659_100279830 | 3300005366 | Bacteria | 1388 |
| 29 | Ga0070659_100493504 | 3300005366 | Bacteria | 1043 |
| 30 | Ga0070667_100832163 | 3300005367 | Bacteria | 858 |
| 31 | Ga0070667_101401293 | 3300005367 | Bacteria | 656 |
| 32 | Ga0070714_100308157 | 3300005435 | Bacteria | 1478 |
| 33 | Ga0070713_100080884 | 3300005436 | Bacteria | 2771 |
| 34 | Ga0070713_100708539 | 3300005436 | Bacteria | 961 |
| 35 | Ga0070713_100830352 | 3300005436 | Bacteria | 887 |
| 36 | Ga0070710_10486792 | 3300005437 | Bacteria | 842 |
| 37 | Ga0070705_100096038 | 3300005440 | Bacteria | 1860 |
| 38 | Ga0070700_100042312 | 3300005441 | Bacteria | 2796 |
| 39 | Ga0070663_100221661 | 3300005455 | Bacteria | 1485 |
| 40 | Ga0070663_100666638 | 3300005455 | Bacteria | 881 |
| 41 | Ga0070678_100396902 | 3300005456 | Bacteria | 1197 |
| 42 | Ga0070678_100424497 | 3300005456 | Bacteria | 1160 |
| 43 | Ga0070678_100464523 | 3300005456 | Bacteria | 1111 |
| 44 | Ga0070662_100051948 | 3300005457 | Bacteria | 2962 |
| 45 | Ga0070681_10399978 | 3300005458 | Bacteria | 1285 |
| 46 | Ga0070681_10505101 | 3300005458 | Bacteria | 1122 |
| 47 | Ga0070707_100454077 | 3300005468 | Bacteria | 1242 |
| 48 | Ga0070699_100408732 | 3300005518 | Bacteria | 1228 |
| 49 | Ga0070679_100088015 | 3300005530 | Bacteria | 3093 |
| 50 | Ga0070679_100265064 | 3300005530 | Bacteria | 1673 |
| 51 | Ga0070684_100018599 | 3300005535 | Bacteria | 5729 |
| 52 | Ga0070684_100700122 | 3300005535 | Bacteria | 944 |
| 53 | Ga0068853_100285853 | 3300005539 | Bacteria | 1521 |
| 54 | Ga0070672_100501517 | 3300005543 | Bacteria | 1050 |
| 55 | Ga0070672_100584638 | 3300005543 | Bacteria | 972 |
| 56 | Ga0070686_101729858 | 3300005544 | Bacteria | 531 |
| 57 | Ga0070693_100935875 | 3300005547 | Bacteria | 652 |
| 58 | Ga0070665_100383287 | 3300005548 | Bacteria | 1413 |
| 59 | Ga0070665_101405824 | 3300005548 | Bacteria | 707 |
| 60 | Ga0070704_100181627 | 3300005549 | Bacteria | 1683 |
| 61 | Ga0068855_100937246 | 3300005563 | Bacteria | 913 |
| 62 | Ga0070664_100004701 | 3300005564 | Bacteria | 10950 |
| 63 | Ga0070664_100471016 | 3300005564 | Bacteria | 1155 |
| 64 | Ga0070664_100588136 | 3300005564 | Bacteria | 1032 |
| 65 | Ga0070664_101054139 | 3300005564 | Bacteria | 765 |
| 66 | Ga0068857_100372400 | 3300005577 | Bacteria | 1325 |
| 67 | Ga0068857_100474031 | 3300005577 | Bacteria | 1172 |
| 68 | Ga0068857_100946067 | 3300005577 | Bacteria | 827 |
| 69 | Ga0068854_100141147 | 3300005578 | Bacteria | 1849 |
| 70 | Ga0068854_100611415 | 3300005578 | Bacteria | 932 |
| 71 | Ga0068856_100049655 | 3300005614 | Bacteria | 4135 |
| 72 | Ga0068856_100769177 | 3300005614 | Bacteria | 983 |
| 73 | Ga0070702_100019124 | 3300005615 | Bacteria | 3565 |
| 74 | Ga0068852_100217899 | 3300005616 | Bacteria | 1814 |
| 75 | Ga0068852_100312974 | 3300005616 | Bacteria | 1523 |
| 76 | Ga0068859_100000154 | 3300005617 | Bacteria | 65719 |
| 77 | Ga0068859_101339204 | 3300005617 | Bacteria | 789 |
| 78 | Ga0068859_101376898 | 3300005617 | Bacteria | 778 |
| 79 | Ga0068864_100078271 | 3300005618 | Bacteria | 2893 |
| 80 | Ga0068864_100109942 | 3300005618 | Bacteria | 2454 |
| 81 | Ga0068864_100598043 | 3300005618 | Bacteria | 1070 |
| 82 | Ga0068866_10026408 | 3300005718 | Bacteria | 2742 |
| 83 | Ga0068861_100065031 | 3300005719 | Bacteria | 2808 |
| 84 | Ga0068861_100900185 | 3300005719 | Bacteria | 838 |
| 85 | Ga0068861_101807545 | 3300005719 | Bacteria | 606 |
| 86 | Ga0068863_100000396 | 3300005841 | Bacteria | 44275 |
| 87 | Ga0068863_100127105 | 3300005841 | Bacteria | 2432 |
| 88 | Ga0068863_100274438 | 3300005841 | Bacteria | 1632 |
| 89 | Ga0068858_100056743 | 3300005842 | Bacteria | 3619 |
| 90 | Ga0068862_100000021 | 3300005844 | Bacteria | 218035 |
| 91 | Ga0068862_100045409 | 3300005844 | Bacteria | 3749 |
| 92 | Ga0081455_10077476 | 3300005937 | Bacteria | 2735 |
| 93 | Ga0081455_10182503 | 3300005937 | Bacteria | 1587 |
| 94 | Ga0081455_10310483 | 3300005937 | Bacteria | 1127 |
| 95 | Ga0081455_10446366 | 3300005937 | Bacteria | 885 |
| 96 | Ga0081540_1000330 | 3300005983 | Bacteria | 49099 |
| 97 | Ga0081540_1023100 | 3300005983 | Bacteria | 3650 |
| 98 | Ga0081540_1124493 | 3300005983 | Bacteria | 1063 |
| 99 | Ga0081539_10001061 | 3300005985 | Bacteria | 50266 |
| 100 | Ga0081539_10005056 | 3300005985 | Bacteria | 13848 |
| 101 | Ga0081539_10006076 | 3300005985 | Bacteria | 11808 |
| 102 | Ga0081539_10032287 | 3300005985 | Bacteria | 3209 |
| 103 | Ga0075364_10011580 | 3300006051 | Bacteria | 5360 |
| 104 | Ga0075432_10046963 | 3300006058 | Bacteria | 1517 |
| 105 | Ga0075432_10047115 | 3300006058 | Bacteria | 1515 |
| 106 | Ga0070716_100022842 | 3300006173 | Bacteria | 3310 |
| 107 | Ga0070716_100190303 | 3300006173 | Bacteria | 1355 |
| 108 | Ga0075362_10190751 | 3300006177 | Bacteria | 995 |
| 109 | Ga0075367_10046560 | 3300006178 | Bacteria | 2548 |
| 110 | Ga0075369_10005526 | 3300006186 | Bacteria | 4730 |
| 111 | Ga0075369_10008271 | 3300006186 | Bacteria | 3999 |
| 112 | Ga0097621_100233258 | 3300006237 | Bacteria | 1607 |
| 113 | Ga0097621_101176367 | 3300006237 | Unclassified | 722 |
| 114 | Ga0075370_10013519 | 3300006353 | Bacteria | 4343 |
| 115 | Ga0075428_100035067 | 3300006844 | Bacteria | 5531 |
| 116 | Ga0075428_100078598 | 3300006844 | Bacteria | 3601 |
| 117 | Ga0075428_100083061 | 3300006844 | Bacteria | 3495 |
| 118 | Ga0075428_100085371 | 3300006844 | Bacteria | 3442 |
| 119 | Ga0075428_100271714 | 3300006844 | Bacteria | 1824 |
| 120 | Ga0075428_100891308 | 3300006844 | Bacteria | 944 |
| 121 | Ga0075430_100009697 | 3300006846 | Bacteria | 8135 |
| 122 | Ga0075430_100016404 | 3300006846 | Bacteria | 6306 |
| 123 | Ga0075430_100052237 | 3300006846 | Bacteria | 3442 |
| 124 | Ga0075431_100012493 | 3300006847 | Bacteria | 8574 |
| 125 | Ga0075431_100077006 | 3300006847 | Bacteria | 3442 |
| 126 | Ga0075431_100133189 | 3300006847 | Bacteria | 2563 |
| 127 | Ga0075431_100336653 | 3300006847 | Bacteria | 1519 |
| 128 | Ga0075431_100363542 | 3300006847 | Bacteria | 1453 |
| 129 | Ga0075431_100368401 | 3300006847 | Bacteria | 1442 |
| 130 | Ga0075431_101095491 | 3300006847 | Bacteria | 761 |
| 131 | Ga0075433_10031189 | 3300006852 | Bacteria | 4555 |
| 132 | Ga0075433_10226522 | 3300006852 | Bacteria | 1660 |
| 133 | Ga0075433_10524168 | 3300006852 | Bacteria | 1042 |
| 134 | Ga0075434_100112049 | 3300006871 | Bacteria | 2739 |
| 135 | Ga0075434_100900179 | 3300006871 | Bacteria | 900 |
| 136 | Ga0075429_100002650 | 3300006880 | Bacteria | 15052 |
| 137 | Ga0075429_100134249 | 3300006880 | Bacteria | 2165 |
| 138 | Ga0075429_101862067 | 3300006880 | Bacteria | 522 |
| 139 | Ga0075436_100108698 | 3300006914 | Bacteria | 1935 |
| 140 | Ga0097620_100000154 | 3300006931 | Bacteria | 65719 |
| 141 | Ga0097620_101339171 | 3300006931 | Bacteria | 789 |
| 142 | Ga0097620_101376940 | 3300006931 | Bacteria | 778 |
| 143 | Ga0075435_100009714 | 3300007076 | Bacteria | 6990 |
| 144 | Ga0075435_100360398 | 3300007076 | Bacteria | 1247 |
| 145 | Ga0099795_10013838 | 3300007788 | Bacteria | 2487 |
| 146 | Ga0105251_10079911 | 3300009011 | Bacteria | 1513 |
| 147 | Ga0105240_10678583 | 3300009093 | Bacteria | 1127 |
| 148 | Ga0105240_10905943 | 3300009093 | Bacteria | 948 |
| 149 | Ga0111539_10005471 | 3300009094 | Bacteria | 16434 |
| 150 | Ga0111539_10160291 | 3300009094 | Bacteria | 2631 |
| 151 | Ga0105245_10011203 | 3300009098 | Bacteria | 7805 |
| 152 | Ga0105245_10334566 | 3300009098 | Bacteria | 1496 |
| 153 | Ga0105245_10704468 | 3300009098 | Bacteria | 1043 |
| 154 | Ga0105245_10997034 | 3300009098 | Bacteria | 882 |
| 155 | Ga0105245_11633508 | 3300009098 | Bacteria | 696 |
| 156 | Ga0114129_10008762 | 3300009147 | Bacteria | 14428 |
| 157 | Ga0114129_10024008 | 3300009147 | Bacteria | 8642 |
| 158 | Ga0114129_10048939 | 3300009147 | Bacteria | 5941 |
| 159 | Ga0114129_10333117 | 3300009147 | Bacteria | 2015 |
| 160 | Ga0114129_12550797 | 3300009147 | Bacteria | 610 |
| 161 | Ga0105243_10245858 | 3300009148 | Bacteria | 1594 |
| 162 | Ga0105241_11363986 | 3300009174 | Bacteria | 677 |
| 163 | Ga0105242_10892857 | 3300009176 | Bacteria | 888 |
| 164 | Ga0105248_10670783 | 3300009177 | Bacteria | 1170 |
| 165 | Ga0105237_10159322 | 3300009545 | Bacteria | 2255 |
| 166 | Ga0105238_10107956 | 3300009551 | Bacteria | 2764 |
| 167 | Ga0105238_10656712 | 3300009551 | Bacteria | 1059 |
| 168 | Ga0105238_12868467 | 3300009551 | Bacteria | 518 |
| 169 | Ga0105249_10132980 | 3300009553 | Bacteria | 2377 |
| 170 | Ga0105249_11118061 | 3300009553 | Bacteria | 858 |
| 171 | Ga0099796_10028410 | 3300010159 | Bacteria | 1795 |
| 172 | Ga0105239_10316372 | 3300010375 | Bacteria | 1760 |
| 173 | Ga0105239_10342206 | 3300010375 | Bacteria | 1688 |
| 174 | Ga0105239_10403971 | 3300010375 | Bacteria | 1546 |
| 175 | Ga0105246_10137085 | 3300011119 | Bacteria | 1836 |
| 176 | Ga0157373_10705961 | 3300013100 | Bacteria | 739 |
| 177 | Ga0157370_10123002 | 3300013104 | Bacteria | 2423 |
| 178 | Ga0157369_10159646 | 3300013105 | Bacteria | 2380 |
| 179 | Ga0157369_10173836 | 3300013105 | Bacteria | 2268 |
| 180 | Ga0157369_11054083 | 3300013105 | Bacteria | 832 |
| 181 | Ga0157369_11432325 | 3300013105 | Bacteria | 703 |
| 182 | Ga0157378_10847571 | 3300013297 | Bacteria | 942 |
| 183 | Ga0163162_10749041 | 3300013306 | Bacteria | 1096 |
| 184 | Ga0157372_10112402 | 3300013307 | Bacteria | 3121 |
| 185 | Ga0157372_10447402 | 3300013307 | Bacteria | 1506 |
| 186 | Ga0157372_10646185 | 3300013307 | Bacteria | 1232 |
| 187 | Ga0157372_10737959 | 3300013307 | Bacteria | 1145 |
| 188 | Ga0157372_11411198 | 3300013307 | Bacteria | 803 |
| 189 | Ga0163163_10011362 | 3300014325 | Bacteria | 8072 |
| 190 | Ga0163163_10043824 | 3300014325 | Bacteria | 4389 |
| 191 | Ga0163163_10307436 | 3300014325 | Bacteria | 1638 |
| 192 | Ga0157380_10547839 | 3300014326 | Bacteria | 1134 |
| 193 | Ga0157380_10801805 | 3300014326 | Bacteria | 959 |
| 194 | Ga0157377_10011787 | 3300014745 | Bacteria | 4373 |
| 195 | Ga0157379_10261039 | 3300014968 | Bacteria | 1574 |
| 196 | Ga0157376_10203025 | 3300014969 | Bacteria | 1825 |
| 197 | Ga0157376_10361318 | 3300014969 | Bacteria | 1393 |
| 198 | Ga0157376_11809047 | 3300014969 | Bacteria | 647 |
| 199 | Ga0197907_10814455 | 3300020069 | Bacteria | 1293 |
| 200 | Ga0206356_10971613 | 3300020070 | Bacteria | 1318 |
| 201 | Ga0206352_11296872 | 3300020078 | Bacteria | 585 |
| 202 | Ga0206353_10354313 | 3300020082 | Bacteria | 3539 |
| 203 | Ga0206353_11458692 | 3300020082 | Bacteria | 1091 |
| 204 | Ga0213876_10023093 | 3300021384 | Bacteria | 3287 |
| 205 | Ga0213876_10272987 | 3300021384 | Bacteria | 899 |
| 206 | Ga0213875_10002508 | 3300021388 | Bacteria | 10966 |
| 207 | Ga0224712_10009645 | 3300022467 | Bacteria | 2919 |
| 208 | Ga0207692_10090044 | 3300025898 | Bacteria | 1662 |
| 209 | Ga0207688_10047376 | 3300025901 | Bacteria | 2400 |
| 210 | Ga0207647_10104749 | 3300025904 | Bacteria | 1676 |
| 211 | Ga0207685_10031535 | 3300025905 | Bacteria | 1899 |
| 212 | Ga0207699_10002187 | 3300025906 | Bacteria | 9228 |
| 213 | Ga0207645_10228149 | 3300025907 | Bacteria | 1229 |
| 214 | Ga0207705_10548847 | 3300025909 | Bacteria | 898 |
| 215 | Ga0207705_11079394 | 3300025909 | Bacteria | 619 |
| 216 | Ga0207707_10065622 | 3300025912 | Bacteria | 3161 |
| 217 | Ga0207707_11245079 | 3300025912 | Bacteria | 600 |
| 218 | Ga0207693_10009125 | 3300025915 | Bacteria | 8096 |
| 219 | Ga0207663_10002997 | 3300025916 | Bacteria | 8177 |
| 220 | Ga0207660_10124375 | 3300025917 | Bacteria | 1957 |
| 221 | Ga0207657_10104817 | 3300025919 | Bacteria | 2342 |
| 222 | Ga0207657_10158369 | 3300025919 | Bacteria | 1840 |
| 223 | Ga0207649_10373821 | 3300025920 | Bacteria | 1061 |
| 224 | Ga0207652_10054890 | 3300025921 | Bacteria | 3426 |
| 225 | Ga0207646_10554252 | 3300025922 | Bacteria | 1033 |
| 226 | Ga0207681_10347083 | 3300025923 | Bacteria | 1187 |
| 227 | Ga0207694_10590379 | 3300025924 | Bacteria | 934 |
| 228 | Ga0207650_10060418 | 3300025925 | Bacteria | 2828 |
| 229 | Ga0207659_10005349 | 3300025926 | Bacteria | 7779 |
| 230 | Ga0207687_10256625 | 3300025927 | Bacteria | 1392 |
| 231 | Ga0207687_10315134 | 3300025927 | Bacteria | 1264 |
| 232 | Ga0207700_10048206 | 3300025928 | Bacteria | 3162 |
| 233 | Ga0207700_10064425 | 3300025928 | Bacteria | 2792 |
| 234 | Ga0207700_10638585 | 3300025928 | Bacteria | 949 |
| 235 | Ga0207664_10004489 | 3300025929 | Bacteria | 9456 |
| 236 | Ga0207706_10035253 | 3300025933 | Bacteria | 4449 |
| 237 | Ga0207706_10808091 | 3300025933 | Bacteria | 796 |
| 238 | Ga0207686_10492295 | 3300025934 | Bacteria | 950 |
| 239 | Ga0207709_10706310 | 3300025935 | Bacteria | 807 |
| 240 | Ga0207669_10461232 | 3300025937 | Bacteria | 1009 |
| 241 | Ga0207704_10028557 | 3300025938 | Bacteria | 3097 |
| 242 | Ga0207665_10005974 | 3300025939 | Bacteria | 8096 |
| 243 | Ga0207665_10232754 | 3300025939 | Bacteria | 1355 |
| 244 | Ga0207691_10236690 | 3300025940 | Bacteria | 1580 |
| 245 | Ga0207711_10000170 | 3300025941 | Bacteria | 70147 |
| 246 | Ga0207689_10010048 | 3300025942 | Bacteria | 8157 |
| 247 | Ga0207689_10283932 | 3300025942 | Bacteria | 1371 |
| 248 | Ga0207661_10210545 | 3300025944 | Bacteria | 1713 |
| 249 | Ga0207661_10258363 | 3300025944 | Bacteria | 1551 |
| 250 | Ga0207679_10084248 | 3300025945 | Bacteria | 2439 |
| 251 | Ga0207679_10478056 | 3300025945 | Bacteria | 1109 |
| 252 | Ga0207667_10797456 | 3300025949 | Bacteria | 941 |
| 253 | Ga0207651_10780771 | 3300025960 | Bacteria | 846 |
| 254 | Ga0207712_10006290 | 3300025961 | Bacteria | 7490 |
| 255 | Ga0207668_10993487 | 3300025972 | Bacteria | 750 |
| 256 | Ga0207640_10116679 | 3300025981 | Bacteria | 1904 |
| 257 | Ga0207640_11028784 | 3300025981 | Bacteria | 726 |
| 258 | Ga0207658_10935225 | 3300025986 | Unclassified | 790 |
| 259 | Ga0207677_10159836 | 3300026023 | Bacteria | 1749 |
| 260 | Ga0207677_10591689 | 3300026023 | Bacteria | 972 |
| 261 | Ga0207703_10199294 | 3300026035 | Bacteria | 1778 |
| 262 | Ga0207678_10131084 | 3300026067 | Bacteria | 2138 |
| 263 | Ga0207678_10155235 | 3300026067 | Bacteria | 1954 |
| 264 | Ga0207678_10173854 | 3300026067 | Bacteria | 1839 |
| 265 | Ga0207678_10448833 | 3300026067 | Bacteria | 1121 |
| 266 | Ga0207678_10556493 | 3300026067 | Bacteria | 1003 |
| 267 | Ga0207708_10063026 | 3300026075 | Bacteria | 2832 |
| 268 | Ga0207702_10064029 | 3300026078 | Bacteria | 3146 |
| 269 | Ga0207702_10444488 | 3300026078 | Bacteria | 1257 |
| 270 | Ga0207641_10001578 | 3300026088 | Bacteria | 22254 |
| 271 | Ga0207641_10016985 | 3300026088 | Bacteria | 5958 |
| 272 | Ga0207676_10131885 | 3300026095 | Bacteria | 2126 |
| 273 | Ga0207676_10341517 | 3300026095 | Bacteria | 1382 |
| 274 | Ga0207676_10836588 | 3300026095 | Bacteria | 900 |
| 275 | Ga0207674_10089136 | 3300026116 | Bacteria | 3077 |
| 276 | Ga0207674_10173753 | 3300026116 | Bacteria | 2107 |
| 277 | Ga0207674_10242446 | 3300026116 | Bacteria | 1750 |
| 278 | Ga0207674_11321972 | 3300026116 | Bacteria | 690 |
| 279 | Ga0207675_100131943 | 3300026118 | Bacteria | 2369 |
| 280 | Ga0207675_101467661 | 3300026118 | Bacteria | 703 |
| 281 | Ga0207683_10092634 | 3300026121 | Bacteria | 2693 |
| 282 | Ga0207683_10099151 | 3300026121 | Bacteria | 2600 |
| 283 | Ga0207683_10226622 | 3300026121 | Bacteria | 1704 |
| 284 | Ga0207683_10390927 | 3300026121 | Bacteria | 1279 |
| 285 | Ga0207683_10472344 | 3300026121 | Bacteria | 1157 |
| 286 | Ga0207698_10233284 | 3300026142 | Bacteria | 1672 |
| 287 | Ga0207698_10563792 | 3300026142 | Bacteria | 1118 |
| 288 | Ga0207698_10882730 | 3300026142 | Bacteria | 901 |
| 289 | Ga0207428_10118715 | 3300027907 | Bacteria | 2030 |
| 290 | Ga0207428_10131813 | 3300027907 | Bacteria | 1912 |
| 291 | Ga0207428_10506760 | 3300027907 | Bacteria | 876 |
| 292 | Ga0268266_10090969 | 3300028379 | Bacteria | 2675 |
| 293 | Ga0268266_10263142 | 3300028379 | Bacteria | 1599 |
| 294 | Ga0268266_10274499 | 3300028379 | Bacteria | 1566 |
| 295 | Ga0268266_10493173 | 3300028379 | Bacteria | 1169 |
| 296 | Ga0268265_10000034 | 3300028380 | Bacteria | 218695 |
| 297 | Ga0268265_10038881 | 3300028380 | Bacteria | 3503 |
| 298 | Ga0268265_10423605 | 3300028380 | Bacteria | 1236 |
| 299 | Ga0307513_10116141 | 3300031456 | Bacteria | 2656 |
| 300 | Ga0307513_11045858 | 3300031456 | Bacteria | 527 |
| 301 | Ga0307408_100074075 | 3300031548 | Bacteria | 2525 |
| 302 | Ga0307408_100264442 | 3300031548 | Bacteria | 1425 |
| 303 | Ga0307516_10749502 | 3300031730 | Bacteria | 636 |
| 304 | Ga0307405_10741689 | 3300031731 | Bacteria | 817 |
| 305 | Ga0307405_10775215 | 3300031731 | Bacteria | 801 |
| 306 | Ga0307413_10268733 | 3300031824 | Bacteria | 1275 |
| 307 | Ga0307413_10290028 | 3300031824 | Bacteria | 1235 |
| 308 | Ga0307413_10749334 | 3300031824 | Bacteria | 816 |
| 309 | Ga0307410_10105286 | 3300031852 | Bacteria | 2030 |
| 310 | Ga0307410_10263800 | 3300031852 | Bacteria | 1344 |
| 311 | Ga0326468_10000155 | 3300031889 | Bacteria | 6672 |
| 312 | Ga0307406_10052243 | 3300031901 | Bacteria | 2599 |
| 313 | Ga0307406_10089698 | 3300031901 | Bacteria | 2066 |
| 314 | Ga0307406_10226821 | 3300031901 | Bacteria | 1392 |
| 315 | Ga0307406_10498826 | 3300031901 | Unclassified | 986 |
| 316 | Ga0307406_10724836 | 3300031901 | Bacteria | 832 |
| 317 | Ga0307407_10010161 | 3300031903 | Bacteria | 4425 |
| 318 | Ga0307407_10167335 | 3300031903 | Bacteria | 1444 |
| 319 | Ga0307407_10276743 | 3300031903 | Bacteria | 1161 |
| 320 | Ga0307412_11117768 | 3300031911 | Bacteria | 702 |
| 321 | Ga0307409_100008660 | 3300031995 | Bacteria | 6190 |
| 322 | Ga0307409_100015439 | 3300031995 | Bacteria | 5014 |
| 323 | Ga0307409_100071358 | 3300031995 | Bacteria | 2761 |
| 324 | Ga0307409_100313190 | 3300031995 | Bacteria | 1465 |
| 325 | Ga0307409_100330896 | 3300031995 | Bacteria | 1429 |
| 326 | Ga0307409_100955324 | 3300031995 | Bacteria | 873 |
| 327 | Ga0307409_101320740 | 3300031995 | Bacteria | 747 |
| 328 | Ga0307409_102891038 | 3300031995 | Bacteria | 507 |
| 329 | Ga0307416_100012136 | 3300032002 | Bacteria | 5787 |
| 330 | Ga0307416_100029413 | 3300032002 | Bacteria | 4104 |
| 331 | Ga0307416_100037324 | 3300032002 | Bacteria | 3737 |
| 332 | Ga0307416_100161594 | 3300032002 | Bacteria | 2071 |
| 333 | Ga0307416_100194728 | 3300032002 | Bacteria | 1916 |
| 334 | Ga0307416_100748197 | 3300032002 | Bacteria | 1070 |
| 335 | Ga0307416_100899555 | 3300032002 | Bacteria | 985 |
| 336 | Ga0307416_101027727 | 3300032002 | Bacteria | 928 |
| 337 | Ga0307416_102652806 | 3300032002 | Bacteria | 598 |
| 338 | Ga0307414_10186301 | 3300032004 | Bacteria | 1675 |
| 339 | Ga0307414_10422814 | 3300032004 | Bacteria | 1162 |
| 340 | Ga0307411_10261907 | 3300032005 | Bacteria | 1366 |
| 341 | Ga0307411_10272240 | 3300032005 | Bacteria | 1343 |
| 342 | Ga0307411_10399168 | 3300032005 | Bacteria | 1136 |
| 343 | Ga0307411_10823758 | 3300032005 | Bacteria | 819 |
| 344 | Ga0307415_100009799 | 3300032126 | Bacteria | 5393 |
| 345 | Ga0307415_100025362 | 3300032126 | Bacteria | 3718 |
| 346 | Ga0307415_100056096 | 3300032126 | Bacteria | 2699 |
| 347 | Ga0307415_100062817 | 3300032126 | Bacteria | 2578 |
| 348 | Ga0307415_100143005 | 3300032126 | Bacteria | 1830 |
| 349 | Ga0307415_100444423 | 3300032126 | Bacteria | 1119 |
| 350 | Ga0307415_100529325 | 3300032126 | Bacteria | 1036 |
| 351 | Ga0307415_100583751 | 3300032126 | Bacteria | 992 |
| 352 | Ga0307415_100875336 | 3300032126 | Bacteria | 826 |
| 353 | Ga0307415_100985309 | 3300032126 | Bacteria | 782 |
| 354 | Ga0307415_102170123 | 3300032126 | Bacteria | 543 |
| 355 | Ga0307507_10107166 | 3300033179 | Bacteria | 2304 |
| 356 | Ga0373930_0015702 | 3300034816 | Bacteria | 1424 |
| 357 | Ga0373959_0001679 | 3300034820 | Bacteria | 3523 |
| 358 | Ga0373938_0006150 | 3300034957 | Bacteria | 2065 |
| 359 | Ga0373926_0051033 | 3300035083 | Bacteria | 1491 |
| 360 | Ga0373928_0004837 | 3300035084 | Bacteria | 2568 |
| 361 | Ga0373929_0005019 | 3300035085 | Bacteria | 2376 |
| 362 | Ga0373934_0002980 | 3300035086 | Bacteria | 6190 |
| 363 | Ga0373934_0019986 | 3300035086 | Bacteria | 2574 |
| 364 | Ga0373934_0355768 | 3300035086 | Bacteria | 610 |
| 365 | Ga0373940_0001674 | 3300035088 | Bacteria | 4092 |
| 366 | Ga0373949_0004023 | 3300035090 | Bacteria | 3409 |
| 367 | Ga0373951_0000057 | 3300035091 | Bacteria | 45426 |
| 368 | Ga0373951_0078888 | 3300035091 | Bacteria | 849 |
| 369 | Ga0373923_0129605 | 3300035111 | Bacteria | 1132 |
| 370 | Ga0373923_0315700 | 3300035111 | Bacteria | 741 |
| 371 | Ga0373939_0156835 | 3300035114 | Bacteria | 833 |
| 372 | Ga0373941_0277264 | 3300035115 | Bacteria | 662 |
| 373 | Ga0373945_0059236 | 3300035116 | Bacteria | 1425 |
| 374 | Ga0373945_0389381 | 3300035116 | Bacteria | 609 |
| 375 | Ga0373953_0000287 | 3300035117 | Bacteria | 13874 |
| 376 | Ga0373953_0034130 | 3300035117 | Bacteria | 1993 |
| 377 | Ga0373954_0008734 | 3300035118 | Bacteria | 4455 |
| 378 | Ga0373954_0008943 | 3300035118 | Bacteria | 4408 |
| 379 | Ga0373956_0000749 | 3300035119 | Bacteria | 13412 |
| 380 | Ga0373956_0064883 | 3300035119 | Bacteria | 1658 |
| 381 | Ga0373957_0000202 | 3300035120 | Bacteria | 15269 |
| 382 | Ga0373957_0008081 | 3300035120 | Bacteria | 3395 |
| 383 | Ga0373957_0119867 | 3300035120 | Bacteria | 1064 |
| 384 | Ga0373960_0012087 | 3300035121 | Bacteria | 2139 |
| 385 | Ga0373943_0074087 | 3300035170 | Bacteria | 1730 |
| 386 | Ga0373943_0084358 | 3300035170 | Bacteria | 1634 |
| 387 | Ga0373946_0190168 | 3300035171 | Bacteria | 978 |
| 388 | Ga0373946_0681692 | 3300035171 | Bacteria | 536 |
| 389 | Ga0373955_0000190 | 3300035172 | Bacteria | 25350 |
| 390 | Ga0373955_0000949 | 3300035172 | Bacteria | 12376 |
| 391 | Ga0373942_0025100 | 3300035207 | Bacteria | 1533 |
| 392 | Ga0373962_0014259 | 3300035242 | Bacteria | 2024 |
| 393 | Ga0373924_0000299 | 3300035410 | Bacteria | 15229 |
| 394 | Ga0373924_0144848 | 3300035410 | Bacteria | 1037 |
| 395 | Ga0373924_0177314 | 3300035410 | Bacteria | 937 |
| 396 | Ga0373935_0207136 | 3300035692 | Bacteria | 1357 |
| 397 | Ga0373935_0344441 | 3300035692 | Bacteria | 1061 |
| 398 | Ga0373927_0064774 | 3300035695 | Bacteria | 2364 |
| 399 | Ga0373927_0157548 | 3300035695 | Bacteria | 1487 |
| 400 | Ga0373933_0000002 | 3300035724 | Bacteria | 151785 |
| 401 | Ga0373933_0020754 | 3300035724 | Bacteria | 3724 |
| 402 | Ga0373933_0030456 | 3300035724 | Bacteria | 3124 |
| 403 | Ga0373947_0129876 | 3300035725 | Bacteria | 1607 |
| 404 | Ga0373947_0274126 | 3300035725 | Bacteria | 1120 |
| 405 | Ga0373937_0000014 | 3300036401 | Bacteria | 151785 |
| 406 | Ga0373937_0010614 | 3300036401 | Bacteria | 8048 |
| 407 | Ga0373937_0047451 | 3300036401 | Bacteria | 3929 |
| 408 | Ga0373925_0007581 | 3300037068 | Bacteria | 7904 |
| 409 | Ga0373925_0229642 | 3300037068 | Bacteria | 1483 |
| 410 | Ga0373925_0755201 | 3300037068 | Bacteria | 802 |
| 411 | Ga0373925_1076711 | 3300037068 | Bacteria | 661 |
| 412 | Ga0395899_0008140 | 3300037312 | Bacteria | 8077 |
| 413 | Ga0395900_0029876 | 3300037418 | Bacteria | 5593 |
| 414 | Ga0395898_0003035 | 3300037466 | Bacteria | 19037 |
| 415 | Ga0395898_0053104 | 3300037466 | Bacteria | 3958 |
| 416 | Ga0395898_0417280 | 3300037466 | Bacteria | 1279 |
| 417 | Ga0395898_0432312 | 3300037466 | Bacteria | 1254 |
| 418 | Ga0395898_1190348 | 3300037466 | Bacteria | 693 |
| 419 | Ga0395905_0003137 | 3300037471 | Bacteria | 17809 |
| 420 | Ga0395905_0066430 | 3300037471 | Bacteria | 3378 |
| 421 | Ga0395905_1099843 | 3300037471 | Bacteria | 698 |
| 422 | Ga0436364_0847286 | 3300037853 | Bacteria | 1034 |
| 423 | Ga0436364_0923522 | 3300037853 | Bacteria | 137390 |
| 424 | Ga0436364_1394990 | 3300037853 | Bacteria | 3996 |
| 425 | Ga0395901_0013845 | 3300038443 | Bacteria | 8205 |
| 426 | Ga0395901_0023594 | 3300038443 | Bacteria | 6307 |
| 427 | Ga0242420_035936 | 3300038996 | Bacteria | 934 |
| 428 | Ga0436365_1135090 | 3300039437 | Bacteria | 5167 |
| 429 | Ga0436365_1929710 | 3300039437 | Unclassified | 2678 |
| 430 | Ga0439461_0001522 | 3300041410 | Bacteria | 3591 |
| 431 | Ga0439466_0004315 | 3300041411 | Bacteria | 5488 |
| 432 | Ga0439466_0004664 | 3300041411 | Bacteria | 5265 |
| 433 | Ga0439465_0000501 | 3300041413 | Bacteria | 11678 |
| 434 | Ga0439465_0003422 | 3300041413 | Bacteria | 5175 |
| 435 | Ga0451789_0318381 | 3300041443 | Bacteria | 2934 |
| 436 | Ga0451797_1028095 | 3300041453 | Bacteria | 2826 |
| 437 | Ga0451795_0617988 | 3300041456 | Bacteria | 2422 |
| 438 | Ga0451800_0925617 | 3300041459 | Bacteria | 2819 |
| 439 | Ga0451807_0590601 | 3300041486 | Bacteria | 1625 |
| 440 | Ga0451837_0856061 | 3300041494 | Bacteria | 900 |
| 441 | Ga0451839_1323259 | 3300041496 | Bacteria | 1779 |
| 442 | Ga0451849_0436125 | 3300041505 | Bacteria | 694 |
| 443 | Ga0451853_1902101 | 3300041512 | Bacteria | 1566 |
| 444 | Ga0451853_3855507 | 3300041512 | Bacteria | 548 |
| 445 | Ga0439442_016837 | 3300042002 | Bacteria | 1508 |
| 446 | Ga0439445_0008773 | 3300042004 | Bacteria | 2372 |
| 447 | Ga0450900_034202 | 3300042136 | Bacteria | 746 |
| 448 | Ga0450905_035629 | 3300042142 | Bacteria | 779 |
| 449 | Ga0439434_0024650 | 3300042435 | Bacteria | 1815 |
| 450 | Ga0439460_0096003 | 3300042461 | Bacteria | 947 |
| 451 | Ga0466972_0016477 | 3300044658 | Bacteria | 3697 |
| 452 | Ga0466960_0104052 | 3300044901 | Bacteria | 1466 |
| 453 | Ga0466960_0383520 | 3300044901 | Bacteria | 807 |
| 454 | Ga0466960_1025719 | 3300044901 | Bacteria | 508 |
| 455 | Ga0466967_0135769 | 3300045976 | Bacteria | 2287 |
| 456 | Ga0466967_0138658 | 3300045976 | Bacteria | 2264 |
| 457 | Ga0466967_0197043 | 3300045976 | Bacteria | 1906 |
| 458 | Ga0495592_0000133 | 3300046454 | Bacteria | 66075 |
| 459 | Ga0495592_0053180 | 3300046454 | Bacteria | 3004 |
| 460 | Ga0495603_0097511 | 3300046455 | Bacteria | 1717 |
| 461 | Ga0495629_0033812 | 3300046459 | Bacteria | 3615 |
| 462 | Ga0495629_0162594 | 3300046459 | Bacteria | 1550 |
| 463 | Ga0495629_0566635 | 3300046459 | Bacteria | 761 |
| 464 | Ga0495651_0000019 | 3300046462 | Bacteria | 120970 |
| 465 | Ga0495651_0121564 | 3300046462 | Bacteria | 1917 |
| 466 | Ga0495651_0245518 | 3300046462 | Bacteria | 1225 |
| 467 | Ga0495651_0832100 | 3300046462 | Bacteria | 568 |
| 468 | Ga0495653_0000763 | 3300046463 | Bacteria | 24698 |
| 469 | Ga0495653_0075842 | 3300046463 | Bacteria | 2501 |
| 470 | Ga0495653_0141416 | 3300046463 | Bacteria | 1692 |
| 471 | Ga0495653_0652885 | 3300046463 | Bacteria | 642 |
| 472 | Ga0495580_0085117 | 3300046472 | Bacteria | 2202 |
| 473 | Ga0495582_0045125 | 3300046473 | Bacteria | 2427 |
| 474 | Ga0495582_0166673 | 3300046473 | Bacteria | 1254 |
| 475 | Ga0495639_0083470 | 3300046475 | Bacteria | 1490 |
| 476 | Ga0495639_0153548 | 3300046475 | Bacteria | 1111 |
| 477 | Ga0495639_0249224 | 3300046475 | Bacteria | 878 |
| 478 | Ga0495639_0606976 | 3300046475 | Bacteria | 563 |
| 479 | Ga0495662_0026275 | 3300046476 | Bacteria | 2812 |
| 480 | Ga0495662_0302037 | 3300046476 | Bacteria | 787 |
| 481 | Ga0495664_0004853 | 3300046477 | Bacteria | 7353 |
| 482 | Ga0495664_0222941 | 3300046477 | Bacteria | 1141 |
| 483 | Ga0495594_0152100 | 3300046499 | Bacteria | 1314 |
| 484 | Ga0495594_0220935 | 3300046499 | Bacteria | 1080 |
| 485 | Ga0495606_0000540 | 3300046507 | Bacteria | 60764 |
| 486 | Ga0495608_0000028 | 3300046511 | Bacteria | 151829 |
| 487 | Ga0495608_0012844 | 3300046511 | Bacteria | 5810 |
| 488 | Ga0495608_0350330 | 3300046511 | Bacteria | 909 |
| 489 | Ga0495618_0046453 | 3300046514 | Bacteria | 2740 |
| 490 | Ga0495618_0211842 | 3300046514 | Bacteria | 1224 |
| 491 | Ga0495628_0000371 | 3300046516 | Bacteria | 41228 |
| 492 | Ga0495630_0476805 | 3300046517 | Bacteria | 956 |
| 493 | Ga0495630_0933343 | 3300046517 | Bacteria | 660 |
| 494 | Ga0495666_0040822 | 3300046526 | Bacteria | 2249 |
| 495 | Ga0495652_0000031 | 3300046529 | Bacteria | 151765 |
| 496 | Ga0495652_0019012 | 3300046529 | Bacteria | 6121 |
| 497 | Ga0495665_0114177 | 3300046531 | Bacteria | 1415 |
| 498 | Ga0495665_0310803 | 3300046531 | Bacteria | 806 |
| 499 | Ga0495665_0333538 | 3300046531 | Bacteria | 774 |
| 500 | Ga0495640_0044467 | 3300046533 | Bacteria | 3087 |
| 501 | Ga0495640_0097108 | 3300046533 | Bacteria | 1938 |
| 502 | Ga0495586_0138003 | 3300046535 | Bacteria | 1367 |
| 503 | Ga0495587_0000023 | 3300046536 | Bacteria | 151763 |
| 504 | Ga0495587_0033842 | 3300046536 | Bacteria | 3083 |
| 505 | Ga0495645_0039761 | 3300046543 | Bacteria | 3429 |
| 506 | Ga0495645_0076335 | 3300046543 | Bacteria | 2411 |
| 507 | Ga0495645_0361009 | 3300046543 | Bacteria | 934 |
| 508 | Ga0495645_0383687 | 3300046543 | Bacteria | 898 |
| 509 | Ga0495667_0000054 | 3300046559 | Bacteria | 105009 |
| 510 | Ga0495667_0013775 | 3300046559 | Bacteria | 5461 |
| 511 | Ga0495668_0000362 | 3300046616 | Bacteria | 60088 |
| 512 | Ga0495634_0017630 | 3300046642 | Bacteria | 5093 |
| 513 | Ga0495634_0021812 | 3300046642 | Bacteria | 4520 |
| 514 | Ga0495625_0001125 | 3300046660 | Bacteria | 34598 |
| 515 | Ga0495635_0150846 | 3300046663 | Bacteria | 1582 |
| 516 | Ga0495588_0134247 | 3300046674 | Bacteria | 1306 |
| 517 | Ga0495657_0000022 | 3300046675 | Bacteria | 151837 |
| 518 | Ga0495657_0026800 | 3300046675 | Bacteria | 4077 |
| 519 | Ga0495599_0000700 | 3300046678 | Bacteria | 18940 |
| 520 | Ga0495599_0039315 | 3300046678 | Bacteria | 2972 |
| 521 | Ga0495599_0244098 | 3300046678 | Bacteria | 1094 |
| 522 | Ga0495623_0000416 | 3300046679 | Bacteria | 28025 |
| 523 | Ga0495623_0014675 | 3300046679 | Bacteria | 5067 |
| 524 | Ga0495623_0039229 | 3300046679 | Bacteria | 3027 |
| 525 | Ga0495646_0082566 | 3300046680 | Bacteria | 1869 |
| 526 | Ga0495647_0031756 | 3300046681 | Bacteria | 1965 |
| 527 | Ga0495647_0406933 | 3300046681 | Bacteria | 625 |
| 528 | Ga0495658_0059288 | 3300046683 | Bacteria | 2191 |
| 529 | Ga0495624_0115440 | 3300046690 | Bacteria | 1650 |
| 530 | Ga0495624_0137278 | 3300046690 | Bacteria | 1498 |
| 531 | Ga0495649_0256636 | 3300046694 | Bacteria | 897 |
| 532 | Ga0495600_0006882 | 3300046809 | Bacteria | 6935 |
| 533 | Ga0495600_0033354 | 3300046809 | Bacteria | 3342 |
| 534 | Ga0495600_0531159 | 3300046809 | Bacteria | 720 |
| 535 | Ga0495581_0020178 | 3300047315 | Bacteria | 3869 |
| 536 | Ga0495581_0179609 | 3300047315 | Bacteria | 1237 |
| 537 | Ga0495604_0000022 | 3300047317 | Bacteria | 151744 |
| 538 | Ga0495604_0019904 | 3300047317 | Bacteria | 5367 |
| 539 | Ga0495604_0126603 | 3300047317 | Bacteria | 1841 |
| 540 | Ga0495674_0534500 | 3300047319 | Bacteria | 935 |
| 541 | Ga0495674_0736390 | 3300047319 | Bacteria | 771 |
| 542 | Ga0495676_0179158 | 3300047321 | Bacteria | 1486 |
| 543 | Ga0495680_0000271 | 3300047322 | Bacteria | 57595 |
| 544 | Ga0495680_0048669 | 3300047322 | Bacteria | 3327 |
| 545 | Ga0495675_0025084 | 3300047444 | Bacteria | 3802 |
| 546 | Ga0495675_0039659 | 3300047444 | Bacteria | 2999 |
| 547 | Ga0495675_0177759 | 3300047444 | Bacteria | 1304 |
| 548 | Ga0495684_0121849 | 3300047471 | Bacteria | 1963 |
| 549 | Ga0495684_0168631 | 3300047471 | Bacteria | 1629 |
| 550 | Ga0495593_0013816 | 3300047673 | Bacteria | 4599 |
| 551 | Ga0495602_0000390 | 3300048088 | Bacteria | 41015 |
| 552 | Ga0495602_0114839 | 3300048088 | Bacteria | 2179 |
| 553 | Ga0495602_0272128 | 3300048088 | Bacteria | 1251 |
| 554 | Ga0495614_0008545 | 3300048089 | Bacteria | 4551 |
| 555 | Ga0495614_0230228 | 3300048089 | Bacteria | 844 |
| 556 | Ga0495626_0000118 | 3300048091 | Bacteria | 103373 |
| 557 | Ga0496100_0239311 | 3300048903 | Bacteria | 1338 |
| 558 | Ga0496100_1343890 | 3300048903 | Bacteria | 564 |
| 559 | Ga0496101_0369046 | 3300048904 | Bacteria | 1129 |
| 560 | Ga0496101_0527182 | 3300048904 | Bacteria | 934 |
| 561 | Ga0496101_0762737 | 3300048904 | Bacteria | 763 |
| 562 | Ga0496102_0005945 | 3300048905 | Bacteria | 10390 |
| 563 | Ga0496102_0019672 | 3300048905 | Bacteria | 5949 |
| 564 | Ga0496102_0217541 | 3300048905 | Bacteria | 1801 |
| 565 | Ga0496102_0548385 | 3300048905 | Bacteria | 1079 |
| 566 | Ga0496102_0879014 | 3300048905 | Bacteria | 818 |
| 567 | Ga0496102_1377964 | 3300048905 | Bacteria | 624 |
| 568 | Ga0496104_0105151 | 3300048907 | Bacteria | 2705 |
| 569 | Ga0496104_0638732 | 3300048907 | Bacteria | 973 |
| 570 | Ga0496104_1485425 | 3300048907 | Bacteria | 581 |
| 571 | Ga0496105_0004687 | 3300048908 | Bacteria | 10307 |
| 572 | Ga0496105_0432779 | 3300048908 | Bacteria | 1040 |
| 573 | Ga0496106_0308531 | 3300048909 | Bacteria | 1269 |
| 574 | Ga0496107_0074401 | 3300048910 | Bacteria | 2471 |
| 575 | Ga0496108_0028194 | 3300048911 | Bacteria | 4645 |
| 576 | Ga0496108_0030255 | 3300048911 | Bacteria | 4487 |
| 577 | Ga0496108_0239073 | 3300048911 | Bacteria | 1580 |
| 578 | Ga0496109_0011048 | 3300048912 | Bacteria | 7741 |
| 579 | Ga0496109_0088322 | 3300048912 | Bacteria | 2865 |
| 580 | Ga0496110_0001522 | 3300048913 | Bacteria | 16827 |
| 581 | Ga0496110_0933515 | 3300048913 | Bacteria | 774 |
| 582 | Ga0496111_0001467 | 3300048914 | Bacteria | 13490 |
| 583 | Ga0496111_0230491 | 3300048914 | Bacteria | 1376 |
| 584 | Ga0496112_0141119 | 3300048915 | Bacteria | 2378 |
| 585 | Ga0496112_0200742 | 3300048915 | Bacteria | 1953 |
| 586 | Ga0496112_0562749 | 3300048915 | Bacteria | 1073 |
| 587 | Ga0496113_0043573 | 3300048916 | Bacteria | 3321 |
| 588 | Ga0496113_0509711 | 3300048916 | Bacteria | 966 |
| 589 | Ga0496114_0061747 | 3300048917 | Bacteria | 3135 |
| 590 | Ga0496114_0074029 | 3300048917 | Bacteria | 2867 |
| 591 | Ga0496114_0115938 | 3300048917 | Bacteria | 2299 |
| 592 | Ga0496114_0133740 | 3300048917 | Bacteria | 2143 |
| 593 | Ga0496114_0756230 | 3300048917 | Bacteria | 849 |
| 594 | Ga0496115_0123719 | 3300048918 | Bacteria | 2129 |
| 595 | Ga0496115_0529364 | 3300048918 | Bacteria | 944 |
| 596 | Ga0496116_0000165 | 3300048919 | Bacteria | 133688 |
| 597 | Ga0496117_0004187 | 3300048920 | Bacteria | 16111 |
| 598 | Ga0496117_0020011 | 3300048920 | Bacteria | 5474 |
| 599 | Ga0496118_0008074 | 3300048921 | Bacteria | 10977 |
| 600 | Ga0496118_0018480 | 3300048921 | Bacteria | 6288 |
| 601 | Ga0496119_0003213 | 3300048922 | Bacteria | 17095 |
| 602 | Ga0496120_0057441 | 3300048923 | Bacteria | 2190 |
| 603 | Ga0496121_0068252 | 3300048924 | Bacteria | 2877 |
| 604 | Ga0496126_0073734 | 3300048929 | Bacteria | 3033 |
| 605 | Ga0501317_081527 | 3300049533 | Bacteria | 560 |
| 606 | Ga0501034_1114876 | 3300049571 | Bacteria | 670 |
| 607 | Ga0501044_0327691 | 3300049823 | Bacteria | 1455 |
| 608 | nmdc:mga03n38_80747_c1 | 3300050490 | Bacteria | 1528 |
| 609 | nmdc:mga00v17_166583_c1 | 3300050491 | Bacteria | 1420 |
| 610 | nmdc:mga0yw44_87683_c1 | 3300050492 | Bacteria | 1962 |
| 611 | nmdc:mga06z11_28004_c1 | 3300050494 | Bacteria | 2699 |
| 612 | nmdc:mga05p37_1840993_c1 | 3300050507 | Bacteria | 582 |
| 613 | nmdc:mga05p37_192167_c1 | 3300050507 | Bacteria | 2477 |
| 614 | nmdc:mga05p37_33850_c1 | 3300050507 | Bacteria | 6259 |
| 615 | nmdc:mga05p37_396093_c1 | 3300050507 | Bacteria | 1613 |
| 616 | nmdc:mga05p37_7263_c1 | 3300050507 | Bacteria | 13071 |
| 617 | nmdc:mga09592_111_c1 | 3300050508 | Bacteria | 51033 |
| 618 | nmdc:mga09592_399956_c1 | 3300050508 | Bacteria | 1187 |
| 619 | nmdc:mga09592_56070_c1 | 3300050508 | Bacteria | 3330 |
| 620 | nmdc:mga0qj67_1531853_c1 | 3300050509 | Bacteria | 512 |
| 621 | nmdc:mga0qj67_2591_c1 | 3300050509 | Bacteria | 12943 |
| 622 | nmdc:mga0qj67_925_c1 | 3300050509 | Bacteria | 20198 |
| 623 | nmdc:mga0qj67_95500_c1 | 3300050509 | Bacteria | 2393 |
| 624 | nmdc:mga06r32_3493_c1 | 3300050510 | Bacteria | 14021 |
| 625 | nmdc:mga06r32_373743_c1 | 3300050510 | Bacteria | 1408 |
| 626 | nmdc:mga06r32_426287_c1 | 3300050510 | Bacteria | 1308 |
| 627 | nmdc:mga06r32_5589_c1 | 3300050510 | Bacteria | 11312 |
| 628 | nmdc:mga08y16_260342_c1 | 3300050511 | Bacteria | 1791 |
| 629 | nmdc:mga08y16_3789_c1 | 3300050511 | Bacteria | 15747 |
| 630 | nmdc:mga0n895_165005_c1 | 3300050512 | Bacteria | 2247 |
| 631 | nmdc:mga0n895_21202_c1 | 3300050512 | Bacteria | 6071 |
| 632 | nmdc:mga0rr50_132590_c1 | 3300050513 | Bacteria | 1997 |
| 633 | nmdc:mga0rr50_552618_c1 | 3300050513 | Bacteria | 980 |
| 634 | nmdc:mga0rr50_90223_c1 | 3300050513 | Bacteria | 2385 |
| 635 | nmdc:mga08x19_128113_c1 | 3300050514 | Bacteria | 1706 |
| 636 | nmdc:mga08x19_86485_c1 | 3300050514 | Bacteria | 2064 |
| 637 | nmdc:mga0a205_305755_c1 | 3300050515 | Bacteria | 1463 |
| 638 | nmdc:mga0a205_42248_c1 | 3300050515 | Bacteria | 4392 |
| 639 | nmdc:mga0sz30_6870_c1 | 3300050516 | Bacteria | 4249 |
| 640 | Ga0495601_0052770 | 3300053077 | Bacteria | 2568 |
| 641 | Ga0495612_0056392 | 3300053078 | Bacteria | 1621 |
| 642 | Ga0495595_0003523 | 3300053084 | Bacteria | 6212 |
| 643 | Ga0495595_0094614 | 3300053084 | Bacteria | 1436 |
| 644 | Ga0495619_0079069 | 3300053085 | Bacteria | 2211 |
| 645 | Ga0495619_0756072 | 3300053085 | Bacteria | 659 |
| 646 | Ga0500646_0065399 | 3300053090 | Bacteria | 1080 |
| 647 | Ga0500583_0134705 | 3300053092 | Bacteria | 1226 |
| 648 | Ga0500616_0076858 | 3300053153 | Bacteria | 1687 |
| 649 | Ga0587073_0022333 | 3300059492 | Bacteria | 1227 |
| 650 | Ga0587082_016845 | 3300059504 | Bacteria | 1145 |
| 651 | Ga0587085_020364 | 3300059506 | Bacteria | 1002 |
| 652 | Ga0587071_032102 | 3300060344 | Bacteria | 1016 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041512 | Ga0451853_3855507 | Ga0451853_3855507_14_421 | 134 |
| 2 | 3300013105 | Ga0157369_11054083 | Ga0157369_110540832 | 135 |
| 3 | 3300046499 | Ga0495594_0152100 | Ga0495594_0152100_289_699 | 135 |
| 4 | 3300005436 | Ga0070713_100830352 | Ga0070713_1008303522 | 136 |
| 5 | 3300005437 | Ga0070710_10486792 | Ga0070710_104867922 | 136 |
| 6 | 3300037418 | Ga0395900_0029876 | Ga0395900_0029876_3676_4086 | 136 |
| 7 | 3300037466 | Ga0395898_0003035 | Ga0395898_0003035_7969_8379 | 136 |
| 8 | 3300037471 | Ga0395905_0003137 | Ga0395905_0003137_12636_13046 | 136 |
| 9 | 3300046475 | Ga0495639_0606976 | Ga0495639_0606976_14_439 | 136 |
| 10 | 3300005347 | Ga0070668_100011862 | Ga0070668_1000118627 | 138 |
| 11 | 3300005617 | Ga0068859_101339204 | Ga0068859_1013392042 | 138 |
| 12 | 3300005719 | Ga0068861_100065031 | Ga0068861_1000650312 | 138 |
| 13 | 3300006931 | Ga0097620_101339171 | Ga0097620_1013391712 | 138 |
| 14 | 3300026118 | Ga0207675_100131943 | Ga0207675_1001319432 | 138 |
| 15 | 3300028380 | Ga0268265_10423605 | Ga0268265_104236051 | 138 |
| 16 | iso_pu_bacteria | 2508501039 | 2508678318 | 138 |
| 17 | iso_pu_bacteria | 2684623035 | 2686539172 | 138 |
| 18 | iso_pu_bacteria | 2887478801 | 2887481649 | 138 |
| 19 | iso_pu_bacteria | 2895880812 | 2895890839 | 138 |
| 20 | iso_pu_bacteria | 8001781756 | 8001789108 | 138 |
| 21 | iso_pu_bacteria | 8002775197 | 8002781693 | 138 |
| 22 | iso_pu_bacteria | 8002784119 | 8002788693 | 138 |
| 23 | iso_pu_bacteria | 8055172936 | 8055173895 | 138 |
| 24 | 3300032126 | Ga0307415_100875336 | Ga0307415_1008753362 | 139 |
| 25 | 3300042461 | Ga0439460_0096003 | Ga0439460_0096003_183_608 | 139 |
| 26 | 3300003203 | JGI25406J46586_10069493 | JGI25406J46586_100694932 | 140 |
| 27 | 3300005985 | Ga0081539_10005056 | Ga0081539_1000505618 | 140 |
| 28 | 3300003203 | JGI25406J46586_10047135 | JGI25406J46586_100471352 | 141 |
| 29 | 3300005564 | Ga0070664_100588136 | Ga0070664_1005881362 | 141 |
| 30 | 3300005983 | Ga0081540_1023100 | Ga0081540_10231006 | 141 |
| 31 | 3300005985 | Ga0081539_10001061 | Ga0081539_1000106137 | 141 |
| 32 | 3300005985 | Ga0081539_10032287 | Ga0081539_100322872 | 141 |
| 33 | 3300013105 | Ga0157369_11432325 | Ga0157369_114323251 | 141 |
| 34 | 3300025944 | Ga0207661_10258363 | Ga0207661_102583633 | 141 |
| 35 | 3300026067 | Ga0207678_10556493 | Ga0207678_105564931 | 141 |
| 36 | 3300028379 | Ga0268266_10493173 | Ga0268266_104931732 | 141 |
| 37 | 3300031730 | Ga0307516_10749502 | Ga0307516_107495022 | 141 |
| 38 | 3300031731 | Ga0307405_10741689 | Ga0307405_107416892 | 141 |
| 39 | 3300031824 | Ga0307413_10749334 | Ga0307413_107493341 | 141 |
| 40 | 3300031852 | Ga0307410_10263800 | Ga0307410_102638003 | 141 |
| 41 | 3300031889 | Ga0326468_10000155 | Ga0326468_1000015510 | 141 |
| 42 | 3300031901 | Ga0307406_10089698 | Ga0307406_100896983 | 141 |
| 43 | 3300031901 | Ga0307406_10226821 | Ga0307406_102268212 | 141 |
| 44 | 3300031901 | Ga0307406_10724836 | Ga0307406_107248361 | 141 |
| 45 | 3300031903 | Ga0307407_10010161 | Ga0307407_100101616 | 141 |
| 46 | 3300031911 | Ga0307412_11117768 | Ga0307412_111177681 | 141 |
| 47 | 3300031995 | Ga0307409_100015439 | Ga0307409_1000154396 | 141 |
| 48 | 3300031995 | Ga0307409_100330896 | Ga0307409_1003308962 | 141 |
| 49 | 3300032002 | Ga0307416_100029413 | Ga0307416_1000294135 | 141 |
| 50 | 3300032002 | Ga0307416_100194728 | Ga0307416_1001947283 | 141 |
| 51 | 3300032004 | Ga0307414_10186301 | Ga0307414_101863012 | 141 |
| 52 | 3300032005 | Ga0307411_10399168 | Ga0307411_103991683 | 141 |
| 53 | 3300032005 | Ga0307411_10823758 | Ga0307411_108237581 | 141 |
| 54 | 3300032126 | Ga0307415_100025362 | Ga0307415_1000253626 | 141 |
| 55 | 3300032126 | Ga0307415_100985309 | Ga0307415_1009853092 | 141 |
| 56 | 3300033179 | Ga0307507_10107166 | Ga0307507_101071663 | 141 |
| 57 | 3300037466 | Ga0395898_0053104 | Ga0395898_0053104_1324_1749 | 141 |
| 58 | 3300037471 | Ga0395905_0066430 | Ga0395905_0066430_2563_2988 | 141 |
| 59 | 3300037853 | Ga0436364_0847286 | Ga0436364_0847286_564_995 | 141 |
| 60 | 3300038443 | Ga0395901_0023594 | Ga0395901_0023594_4001_4426 | 141 |
| 61 | 3300042136 | Ga0450900_034202 | Ga0450900_034202_276_701 | 141 |
| 62 | 3300042142 | Ga0450905_035629 | Ga0450905_035629_53_478 | 141 |
| 63 | 3300045976 | Ga0466967_0197043 | Ga0466967_0197043_112_546 | 141 |
| 64 | 3300049533 | Ga0501317_081527 | Ga0501317_081527_80_505 | 141 |
| 65 | 3300053090 | Ga0500646_0065399 | Ga0500646_0065399_410_841 | 141 |
| 66 | 3300002077 | JGI24744J21845_10088469 | JGI24744J21845_100884691 | 142 |
| 67 | 3300003203 | JGI25406J46586_10114731 | JGI25406J46586_101147312 | 142 |
| 68 | 3300004800 | Ga0058861_12044538 | Ga0058861_120445382 | 142 |
| 69 | 3300005327 | Ga0070658_10445188 | Ga0070658_104451882 | 142 |
| 70 | 3300005328 | Ga0070676_10234244 | Ga0070676_102342442 | 142 |
| 71 | 3300005329 | Ga0070683_100004578 | Ga0070683_1000045784 | 142 |
| 72 | 3300005331 | Ga0070670_100540284 | Ga0070670_1005402841 | 142 |
| 73 | 3300005334 | Ga0068869_100008619 | Ga0068869_1000086191 | 142 |
| 74 | 3300005335 | Ga0070666_10859439 | Ga0070666_108594391 | 142 |
| 75 | 3300005336 | Ga0070680_100104608 | Ga0070680_1001046082 | 142 |
| 76 | 3300005337 | Ga0070682_100022080 | Ga0070682_1000220804 | 142 |
| 77 | 3300005337 | Ga0070682_100045776 | Ga0070682_1000457763 | 142 |
| 78 | 3300005337 | Ga0070682_100290382 | Ga0070682_1002903821 | 142 |
| 79 | 3300005338 | Ga0068868_100008936 | Ga0068868_1000089364 | 142 |
| 80 | 3300005339 | Ga0070660_100151329 | Ga0070660_1001513292 | 142 |
| 81 | 3300005339 | Ga0070660_101163086 | Ga0070660_1011630861 | 142 |
| 82 | 3300005341 | Ga0070691_10149956 | Ga0070691_101499561 | 142 |
| 83 | 3300005344 | Ga0070661_100004316 | Ga0070661_1000043167 | 142 |
| 84 | 3300005345 | Ga0070692_10201040 | Ga0070692_102010402 | 142 |
| 85 | 3300005353 | Ga0070669_100301732 | Ga0070669_1003017322 | 142 |
| 86 | 3300005354 | Ga0070675_100004936 | Ga0070675_1000049363 | 142 |
| 87 | 3300005355 | Ga0070671_100603280 | Ga0070671_1006032802 | 142 |
| 88 | 3300005356 | Ga0070674_100101872 | Ga0070674_1001018722 | 142 |
| 89 | 3300005356 | Ga0070674_100193779 | Ga0070674_1001937792 | 142 |
| 90 | 3300005366 | Ga0070659_100279830 | Ga0070659_1002798302 | 142 |
| 91 | 3300005366 | Ga0070659_100493504 | Ga0070659_1004935042 | 142 |
| 92 | 3300005367 | Ga0070667_100832163 | Ga0070667_1008321632 | 142 |
| 93 | 3300005367 | Ga0070667_101401293 | Ga0070667_1014012931 | 142 |
| 94 | 3300005435 | Ga0070714_100308157 | Ga0070714_1003081572 | 142 |
| 95 | 3300005436 | Ga0070713_100080884 | Ga0070713_1000808842 | 142 |
| 96 | 3300005436 | Ga0070713_100708539 | Ga0070713_1007085392 | 142 |
| 97 | 3300005440 | Ga0070705_100096038 | Ga0070705_1000960382 | 142 |
| 98 | 3300005441 | Ga0070700_100042312 | Ga0070700_1000423122 | 142 |
| 99 | 3300005455 | Ga0070663_100221661 | Ga0070663_1002216612 | 142 |
| 100 | 3300005455 | Ga0070663_100666638 | Ga0070663_1006666381 | 142 |
| 101 | 3300005456 | Ga0070678_100396902 | Ga0070678_1003969022 | 142 |
| 102 | 3300005456 | Ga0070678_100424497 | Ga0070678_1004244972 | 142 |
| 103 | 3300005456 | Ga0070678_100464523 | Ga0070678_1004645232 | 142 |
| 104 | 3300005457 | Ga0070662_100051948 | Ga0070662_1000519482 | 142 |
| 105 | 3300005458 | Ga0070681_10399978 | Ga0070681_103999782 | 142 |
| 106 | 3300005458 | Ga0070681_10505101 | Ga0070681_105051011 | 142 |
| 107 | 3300005468 | Ga0070707_100454077 | Ga0070707_1004540772 | 142 |
| 108 | 3300005518 | Ga0070699_100408732 | Ga0070699_1004087322 | 142 |
| 109 | 3300005530 | Ga0070679_100088015 | Ga0070679_1000880153 | 142 |
| 110 | 3300005530 | Ga0070679_100265064 | Ga0070679_1002650642 | 142 |
| 111 | 3300005535 | Ga0070684_100018599 | Ga0070684_1000185995 | 142 |
| 112 | 3300005535 | Ga0070684_100700122 | Ga0070684_1007001221 | 142 |
| 113 | 3300005539 | Ga0068853_100285853 | Ga0068853_1002858532 | 142 |
| 114 | 3300005543 | Ga0070672_100501517 | Ga0070672_1005015172 | 142 |
| 115 | 3300005543 | Ga0070672_100584638 | Ga0070672_1005846382 | 142 |
| 116 | 3300005544 | Ga0070686_101729858 | Ga0070686_1017298581 | 142 |
| 117 | 3300005547 | Ga0070693_100935875 | Ga0070693_1009358751 | 142 |
| 118 | 3300005548 | Ga0070665_100383287 | Ga0070665_1003832872 | 142 |
| 119 | 3300005548 | Ga0070665_101405824 | Ga0070665_1014058242 | 142 |
| 120 | 3300005549 | Ga0070704_100181627 | Ga0070704_1001816272 | 142 |
| 121 | 3300005563 | Ga0068855_100937246 | Ga0068855_1009372462 | 142 |
| 122 | 3300005564 | Ga0070664_100004701 | Ga0070664_10000470110 | 142 |
| 123 | 3300005564 | Ga0070664_100471016 | Ga0070664_1004710162 | 142 |
| 124 | 3300005564 | Ga0070664_101054139 | Ga0070664_1010541392 | 142 |
| 125 | 3300005577 | Ga0068857_100372400 | Ga0068857_1003724002 | 142 |
| 126 | 3300005577 | Ga0068857_100474031 | Ga0068857_1004740311 | 142 |
| 127 | 3300005577 | Ga0068857_100946067 | Ga0068857_1009460671 | 142 |
| 128 | 3300005578 | Ga0068854_100141147 | Ga0068854_1001411472 | 142 |
| 129 | 3300005578 | Ga0068854_100611415 | Ga0068854_1006114152 | 142 |
| 130 | 3300005614 | Ga0068856_100049655 | Ga0068856_1000496552 | 142 |
| 131 | 3300005614 | Ga0068856_100769177 | Ga0068856_1007691772 | 142 |
| 132 | 3300005615 | Ga0070702_100019124 | Ga0070702_1000191241 | 142 |
| 133 | 3300005616 | Ga0068852_100217899 | Ga0068852_1002178992 | 142 |
| 134 | 3300005616 | Ga0068852_100312974 | Ga0068852_1003129743 | 142 |
| 135 | 3300005617 | Ga0068859_100000154 | Ga0068859_10000015452 | 142 |
| 136 | 3300005617 | Ga0068859_101376898 | Ga0068859_1013768982 | 142 |
| 137 | 3300005618 | Ga0068864_100078271 | Ga0068864_1000782713 | 142 |
| 138 | 3300005618 | Ga0068864_100109942 | Ga0068864_1001099422 | 142 |
| 139 | 3300005618 | Ga0068864_100598043 | Ga0068864_1005980432 | 142 |
| 140 | 3300005718 | Ga0068866_10026408 | Ga0068866_100264082 | 142 |
| 141 | 3300005719 | Ga0068861_100900185 | Ga0068861_1009001852 | 142 |
| 142 | 3300005719 | Ga0068861_101807545 | Ga0068861_1018075452 | 142 |
| 143 | 3300005841 | Ga0068863_100000396 | Ga0068863_10000039616 | 142 |
| 144 | 3300005841 | Ga0068863_100127105 | Ga0068863_1001271052 | 142 |
| 145 | 3300005841 | Ga0068863_100274438 | Ga0068863_1002744382 | 142 |
| 146 | 3300005842 | Ga0068858_100056743 | Ga0068858_1000567434 | 142 |
| 147 | 3300005844 | Ga0068862_100000021 | Ga0068862_10000002193 | 142 |
| 148 | 3300005844 | Ga0068862_100045409 | Ga0068862_1000454093 | 142 |
| 149 | 3300005937 | Ga0081455_10077476 | Ga0081455_100774762 | 142 |
| 150 | 3300005937 | Ga0081455_10182503 | Ga0081455_101825032 | 142 |
| 151 | 3300005937 | Ga0081455_10310483 | Ga0081455_103104832 | 142 |
| 152 | 3300005937 | Ga0081455_10446366 | Ga0081455_104463662 | 142 |
| 153 | 3300005983 | Ga0081540_1000330 | Ga0081540_100033037 | 142 |
| 154 | 3300005983 | Ga0081540_1124493 | Ga0081540_11244932 | 142 |
| 155 | 3300005985 | Ga0081539_10006076 | Ga0081539_100060764 | 142 |
| 156 | 3300006051 | Ga0075364_10011580 | Ga0075364_100115803 | 142 |
| 157 | 3300006058 | Ga0075432_10046963 | Ga0075432_100469631 | 142 |
| 158 | 3300006058 | Ga0075432_10047115 | Ga0075432_100471151 | 142 |
| 159 | 3300006173 | Ga0070716_100022842 | Ga0070716_1000228425 | 142 |
| 160 | 3300006173 | Ga0070716_100190303 | Ga0070716_1001903032 | 142 |
| 161 | 3300006177 | Ga0075362_10190751 | Ga0075362_101907511 | 142 |
| 162 | 3300006178 | Ga0075367_10046560 | Ga0075367_100465603 | 142 |
| 163 | 3300006186 | Ga0075369_10005526 | Ga0075369_100055264 | 142 |
| 164 | 3300006186 | Ga0075369_10008271 | Ga0075369_100082714 | 142 |
| 165 | 3300006237 | Ga0097621_100233258 | Ga0097621_1002332582 | 142 |
| 166 | 3300006237 | Ga0097621_101176367 | Ga0097621_1011763672 | 142 |
| 167 | 3300006353 | Ga0075370_10013519 | Ga0075370_100135194 | 142 |
| 168 | 3300006844 | Ga0075428_100035067 | Ga0075428_1000350673 | 142 |
| 169 | 3300006844 | Ga0075428_100078598 | Ga0075428_1000785982 | 142 |
| 170 | 3300006844 | Ga0075428_100083061 | Ga0075428_1000830612 | 142 |
| 171 | 3300006844 | Ga0075428_100085371 | Ga0075428_1000853712 | 142 |
| 172 | 3300006844 | Ga0075428_100271714 | Ga0075428_1002717143 | 142 |
| 173 | 3300006844 | Ga0075428_100891308 | Ga0075428_1008913082 | 142 |
| 174 | 3300006846 | Ga0075430_100009697 | Ga0075430_1000096973 | 142 |
| 175 | 3300006846 | Ga0075430_100016404 | Ga0075430_1000164046 | 142 |
| 176 | 3300006846 | Ga0075430_100052237 | Ga0075430_1000522373 | 142 |
| 177 | 3300006847 | Ga0075431_100012493 | Ga0075431_1000124935 | 142 |
| 178 | 3300006847 | Ga0075431_100077006 | Ga0075431_1000770062 | 142 |
| 179 | 3300006847 | Ga0075431_100133189 | Ga0075431_1001331892 | 142 |
| 180 | 3300006847 | Ga0075431_100336653 | Ga0075431_1003366533 | 142 |
| 181 | 3300006847 | Ga0075431_100363542 | Ga0075431_1003635422 | 142 |
| 182 | 3300006847 | Ga0075431_100368401 | Ga0075431_1003684012 | 142 |
| 183 | 3300006847 | Ga0075431_101095491 | Ga0075431_1010954912 | 142 |
| 184 | 3300006852 | Ga0075433_10031189 | Ga0075433_100311893 | 142 |
| 185 | 3300006852 | Ga0075433_10226522 | Ga0075433_102265222 | 142 |
| 186 | 3300006852 | Ga0075433_10524168 | Ga0075433_105241682 | 142 |
| 187 | 3300006871 | Ga0075434_100112049 | Ga0075434_1001120492 | 142 |
| 188 | 3300006871 | Ga0075434_100900179 | Ga0075434_1009001792 | 142 |
| 189 | 3300006880 | Ga0075429_100002650 | Ga0075429_10000265011 | 142 |
| 190 | 3300006880 | Ga0075429_100134249 | Ga0075429_1001342492 | 142 |
| 191 | 3300006880 | Ga0075429_101862067 | Ga0075429_1018620671 | 142 |
| 192 | 3300006914 | Ga0075436_100108698 | Ga0075436_1001086982 | 142 |
| 193 | 3300006931 | Ga0097620_100000154 | Ga0097620_10000015412 | 142 |
| 194 | 3300006931 | Ga0097620_101376940 | Ga0097620_1013769402 | 142 |
| 195 | 3300007076 | Ga0075435_100009714 | Ga0075435_1000097145 | 142 |
| 196 | 3300007076 | Ga0075435_100360398 | Ga0075435_1003603982 | 142 |
| 197 | 3300007788 | Ga0099795_10013838 | Ga0099795_100138381 | 142 |
| 198 | 3300009011 | Ga0105251_10079911 | Ga0105251_100799113 | 142 |
| 199 | 3300009093 | Ga0105240_10678583 | Ga0105240_106785832 | 142 |
| 200 | 3300009093 | Ga0105240_10905943 | Ga0105240_109059432 | 142 |
| 201 | 3300009094 | Ga0111539_10005471 | Ga0111539_1000547110 | 142 |
| 202 | 3300009094 | Ga0111539_10160291 | Ga0111539_101602914 | 142 |
| 203 | 3300009098 | Ga0105245_10011203 | Ga0105245_100112039 | 142 |
| 204 | 3300009098 | Ga0105245_10334566 | Ga0105245_103345662 | 142 |
| 205 | 3300009098 | Ga0105245_10704468 | Ga0105245_107044682 | 142 |
| 206 | 3300009098 | Ga0105245_10997034 | Ga0105245_109970342 | 142 |
| 207 | 3300009098 | Ga0105245_11633508 | Ga0105245_116335081 | 142 |
| 208 | 3300009147 | Ga0114129_10008762 | Ga0114129_100087622 | 142 |
| 209 | 3300009147 | Ga0114129_10024008 | Ga0114129_100240085 | 142 |
| 210 | 3300009147 | Ga0114129_10048939 | Ga0114129_100489395 | 142 |
| 211 | 3300009147 | Ga0114129_10333117 | Ga0114129_103331173 | 142 |
| 212 | 3300009147 | Ga0114129_12550797 | Ga0114129_125507971 | 142 |
| 213 | 3300009148 | Ga0105243_10245858 | Ga0105243_102458582 | 142 |
| 214 | 3300009174 | Ga0105241_11363986 | Ga0105241_113639861 | 142 |
| 215 | 3300009176 | Ga0105242_10892857 | Ga0105242_108928572 | 142 |
| 216 | 3300009177 | Ga0105248_10670783 | Ga0105248_106707831 | 142 |
| 217 | 3300009545 | Ga0105237_10159322 | Ga0105237_101593223 | 142 |
| 218 | 3300009551 | Ga0105238_10107956 | Ga0105238_101079562 | 142 |
| 219 | 3300009551 | Ga0105238_10656712 | Ga0105238_106567122 | 142 |
| 220 | 3300009551 | Ga0105238_12868467 | Ga0105238_128684671 | 142 |
| 221 | 3300009553 | Ga0105249_10132980 | Ga0105249_101329802 | 142 |
| 222 | 3300009553 | Ga0105249_11118061 | Ga0105249_111180612 | 142 |
| 223 | 3300010159 | Ga0099796_10028410 | Ga0099796_100284103 | 142 |
| 224 | 3300010375 | Ga0105239_10316372 | Ga0105239_103163723 | 142 |
| 225 | 3300010375 | Ga0105239_10342206 | Ga0105239_103422062 | 142 |
| 226 | 3300010375 | Ga0105239_10403971 | Ga0105239_104039712 | 142 |
| 227 | 3300011119 | Ga0105246_10137085 | Ga0105246_101370853 | 142 |
| 228 | 3300013100 | Ga0157373_10705961 | Ga0157373_107059611 | 142 |
| 229 | 3300013104 | Ga0157370_10123002 | Ga0157370_101230022 | 142 |
| 230 | 3300013105 | Ga0157369_10159646 | Ga0157369_101596462 | 142 |
| 231 | 3300013105 | Ga0157369_10173836 | Ga0157369_101738362 | 142 |
| 232 | 3300013297 | Ga0157378_10847571 | Ga0157378_108475712 | 142 |
| 233 | 3300013306 | Ga0163162_10749041 | Ga0163162_107490412 | 142 |
| 234 | 3300013307 | Ga0157372_10112402 | Ga0157372_101124023 | 142 |
| 235 | 3300013307 | Ga0157372_10447402 | Ga0157372_104474022 | 142 |
| 236 | 3300013307 | Ga0157372_10646185 | Ga0157372_106461852 | 142 |
| 237 | 3300013307 | Ga0157372_10737959 | Ga0157372_107379591 | 142 |
| 238 | 3300013307 | Ga0157372_11411198 | Ga0157372_114111981 | 142 |
| 239 | 3300014325 | Ga0163163_10011362 | Ga0163163_100113623 | 142 |
| 240 | 3300014325 | Ga0163163_10043824 | Ga0163163_100438245 | 142 |
| 241 | 3300014325 | Ga0163163_10307436 | Ga0163163_103074362 | 142 |
| 242 | 3300014326 | Ga0157380_10547839 | Ga0157380_105478391 | 142 |
| 243 | 3300014326 | Ga0157380_10801805 | Ga0157380_108018051 | 142 |
| 244 | 3300014745 | Ga0157377_10011787 | Ga0157377_100117873 | 142 |
| 245 | 3300014968 | Ga0157379_10261039 | Ga0157379_102610391 | 142 |
| 246 | 3300014969 | Ga0157376_10203025 | Ga0157376_102030252 | 142 |
| 247 | 3300014969 | Ga0157376_10361318 | Ga0157376_103613182 | 142 |
| 248 | 3300014969 | Ga0157376_11809047 | Ga0157376_118090472 | 142 |
| 249 | 3300020069 | Ga0197907_10814455 | Ga0197907_108144551 | 142 |
| 250 | 3300020070 | Ga0206356_10971613 | Ga0206356_109716132 | 142 |
| 251 | 3300020078 | Ga0206352_11296872 | Ga0206352_112968721 | 142 |
| 252 | 3300020082 | Ga0206353_10354313 | Ga0206353_103543132 | 142 |
| 253 | 3300020082 | Ga0206353_11458692 | Ga0206353_114586923 | 142 |
| 254 | 3300021384 | Ga0213876_10023093 | Ga0213876_100230932 | 142 |
| 255 | 3300021384 | Ga0213876_10272987 | Ga0213876_102729872 | 142 |
| 256 | 3300021388 | Ga0213875_10002508 | Ga0213875_100025083 | 142 |
| 257 | 3300022467 | Ga0224712_10009645 | Ga0224712_100096452 | 142 |
| 258 | 3300025898 | Ga0207692_10090044 | Ga0207692_100900443 | 142 |
| 259 | 3300025901 | Ga0207688_10047376 | Ga0207688_100473763 | 142 |
| 260 | 3300025904 | Ga0207647_10104749 | Ga0207647_101047492 | 142 |
| 261 | 3300025905 | Ga0207685_10031535 | Ga0207685_100315351 | 142 |
| 262 | 3300025906 | Ga0207699_10002187 | Ga0207699_100021872 | 142 |
| 263 | 3300025907 | Ga0207645_10228149 | Ga0207645_102281492 | 142 |
| 264 | 3300025909 | Ga0207705_10548847 | Ga0207705_105488471 | 142 |
| 265 | 3300025909 | Ga0207705_11079394 | Ga0207705_110793942 | 142 |
| 266 | 3300025912 | Ga0207707_10065622 | Ga0207707_100656223 | 142 |
| 267 | 3300025912 | Ga0207707_11245079 | Ga0207707_112450792 | 142 |
| 268 | 3300025915 | Ga0207693_10009125 | Ga0207693_100091257 | 142 |
| 269 | 3300025916 | Ga0207663_10002997 | Ga0207663_100029972 | 142 |
| 270 | 3300025917 | Ga0207660_10124375 | Ga0207660_101243751 | 142 |
| 271 | 3300025919 | Ga0207657_10104817 | Ga0207657_101048172 | 142 |
| 272 | 3300025919 | Ga0207657_10158369 | Ga0207657_101583693 | 142 |
| 273 | 3300025920 | Ga0207649_10373821 | Ga0207649_103738212 | 142 |
| 274 | 3300025921 | Ga0207652_10054890 | Ga0207652_100548902 | 142 |
| 275 | 3300025922 | Ga0207646_10554252 | Ga0207646_105542521 | 142 |
| 276 | 3300025923 | Ga0207681_10347083 | Ga0207681_103470832 | 142 |
| 277 | 3300025924 | Ga0207694_10590379 | Ga0207694_105903792 | 142 |
| 278 | 3300025925 | Ga0207650_10060418 | Ga0207650_100604182 | 142 |
| 279 | 3300025926 | Ga0207659_10005349 | Ga0207659_100053494 | 142 |
| 280 | 3300025927 | Ga0207687_10256625 | Ga0207687_102566253 | 142 |
| 281 | 3300025927 | Ga0207687_10315134 | Ga0207687_103151341 | 142 |
| 282 | 3300025928 | Ga0207700_10048206 | Ga0207700_100482062 | 142 |
| 283 | 3300025928 | Ga0207700_10064425 | Ga0207700_100644252 | 142 |
| 284 | 3300025928 | Ga0207700_10638585 | Ga0207700_106385852 | 142 |
| 285 | 3300025929 | Ga0207664_10004489 | Ga0207664_100044892 | 142 |
| 286 | 3300025933 | Ga0207706_10035253 | Ga0207706_100352532 | 142 |
| 287 | 3300025933 | Ga0207706_10808091 | Ga0207706_108080911 | 142 |
| 288 | 3300025934 | Ga0207686_10492295 | Ga0207686_104922952 | 142 |
| 289 | 3300025935 | Ga0207709_10706310 | Ga0207709_107063101 | 142 |
| 290 | 3300025937 | Ga0207669_10461232 | Ga0207669_104612322 | 142 |
| 291 | 3300025938 | Ga0207704_10028557 | Ga0207704_100285575 | 142 |
| 292 | 3300025939 | Ga0207665_10005974 | Ga0207665_100059747 | 142 |
| 293 | 3300025939 | Ga0207665_10232754 | Ga0207665_102327542 | 142 |
| 294 | 3300025940 | Ga0207691_10236690 | Ga0207691_102366903 | 142 |
| 295 | 3300025941 | Ga0207711_10000170 | Ga0207711_1000017050 | 142 |
| 296 | 3300025942 | Ga0207689_10010048 | Ga0207689_100100487 | 142 |
| 297 | 3300025942 | Ga0207689_10283932 | Ga0207689_102839322 | 142 |
| 298 | 3300025944 | Ga0207661_10210545 | Ga0207661_102105451 | 142 |
| 299 | 3300025945 | Ga0207679_10084248 | Ga0207679_100842484 | 142 |
| 300 | 3300025945 | Ga0207679_10478056 | Ga0207679_104780562 | 142 |
| 301 | 3300025949 | Ga0207667_10797456 | Ga0207667_107974562 | 142 |
| 302 | 3300025960 | Ga0207651_10780771 | Ga0207651_107807711 | 142 |
| 303 | 3300025961 | Ga0207712_10006290 | Ga0207712_100062907 | 142 |
| 304 | 3300025972 | Ga0207668_10993487 | Ga0207668_109934872 | 142 |
| 305 | 3300025981 | Ga0207640_10116679 | Ga0207640_101166793 | 142 |
| 306 | 3300025981 | Ga0207640_11028784 | Ga0207640_110287841 | 142 |
| 307 | 3300025986 | Ga0207658_10935225 | Ga0207658_109352252 | 142 |
| 308 | 3300026023 | Ga0207677_10159836 | Ga0207677_101598363 | 142 |
| 309 | 3300026023 | Ga0207677_10591689 | Ga0207677_105916891 | 142 |
| 310 | 3300026035 | Ga0207703_10199294 | Ga0207703_101992943 | 142 |
| 311 | 3300026067 | Ga0207678_10131084 | Ga0207678_101310842 | 142 |
| 312 | 3300026067 | Ga0207678_10155235 | Ga0207678_101552353 | 142 |
| 313 | 3300026067 | Ga0207678_10173854 | Ga0207678_101738543 | 142 |
| 314 | 3300026067 | Ga0207678_10448833 | Ga0207678_104488331 | 142 |
| 315 | 3300026075 | Ga0207708_10063026 | Ga0207708_100630262 | 142 |
| 316 | 3300026078 | Ga0207702_10064029 | Ga0207702_100640292 | 142 |
| 317 | 3300026078 | Ga0207702_10444488 | Ga0207702_104444882 | 142 |
| 318 | 3300026088 | Ga0207641_10001578 | Ga0207641_1000157815 | 142 |
| 319 | 3300026088 | Ga0207641_10016985 | Ga0207641_100169856 | 142 |
| 320 | 3300026095 | Ga0207676_10131885 | Ga0207676_101318853 | 142 |
| 321 | 3300026095 | Ga0207676_10341517 | Ga0207676_103415173 | 142 |
| 322 | 3300026095 | Ga0207676_10836588 | Ga0207676_108365882 | 142 |
| 323 | 3300026116 | Ga0207674_10089136 | Ga0207674_100891362 | 142 |
| 324 | 3300026116 | Ga0207674_10173753 | Ga0207674_101737532 | 142 |
| 325 | 3300026116 | Ga0207674_10242446 | Ga0207674_102424462 | 142 |
| 326 | 3300026116 | Ga0207674_11321972 | Ga0207674_113219722 | 142 |
| 327 | 3300026118 | Ga0207675_101467661 | Ga0207675_1014676611 | 142 |
| 328 | 3300026121 | Ga0207683_10092634 | Ga0207683_100926344 | 142 |
| 329 | 3300026121 | Ga0207683_10099151 | Ga0207683_100991511 | 142 |
| 330 | 3300026121 | Ga0207683_10226622 | Ga0207683_102266222 | 142 |
| 331 | 3300026121 | Ga0207683_10390927 | Ga0207683_103909272 | 142 |
| 332 | 3300026121 | Ga0207683_10472344 | Ga0207683_104723442 | 142 |
| 333 | 3300026142 | Ga0207698_10233284 | Ga0207698_102332841 | 142 |
| 334 | 3300026142 | Ga0207698_10563792 | Ga0207698_105637922 | 142 |
| 335 | 3300026142 | Ga0207698_10882730 | Ga0207698_108827302 | 142 |
| 336 | 3300027907 | Ga0207428_10118715 | Ga0207428_101187151 | 142 |
| 337 | 3300027907 | Ga0207428_10131813 | Ga0207428_101318131 | 142 |
| 338 | 3300027907 | Ga0207428_10506760 | Ga0207428_105067602 | 142 |
| 339 | 3300028379 | Ga0268266_10090969 | Ga0268266_100909693 | 142 |
| 340 | 3300028379 | Ga0268266_10263142 | Ga0268266_102631422 | 142 |
| 341 | 3300028379 | Ga0268266_10274499 | Ga0268266_102744991 | 142 |
| 342 | 3300028380 | Ga0268265_10000034 | Ga0268265_10000034100 | 142 |
| 343 | 3300028380 | Ga0268265_10038881 | Ga0268265_100388813 | 142 |
| 344 | 3300031456 | Ga0307513_10116141 | Ga0307513_101161413 | 142 |
| 345 | 3300031456 | Ga0307513_11045858 | Ga0307513_110458581 | 142 |
| 346 | 3300031548 | Ga0307408_100074075 | Ga0307408_1000740753 | 142 |
| 347 | 3300031548 | Ga0307408_100264442 | Ga0307408_1002644422 | 142 |
| 348 | 3300031731 | Ga0307405_10775215 | Ga0307405_107752151 | 142 |
| 349 | 3300031824 | Ga0307413_10268733 | Ga0307413_102687331 | 142 |
| 350 | 3300031824 | Ga0307413_10290028 | Ga0307413_102900282 | 142 |
| 351 | 3300031852 | Ga0307410_10105286 | Ga0307410_101052864 | 142 |
| 352 | 3300031901 | Ga0307406_10052243 | Ga0307406_100522432 | 142 |
| 353 | 3300031901 | Ga0307406_10498826 | Ga0307406_104988261 | 142 |
| 354 | 3300031903 | Ga0307407_10167335 | Ga0307407_101673352 | 142 |
| 355 | 3300031903 | Ga0307407_10276743 | Ga0307407_102767432 | 142 |
| 356 | 3300031995 | Ga0307409_100008660 | Ga0307409_1000086604 | 142 |
| 357 | 3300031995 | Ga0307409_100071358 | Ga0307409_1000713584 | 142 |
| 358 | 3300031995 | Ga0307409_100313190 | Ga0307409_1003131903 | 142 |
| 359 | 3300031995 | Ga0307409_100955324 | Ga0307409_1009553241 | 142 |
| 360 | 3300031995 | Ga0307409_101320740 | Ga0307409_1013207402 | 142 |
| 361 | 3300031995 | Ga0307409_102891038 | Ga0307409_1028910381 | 142 |
| 362 | 3300032002 | Ga0307416_100012136 | Ga0307416_1000121365 | 142 |
| 363 | 3300032002 | Ga0307416_100037324 | Ga0307416_1000373244 | 142 |
| 364 | 3300032002 | Ga0307416_100161594 | Ga0307416_1001615942 | 142 |
| 365 | 3300032002 | Ga0307416_100748197 | Ga0307416_1007481972 | 142 |
| 366 | 3300032002 | Ga0307416_100899555 | Ga0307416_1008995552 | 142 |
| 367 | 3300032002 | Ga0307416_101027727 | Ga0307416_1010277272 | 142 |
| 368 | 3300032002 | Ga0307416_102652806 | Ga0307416_1026528061 | 142 |
| 369 | 3300032004 | Ga0307414_10422814 | Ga0307414_104228141 | 142 |
| 370 | 3300032005 | Ga0307411_10261907 | Ga0307411_102619072 | 142 |
| 371 | 3300032005 | Ga0307411_10272240 | Ga0307411_102722401 | 142 |
| 372 | 3300032126 | Ga0307415_100009799 | Ga0307415_1000097992 | 142 |
| 373 | 3300032126 | Ga0307415_100056096 | Ga0307415_1000560963 | 142 |
| 374 | 3300032126 | Ga0307415_100062817 | Ga0307415_1000628171 | 142 |
| 375 | 3300032126 | Ga0307415_100143005 | Ga0307415_1001430053 | 142 |
| 376 | 3300032126 | Ga0307415_100444423 | Ga0307415_1004444232 | 142 |
| 377 | 3300032126 | Ga0307415_100529325 | Ga0307415_1005293252 | 142 |
| 378 | 3300032126 | Ga0307415_100583751 | Ga0307415_1005837512 | 142 |
| 379 | 3300032126 | Ga0307415_102170123 | Ga0307415_1021701231 | 142 |
| 380 | 3300034816 | Ga0373930_0015702 | Ga0373930_0015702_710_1138 | 142 |
| 381 | 3300034820 | Ga0373959_0001679 | Ga0373959_0001679_949_1377 | 142 |
| 382 | 3300034957 | Ga0373938_0006150 | Ga0373938_0006150_334_762 | 142 |
| 383 | 3300035083 | Ga0373926_0051033 | Ga0373926_0051033_909_1337 | 142 |
| 384 | 3300035084 | Ga0373928_0004837 | Ga0373928_0004837_964_1392 | 142 |
| 385 | 3300035085 | Ga0373929_0005019 | Ga0373929_0005019_488_916 | 142 |
| 386 | 3300035086 | Ga0373934_0002980 | Ga0373934_0002980_4039_4467 | 142 |
| 387 | 3300035086 | Ga0373934_0019986 | Ga0373934_0019986_621_1049 | 142 |
| 388 | 3300035086 | Ga0373934_0355768 | Ga0373934_0355768_145_573 | 142 |
| 389 | 3300035088 | Ga0373940_0001674 | Ga0373940_0001674_1793_2221 | 142 |
| 390 | 3300035090 | Ga0373949_0004023 | Ga0373949_0004023_214_642 | 142 |
| 391 | 3300035091 | Ga0373951_0000057 | Ga0373951_0000057_1216_1644 | 142 |
| 392 | 3300035091 | Ga0373951_0078888 | Ga0373951_0078888_380_808 | 142 |
| 393 | 3300035111 | Ga0373923_0129605 | Ga0373923_0129605_308_736 | 142 |
| 394 | 3300035111 | Ga0373923_0315700 | Ga0373923_0315700_250_678 | 142 |
| 395 | 3300035114 | Ga0373939_0156835 | Ga0373939_0156835_202_630 | 142 |
| 396 | 3300035115 | Ga0373941_0277264 | Ga0373941_0277264_97_525 | 142 |
| 397 | 3300035116 | Ga0373945_0059236 | Ga0373945_0059236_664_1092 | 142 |
| 398 | 3300035116 | Ga0373945_0389381 | Ga0373945_0389381_17_445 | 142 |
| 399 | 3300035117 | Ga0373953_0000287 | Ga0373953_0000287_11809_12237 | 142 |
| 400 | 3300035117 | Ga0373953_0034130 | Ga0373953_0034130_1160_1588 | 142 |
| 401 | 3300035118 | Ga0373954_0008734 | Ga0373954_0008734_2611_3039 | 142 |
| 402 | 3300035118 | Ga0373954_0008943 | Ga0373954_0008943_2723_3151 | 142 |
| 403 | 3300035119 | Ga0373956_0000749 | Ga0373956_0000749_1675_2103 | 142 |
| 404 | 3300035119 | Ga0373956_0064883 | Ga0373956_0064883_1102_1530 | 142 |
| 405 | 3300035120 | Ga0373957_0000202 | Ga0373957_0000202_4533_4961 | 142 |
| 406 | 3300035120 | Ga0373957_0008081 | Ga0373957_0008081_399_827 | 142 |
| 407 | 3300035120 | Ga0373957_0119867 | Ga0373957_0119867_349_777 | 142 |
| 408 | 3300035121 | Ga0373960_0012087 | Ga0373960_0012087_322_750 | 142 |
| 409 | 3300035170 | Ga0373943_0074087 | Ga0373943_0074087_518_946 | 142 |
| 410 | 3300035170 | Ga0373943_0084358 | Ga0373943_0084358_974_1402 | 142 |
| 411 | 3300035171 | Ga0373946_0190168 | Ga0373946_0190168_339_767 | 142 |
| 412 | 3300035171 | Ga0373946_0681692 | Ga0373946_0681692_10_438 | 142 |
| 413 | 3300035172 | Ga0373955_0000190 | Ga0373955_0000190_7977_8405 | 142 |
| 414 | 3300035172 | Ga0373955_0000949 | Ga0373955_0000949_10949_11377 | 142 |
| 415 | 3300035207 | Ga0373942_0025100 | Ga0373942_0025100_682_1110 | 142 |
| 416 | 3300035242 | Ga0373962_0014259 | Ga0373962_0014259_1553_1981 | 142 |
| 417 | 3300035410 | Ga0373924_0000299 | Ga0373924_0000299_12611_13039 | 142 |
| 418 | 3300035410 | Ga0373924_0144848 | Ga0373924_0144848_73_501 | 142 |
| 419 | 3300035410 | Ga0373924_0177314 | Ga0373924_0177314_51_479 | 142 |
| 420 | 3300035692 | Ga0373935_0207136 | Ga0373935_0207136_44_472 | 142 |
| 421 | 3300035692 | Ga0373935_0344441 | Ga0373935_0344441_304_732 | 142 |
| 422 | 3300035695 | Ga0373927_0064774 | Ga0373927_0064774_1790_2218 | 142 |
| 423 | 3300035695 | Ga0373927_0157548 | Ga0373927_0157548_992_1420 | 142 |
| 424 | 3300035724 | Ga0373933_0000002 | Ga0373933_0000002_36677_37105 | 142 |
| 425 | 3300035724 | Ga0373933_0020754 | Ga0373933_0020754_741_1169 | 142 |
| 426 | 3300035724 | Ga0373933_0030456 | Ga0373933_0030456_591_1019 | 142 |
| 427 | 3300035725 | Ga0373947_0129876 | Ga0373947_0129876_340_768 | 142 |
| 428 | 3300035725 | Ga0373947_0274126 | Ga0373947_0274126_519_947 | 142 |
| 429 | 3300036401 | Ga0373937_0000014 | Ga0373937_0000014_114681_115109 | 142 |
| 430 | 3300036401 | Ga0373937_0010614 | Ga0373937_0010614_5696_6124 | 142 |
| 431 | 3300036401 | Ga0373937_0047451 | Ga0373937_0047451_2746_3174 | 142 |
| 432 | 3300037068 | Ga0373925_0007581 | Ga0373925_0007581_5336_5764 | 142 |
| 433 | 3300037068 | Ga0373925_0229642 | Ga0373925_0229642_373_801 | 142 |
| 434 | 3300037068 | Ga0373925_0755201 | Ga0373925_0755201_189_617 | 142 |
| 435 | 3300037068 | Ga0373925_1076711 | Ga0373925_1076711_164_592 | 142 |
| 436 | 3300037312 | Ga0395899_0008140 | Ga0395899_0008140_3766_4194 | 142 |
| 437 | 3300037466 | Ga0395898_0417280 | Ga0395898_0417280_624_1052 | 142 |
| 438 | 3300037466 | Ga0395898_0432312 | Ga0395898_0432312_794_1222 | 142 |
| 439 | 3300037466 | Ga0395898_1190348 | Ga0395898_1190348_80_508 | 142 |
| 440 | 3300037471 | Ga0395905_1099843 | Ga0395905_1099843_220_648 | 142 |
| 441 | 3300037853 | Ga0436364_0923522 | Ga0436364_0923522_90714_91142 | 142 |
| 442 | 3300037853 | Ga0436364_1394990 | Ga0436364_1394990_1792_2223 | 142 |
| 443 | 3300038443 | Ga0395901_0013845 | Ga0395901_0013845_4115_4543 | 142 |
| 444 | 3300038996 | Ga0242420_035936 | Ga0242420_035936_459_887 | 142 |
| 445 | 3300039437 | Ga0436365_1135090 | Ga0436365_1135090_1291_1719 | 142 |
| 446 | 3300039437 | Ga0436365_1929710 | Ga0436365_1929710_392_823 | 142 |
| 447 | 3300041410 | Ga0439461_0001522 | Ga0439461_0001522_1814_2242 | 142 |
| 448 | 3300041411 | Ga0439466_0004315 | Ga0439466_0004315_3244_3672 | 142 |
| 449 | 3300041411 | Ga0439466_0004664 | Ga0439466_0004664_2259_2687 | 142 |
| 450 | 3300041413 | Ga0439465_0000501 | Ga0439465_0000501_3136_3564 | 142 |
| 451 | 3300041413 | Ga0439465_0003422 | Ga0439465_0003422_1109_1537 | 142 |
| 452 | 3300041443 | Ga0451789_0318381 | Ga0451789_0318381_1105_1533 | 142 |
| 453 | 3300041453 | Ga0451797_1028095 | Ga0451797_1028095_1192_1620 | 142 |
| 454 | 3300041456 | Ga0451795_0617988 | Ga0451795_0617988_1662_2090 | 142 |
| 455 | 3300041459 | Ga0451800_0925617 | Ga0451800_0925617_1929_2357 | 142 |
| 456 | 3300041486 | Ga0451807_0590601 | Ga0451807_0590601_107_535 | 142 |
| 457 | 3300041494 | Ga0451837_0856061 | Ga0451837_0856061_134_562 | 142 |
| 458 | 3300041496 | Ga0451839_1323259 | Ga0451839_1323259_1267_1695 | 142 |
| 459 | 3300041505 | Ga0451849_0436125 | Ga0451849_0436125_197_625 | 142 |
| 460 | 3300041512 | Ga0451853_1902101 | Ga0451853_1902101_1078_1506 | 142 |
| 461 | 3300042002 | Ga0439442_016837 | Ga0439442_016837_558_986 | 142 |
| 462 | 3300042004 | Ga0439445_0008773 | Ga0439445_0008773_37_465 | 142 |
| 463 | 3300042435 | Ga0439434_0024650 | Ga0439434_0024650_427_855 | 142 |
| 464 | 3300044658 | Ga0466972_0016477 | Ga0466972_0016477_1901_2329 | 142 |
| 465 | 3300044901 | Ga0466960_0104052 | Ga0466960_0104052_975_1403 | 142 |
| 466 | 3300044901 | Ga0466960_0383520 | Ga0466960_0383520_164_592 | 142 |
| 467 | 3300044901 | Ga0466960_1025719 | Ga0466960_1025719_49_477 | 142 |
| 468 | 3300045976 | Ga0466967_0135769 | Ga0466967_0135769_569_997 | 142 |
| 469 | 3300045976 | Ga0466967_0138658 | Ga0466967_0138658_1226_1654 | 142 |
| 470 | 3300046454 | Ga0495592_0000133 | Ga0495592_0000133_36677_37105 | 142 |
| 471 | 3300046454 | Ga0495592_0053180 | Ga0495592_0053180_1572_2000 | 142 |
| 472 | 3300046455 | Ga0495603_0097511 | Ga0495603_0097511_464_892 | 142 |
| 473 | 3300046459 | Ga0495629_0033812 | Ga0495629_0033812_312_740 | 142 |
| 474 | 3300046459 | Ga0495629_0162594 | Ga0495629_0162594_432_860 | 142 |
| 475 | 3300046459 | Ga0495629_0566635 | Ga0495629_0566635_23_451 | 142 |
| 476 | 3300046462 | Ga0495651_0000019 | Ga0495651_0000019_114681_115109 | 142 |
| 477 | 3300046462 | Ga0495651_0121564 | Ga0495651_0121564_1446_1874 | 142 |
| 478 | 3300046462 | Ga0495651_0245518 | Ga0495651_0245518_399_827 | 142 |
| 479 | 3300046462 | Ga0495651_0832100 | Ga0495651_0832100_89_517 | 142 |
| 480 | 3300046463 | Ga0495653_0000763 | Ga0495653_0000763_9076_9504 | 142 |
| 481 | 3300046463 | Ga0495653_0075842 | Ga0495653_0075842_1778_2206 | 142 |
| 482 | 3300046463 | Ga0495653_0141416 | Ga0495653_0141416_1046_1477 | 142 |
| 483 | 3300046463 | Ga0495653_0652885 | Ga0495653_0652885_21_455 | 142 |
| 484 | 3300046472 | Ga0495580_0085117 | Ga0495580_0085117_1328_1756 | 142 |
| 485 | 3300046473 | Ga0495582_0045125 | Ga0495582_0045125_1020_1448 | 142 |
| 486 | 3300046473 | Ga0495582_0166673 | Ga0495582_0166673_792_1235 | 142 |
| 487 | 3300046475 | Ga0495639_0083470 | Ga0495639_0083470_1044_1472 | 142 |
| 488 | 3300046475 | Ga0495639_0153548 | Ga0495639_0153548_555_983 | 142 |
| 489 | 3300046475 | Ga0495639_0249224 | Ga0495639_0249224_331_768 | 142 |
| 490 | 3300046476 | Ga0495662_0026275 | Ga0495662_0026275_1654_2082 | 142 |
| 491 | 3300046476 | Ga0495662_0302037 | Ga0495662_0302037_294_722 | 142 |
| 492 | 3300046477 | Ga0495664_0004853 | Ga0495664_0004853_5069_5497 | 142 |
| 493 | 3300046477 | Ga0495664_0222941 | Ga0495664_0222941_409_858 | 142 |
| 494 | 3300046499 | Ga0495594_0220935 | Ga0495594_0220935_110_538 | 142 |
| 495 | 3300046507 | Ga0495606_0000540 | Ga0495606_0000540_5348_5788 | 142 |
| 496 | 3300046511 | Ga0495608_0000028 | Ga0495608_0000028_36669_37097 | 142 |
| 497 | 3300046511 | Ga0495608_0012844 | Ga0495608_0012844_1136_1564 | 142 |
| 498 | 3300046511 | Ga0495608_0350330 | Ga0495608_0350330_434_862 | 142 |
| 499 | 3300046514 | Ga0495618_0046453 | Ga0495618_0046453_494_922 | 142 |
| 500 | 3300046514 | Ga0495618_0211842 | Ga0495618_0211842_784_1212 | 142 |
| 501 | 3300046516 | Ga0495628_0000371 | Ga0495628_0000371_20437_20865 | 142 |
| 502 | 3300046517 | Ga0495630_0476805 | Ga0495630_0476805_293_721 | 142 |
| 503 | 3300046517 | Ga0495630_0933343 | Ga0495630_0933343_34_462 | 142 |
| 504 | 3300046526 | Ga0495666_0040822 | Ga0495666_0040822_1760_2188 | 142 |
| 505 | 3300046529 | Ga0495652_0000031 | Ga0495652_0000031_36657_37085 | 142 |
| 506 | 3300046529 | Ga0495652_0019012 | Ga0495652_0019012_4248_4676 | 142 |
| 507 | 3300046531 | Ga0495665_0114177 | Ga0495665_0114177_285_713 | 142 |
| 508 | 3300046531 | Ga0495665_0310803 | Ga0495665_0310803_336_764 | 142 |
| 509 | 3300046531 | Ga0495665_0333538 | Ga0495665_0333538_162_605 | 142 |
| 510 | 3300046533 | Ga0495640_0044467 | Ga0495640_0044467_829_1257 | 142 |
| 511 | 3300046533 | Ga0495640_0097108 | Ga0495640_0097108_133_561 | 142 |
| 512 | 3300046535 | Ga0495586_0138003 | Ga0495586_0138003_611_1039 | 142 |
| 513 | 3300046536 | Ga0495587_0000023 | Ga0495587_0000023_114659_115087 | 142 |
| 514 | 3300046536 | Ga0495587_0033842 | Ga0495587_0033842_1695_2123 | 142 |
| 515 | 3300046543 | Ga0495645_0039761 | Ga0495645_0039761_1182_1610 | 142 |
| 516 | 3300046543 | Ga0495645_0076335 | Ga0495645_0076335_1336_1764 | 142 |
| 517 | 3300046543 | Ga0495645_0361009 | Ga0495645_0361009_147_581 | 142 |
| 518 | 3300046543 | Ga0495645_0383687 | Ga0495645_0383687_446_874 | 142 |
| 519 | 3300046559 | Ga0495667_0000054 | Ga0495667_0000054_36669_37097 | 142 |
| 520 | 3300046559 | Ga0495667_0013775 | Ga0495667_0013775_1803_2231 | 142 |
| 521 | 3300046616 | Ga0495668_0000362 | Ga0495668_0000362_29483_29923 | 142 |
| 522 | 3300046642 | Ga0495634_0017630 | Ga0495634_0017630_1606_2034 | 142 |
| 523 | 3300046642 | Ga0495634_0021812 | Ga0495634_0021812_3971_4399 | 142 |
| 524 | 3300046660 | Ga0495625_0001125 | Ga0495625_0001125_3985_4425 | 142 |
| 525 | 3300046663 | Ga0495635_0150846 | Ga0495635_0150846_809_1237 | 142 |
| 526 | 3300046674 | Ga0495588_0134247 | Ga0495588_0134247_313_741 | 142 |
| 527 | 3300046675 | Ga0495657_0000022 | Ga0495657_0000022_36677_37105 | 142 |
| 528 | 3300046675 | Ga0495657_0026800 | Ga0495657_0026800_1569_1997 | 142 |
| 529 | 3300046678 | Ga0495599_0000700 | Ga0495599_0000700_2131_2559 | 142 |
| 530 | 3300046678 | Ga0495599_0039315 | Ga0495599_0039315_953_1381 | 142 |
| 531 | 3300046678 | Ga0495599_0244098 | Ga0495599_0244098_540_968 | 142 |
| 532 | 3300046679 | Ga0495623_0000416 | Ga0495623_0000416_150_578 | 142 |
| 533 | 3300046679 | Ga0495623_0014675 | Ga0495623_0014675_2613_3041 | 142 |
| 534 | 3300046679 | Ga0495623_0039229 | Ga0495623_0039229_1109_1537 | 142 |
| 535 | 3300046680 | Ga0495646_0082566 | Ga0495646_0082566_993_1421 | 142 |
| 536 | 3300046681 | Ga0495647_0031756 | Ga0495647_0031756_593_1021 | 142 |
| 537 | 3300046681 | Ga0495647_0406933 | Ga0495647_0406933_63_491 | 142 |
| 538 | 3300046683 | Ga0495658_0059288 | Ga0495658_0059288_340_768 | 142 |
| 539 | 3300046690 | Ga0495624_0115440 | Ga0495624_0115440_938_1366 | 142 |
| 540 | 3300046690 | Ga0495624_0137278 | Ga0495624_0137278_197_625 | 142 |
| 541 | 3300046694 | Ga0495649_0256636 | Ga0495649_0256636_359_787 | 142 |
| 542 | 3300046809 | Ga0495600_0006882 | Ga0495600_0006882_2665_3093 | 142 |
| 543 | 3300046809 | Ga0495600_0033354 | Ga0495600_0033354_1182_1610 | 142 |
| 544 | 3300046809 | Ga0495600_0531159 | Ga0495600_0531159_264_695 | 142 |
| 545 | 3300047315 | Ga0495581_0020178 | Ga0495581_0020178_79_507 | 142 |
| 546 | 3300047315 | Ga0495581_0179609 | Ga0495581_0179609_393_821 | 142 |
| 547 | 3300047317 | Ga0495604_0000022 | Ga0495604_0000022_36654_37082 | 142 |
| 548 | 3300047317 | Ga0495604_0019904 | Ga0495604_0019904_657_1085 | 142 |
| 549 | 3300047317 | Ga0495604_0126603 | Ga0495604_0126603_891_1319 | 142 |
| 550 | 3300047319 | Ga0495674_0534500 | Ga0495674_0534500_57_491 | 142 |
| 551 | 3300047319 | Ga0495674_0736390 | Ga0495674_0736390_133_564 | 142 |
| 552 | 3300047321 | Ga0495676_0179158 | Ga0495676_0179158_73_501 | 142 |
| 553 | 3300047322 | Ga0495680_0000271 | Ga0495680_0000271_20491_20919 | 142 |
| 554 | 3300047322 | Ga0495680_0048669 | Ga0495680_0048669_2857_3285 | 142 |
| 555 | 3300047444 | Ga0495675_0025084 | Ga0495675_0025084_1936_2364 | 142 |
| 556 | 3300047444 | Ga0495675_0039659 | Ga0495675_0039659_2282_2710 | 142 |
| 557 | 3300047444 | Ga0495675_0177759 | Ga0495675_0177759_753_1181 | 142 |
| 558 | 3300047471 | Ga0495684_0121849 | Ga0495684_0121849_1181_1609 | 142 |
| 559 | 3300047471 | Ga0495684_0168631 | Ga0495684_0168631_311_739 | 142 |
| 560 | 3300047673 | Ga0495593_0013816 | Ga0495593_0013816_3826_4254 | 142 |
| 561 | 3300048088 | Ga0495602_0000390 | Ga0495602_0000390_36677_37105 | 142 |
| 562 | 3300048088 | Ga0495602_0114839 | Ga0495602_0114839_1538_1966 | 142 |
| 563 | 3300048088 | Ga0495602_0272128 | Ga0495602_0272128_43_471 | 142 |
| 564 | 3300048089 | Ga0495614_0008545 | Ga0495614_0008545_976_1404 | 142 |
| 565 | 3300048089 | Ga0495614_0230228 | Ga0495614_0230228_365_802 | 142 |
| 566 | 3300048091 | Ga0495626_0000118 | Ga0495626_0000118_36021_36461 | 142 |
| 567 | 3300048903 | Ga0496100_0239311 | Ga0496100_0239311_325_753 | 142 |
| 568 | 3300048903 | Ga0496100_1343890 | Ga0496100_1343890_24_458 | 142 |
| 569 | 3300048904 | Ga0496101_0369046 | Ga0496101_0369046_559_999 | 142 |
| 570 | 3300048904 | Ga0496101_0527182 | Ga0496101_0527182_475_909 | 142 |
| 571 | 3300048904 | Ga0496101_0762737 | Ga0496101_0762737_306_749 | 142 |
| 572 | 3300048905 | Ga0496102_0005945 | Ga0496102_0005945_6784_7218 | 142 |
| 573 | 3300048905 | Ga0496102_0019672 | Ga0496102_0019672_439_867 | 142 |
| 574 | 3300048905 | Ga0496102_0217541 | Ga0496102_0217541_334_774 | 142 |
| 575 | 3300048905 | Ga0496102_0548385 | Ga0496102_0548385_503_931 | 142 |
| 576 | 3300048905 | Ga0496102_0879014 | Ga0496102_0879014_376_804 | 142 |
| 577 | 3300048905 | Ga0496102_1377964 | Ga0496102_1377964_27_464 | 142 |
| 578 | 3300048907 | Ga0496104_0105151 | Ga0496104_0105151_1440_1874 | 142 |
| 579 | 3300048907 | Ga0496104_0638732 | Ga0496104_0638732_104_532 | 142 |
| 580 | 3300048907 | Ga0496104_1485425 | Ga0496104_1485425_56_499 | 142 |
| 581 | 3300048908 | Ga0496105_0004687 | Ga0496105_0004687_355_783 | 142 |
| 582 | 3300048908 | Ga0496105_0432779 | Ga0496105_0432779_103_537 | 142 |
| 583 | 3300048909 | Ga0496106_0308531 | Ga0496106_0308531_159_587 | 142 |
| 584 | 3300048910 | Ga0496107_0074401 | Ga0496107_0074401_1337_1765 | 142 |
| 585 | 3300048911 | Ga0496108_0028194 | Ga0496108_0028194_2890_3318 | 142 |
| 586 | 3300048911 | Ga0496108_0030255 | Ga0496108_0030255_1448_1882 | 142 |
| 587 | 3300048911 | Ga0496108_0239073 | Ga0496108_0239073_659_1087 | 142 |
| 588 | 3300048912 | Ga0496109_0011048 | Ga0496109_0011048_6944_7378 | 142 |
| 589 | 3300048912 | Ga0496109_0088322 | Ga0496109_0088322_1027_1455 | 142 |
| 590 | 3300048913 | Ga0496110_0001522 | Ga0496110_0001522_2415_2849 | 142 |
| 591 | 3300048913 | Ga0496110_0933515 | Ga0496110_0933515_164_592 | 142 |
| 592 | 3300048914 | Ga0496111_0001467 | Ga0496111_0001467_9031_9465 | 142 |
| 593 | 3300048914 | Ga0496111_0230491 | Ga0496111_0230491_466_894 | 142 |
| 594 | 3300048915 | Ga0496112_0141119 | Ga0496112_0141119_748_1191 | 142 |
| 595 | 3300048915 | Ga0496112_0200742 | Ga0496112_0200742_1465_1908 | 142 |
| 596 | 3300048915 | Ga0496112_0562749 | Ga0496112_0562749_37_465 | 142 |
| 597 | 3300048916 | Ga0496113_0043573 | Ga0496113_0043573_2064_2492 | 142 |
| 598 | 3300048916 | Ga0496113_0509711 | Ga0496113_0509711_424_852 | 142 |
| 599 | 3300048917 | Ga0496114_0061747 | Ga0496114_0061747_1561_2004 | 142 |
| 600 | 3300048917 | Ga0496114_0074029 | Ga0496114_0074029_1504_1938 | 142 |
| 601 | 3300048917 | Ga0496114_0115938 | Ga0496114_0115938_1775_2215 | 142 |
| 602 | 3300048917 | Ga0496114_0133740 | Ga0496114_0133740_1552_1980 | 142 |
| 603 | 3300048917 | Ga0496114_0756230 | Ga0496114_0756230_213_653 | 142 |
| 604 | 3300048918 | Ga0496115_0123719 | Ga0496115_0123719_681_1109 | 142 |
| 605 | 3300048918 | Ga0496115_0529364 | Ga0496115_0529364_118_546 | 142 |
| 606 | 3300048919 | Ga0496116_0000165 | Ga0496116_0000165_21237_21665 | 142 |
| 607 | 3300048920 | Ga0496117_0004187 | Ga0496117_0004187_12918_13346 | 142 |
| 608 | 3300048920 | Ga0496117_0020011 | Ga0496117_0020011_998_1426 | 142 |
| 609 | 3300048921 | Ga0496118_0008074 | Ga0496118_0008074_2739_3167 | 142 |
| 610 | 3300048921 | Ga0496118_0018480 | Ga0496118_0018480_5778_6206 | 142 |
| 611 | 3300048922 | Ga0496119_0003213 | Ga0496119_0003213_6620_7048 | 142 |
| 612 | 3300048923 | Ga0496120_0057441 | Ga0496120_0057441_842_1270 | 142 |
| 613 | 3300048924 | Ga0496121_0068252 | Ga0496121_0068252_250_678 | 142 |
| 614 | 3300048929 | Ga0496126_0073734 | Ga0496126_0073734_51_479 | 142 |
| 615 | 3300049571 | Ga0501034_1114876 | Ga0501034_1114876_58_486 | 142 |
| 616 | 3300049823 | Ga0501044_0327691 | Ga0501044_0327691_621_1049 | 142 |
| 617 | 3300050490 | nmdc:mga03n38_80747_c1 | nmdc:mga03n38_80747_c1_872_1300 | 142 |
| 618 | 3300050491 | nmdc:mga00v17_166583_c1 | nmdc:mga00v17_166583_c1_548_976 | 142 |
| 619 | 3300050492 | nmdc:mga0yw44_87683_c1 | nmdc:mga0yw44_87683_c1_1036_1464 | 142 |
| 620 | 3300050494 | nmdc:mga06z11_28004_c1 | nmdc:mga06z11_28004_c1_1558_1986 | 142 |
| 621 | 3300050507 | nmdc:mga05p37_1840993_c1 | nmdc:mga05p37_1840993_c1_128_556 | 142 |
| 622 | 3300050507 | nmdc:mga05p37_192167_c1 | nmdc:mga05p37_192167_c1_358_786 | 142 |
| 623 | 3300050507 | nmdc:mga05p37_33850_c1 | nmdc:mga05p37_33850_c1_788_1216 | 142 |
| 624 | 3300050507 | nmdc:mga05p37_396093_c1 | nmdc:mga05p37_396093_c1_551_979 | 142 |
| 625 | 3300050507 | nmdc:mga05p37_7263_c1 | nmdc:mga05p37_7263_c1_11886_12314 | 142 |
| 626 | 3300050508 | nmdc:mga09592_111_c1 | nmdc:mga09592_111_c1_758_1186 | 142 |
| 627 | 3300050508 | nmdc:mga09592_399956_c1 | nmdc:mga09592_399956_c1_91_519 | 142 |
| 628 | 3300050508 | nmdc:mga09592_56070_c1 | nmdc:mga09592_56070_c1_593_1021 | 142 |
| 629 | 3300050509 | nmdc:mga0qj67_1531853_c1 | nmdc:mga0qj67_1531853_c1_46_474 | 142 |
| 630 | 3300050509 | nmdc:mga0qj67_2591_c1 | nmdc:mga0qj67_2591_c1_11758_12186 | 142 |
| 631 | 3300050509 | nmdc:mga0qj67_925_c1 | nmdc:mga0qj67_925_c1_10095_10523 | 142 |
| 632 | 3300050509 | nmdc:mga0qj67_95500_c1 | nmdc:mga0qj67_95500_c1_851_1279 | 142 |
| 633 | 3300050510 | nmdc:mga06r32_3493_c1 | nmdc:mga06r32_3493_c1_758_1186 | 142 |
| 634 | 3300050510 | nmdc:mga06r32_373743_c1 | nmdc:mga06r32_373743_c1_153_581 | 142 |
| 635 | 3300050510 | nmdc:mga06r32_426287_c1 | nmdc:mga06r32_426287_c1_740_1168 | 142 |
| 636 | 3300050510 | nmdc:mga06r32_5589_c1 | nmdc:mga06r32_5589_c1_4198_4626 | 142 |
| 637 | 3300050511 | nmdc:mga08y16_260342_c1 | nmdc:mga08y16_260342_c1_242_670 | 142 |
| 638 | 3300050511 | nmdc:mga08y16_3789_c1 | nmdc:mga08y16_3789_c1_355_783 | 142 |
| 639 | 3300050512 | nmdc:mga0n895_165005_c1 | nmdc:mga0n895_165005_c1_675_1103 | 142 |
| 640 | 3300050512 | nmdc:mga0n895_21202_c1 | nmdc:mga0n895_21202_c1_1513_1941 | 142 |
| 641 | 3300050513 | nmdc:mga0rr50_132590_c1 | nmdc:mga0rr50_132590_c1_935_1363 | 142 |
| 642 | 3300050513 | nmdc:mga0rr50_552618_c1 | nmdc:mga0rr50_552618_c1_366_794 | 142 |
| 643 | 3300050513 | nmdc:mga0rr50_90223_c1 | nmdc:mga0rr50_90223_c1_1139_1567 | 142 |
| 644 | 3300050514 | nmdc:mga08x19_128113_c1 | nmdc:mga08x19_128113_c1_447_875 | 142 |
| 645 | 3300050514 | nmdc:mga08x19_86485_c1 | nmdc:mga08x19_86485_c1_1469_1897 | 142 |
| 646 | 3300050515 | nmdc:mga0a205_305755_c1 | nmdc:mga0a205_305755_c1_651_1079 | 142 |
| 647 | 3300050515 | nmdc:mga0a205_42248_c1 | nmdc:mga0a205_42248_c1_1566_1994 | 142 |
| 648 | 3300050516 | nmdc:mga0sz30_6870_c1 | nmdc:mga0sz30_6870_c1_3491_3919 | 142 |
| 649 | 3300053077 | Ga0495601_0052770 | Ga0495601_0052770_1749_2177 | 142 |
| 650 | 3300053078 | Ga0495612_0056392 | Ga0495612_0056392_183_611 | 142 |
| 651 | 3300053084 | Ga0495595_0003523 | Ga0495595_0003523_3024_3452 | 142 |
| 652 | 3300053084 | Ga0495595_0094614 | Ga0495595_0094614_384_812 | 142 |
| 653 | 3300053085 | Ga0495619_0079069 | Ga0495619_0079069_1272_1700 | 142 |
| 654 | 3300053085 | Ga0495619_0756072 | Ga0495619_0756072_165_596 | 142 |
| 655 | 3300053092 | Ga0500583_0134705 | Ga0500583_0134705_631_1059 | 142 |
| 656 | 3300053153 | Ga0500616_0076858 | Ga0500616_0076858_195_623 | 142 |
| 657 | 3300059492 | Ga0587073_0022333 | Ga0587073_0022333_608_1036 | 142 |
| 658 | 3300059504 | Ga0587082_016845 | Ga0587082_016845_180_608 | 142 |
| 659 | 3300059506 | Ga0587085_020364 | Ga0587085_020364_431_859 | 142 |
| 660 | 3300060344 | Ga0587071_032102 | Ga0587071_032102_397_825 | 142 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5umw-assembly3.cif.gz_D | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.9215 | 1 | 132 |
| 5umw-assembly2.cif.gz_B | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.9181 | 2 | 135 |
| 5umw-assembly2.cif.gz_B | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.9116 | 2 | 135 |
| 6cky-assembly1.cif.gz_B | crystal structure of ucms2 | 0.9113 | 1 | 133 |
| 5umw-assembly3.cif.gz_D | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.9083 | 1 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8955 | 82 | 132 | 3.30.720.110 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8792 | 82 | 132 | 3.30.720.110 |
| 4g6xA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8608 | 4 | 130 | 3.10.180.10 |
| 5uhjB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8587 | 1 | 134 | 3.10.180.10 |
| 2pjsB01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8529 | 82 | 132 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5N6BL37-F1-model_v4 | VOC family protein | 0.9846 | 1 | 142 |
|
| AF-A0A4R1HPW1-F1-model_v4 | Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein | 0.9824 | 24 | 141 |
|
| AF-A0A5N6BL37-F1-model_v4 | VOC family protein | 0.9777 | 1 | 142 |
|
| AF-M3TGK3-F1-model_v4 | VOC domain-containing protein | 0.9765 | 1 | 141 |
|
| AF-A0A2E0RSF9-F1-model_v4 | Glyoxalase | 0.9743 | 1 | 141 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar