F473316

General Info

Members Datasets Scaffolds Average Seq Length
660 346 652 142

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100588136|Ga0070664_1005881362
Length 143
Sequence MIESISLVTVYCLDQSATRDFYVDHLGFEPRVDATMGEFRWVTIAHPSQPELEVTLMLPGPPLAPDAAAFIRSQLESGQMGGLGLRVDDCRKTAADLTKAGVTFIQEPSDRPYGVEAVIRDNTGNWLTLVEPKAFTQEDLKKF

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
3 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
4 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
184 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
185 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
186 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
187 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
188 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
189 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
196 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
197 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
224 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
225 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
226 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
227 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
228 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
229 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
230 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
231 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
232 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
233 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
236 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
237 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
238 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
239 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
240 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
241 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
242 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
258 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
259 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
260 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
277 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
280 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
283 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
292 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
309 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
310 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
311 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
312 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
313 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
319 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
320 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
321 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
331 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
334 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
337 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
344 8002775197 Frankia nepalensis CN7 Isolate Nodule
345 8002784119 Frankia sp. AgB1.9 Isolate Nodule
346 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.97
Metatranscriptomes 1.82
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.12
Nodule 0.45
Rhizoplane 6.67
Rhizosphere 86.52
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10088469 3300002077 Bacteria 568
2 JGI25406J46586_10047135 3300003203 Bacteria 1470
3 JGI25406J46586_10069493 3300003203 Bacteria 1109
4 JGI25406J46586_10114731 3300003203 Bacteria 796
5 Ga0058861_12044538 3300004800 Bacteria 957
6 Ga0070658_10445188 3300005327 Bacteria 1116
7 Ga0070676_10234244 3300005328 Bacteria 1218
8 Ga0070683_100004578 3300005329 Bacteria 11414
9 Ga0070670_100540284 3300005331 Bacteria 1039
10 Ga0068869_100008619 3300005334 Bacteria 6584
11 Ga0070666_10859439 3300005335 Bacteria 670
12 Ga0070680_100104608 3300005336 Bacteria 2352
13 Ga0070682_100022080 3300005337 Bacteria 3765
14 Ga0070682_100045776 3300005337 Bacteria 2713
15 Ga0070682_100290382 3300005337 Bacteria 1196
16 Ga0068868_100008936 3300005338 Bacteria 7188
17 Ga0070660_100151329 3300005339 Bacteria 1866
18 Ga0070660_101163086 3300005339 Bacteria 654
19 Ga0070691_10149956 3300005341 Bacteria 1195
20 Ga0070661_100004316 3300005344 Bacteria 9809
21 Ga0070692_10201040 3300005345 Bacteria 1167
22 Ga0070668_100011862 3300005347 Bacteria 6492
23 Ga0070669_100301732 3300005353 Bacteria 1288
24 Ga0070675_100004936 3300005354 Bacteria 10173
25 Ga0070671_100603280 3300005355 Bacteria 949
26 Ga0070674_100101872 3300005356 Bacteria 2093
27 Ga0070674_100193779 3300005356 Bacteria 1565
28 Ga0070659_100279830 3300005366 Bacteria 1388
29 Ga0070659_100493504 3300005366 Bacteria 1043
30 Ga0070667_100832163 3300005367 Bacteria 858
31 Ga0070667_101401293 3300005367 Bacteria 656
32 Ga0070714_100308157 3300005435 Bacteria 1478
33 Ga0070713_100080884 3300005436 Bacteria 2771
34 Ga0070713_100708539 3300005436 Bacteria 961
35 Ga0070713_100830352 3300005436 Bacteria 887
36 Ga0070710_10486792 3300005437 Bacteria 842
37 Ga0070705_100096038 3300005440 Bacteria 1860
38 Ga0070700_100042312 3300005441 Bacteria 2796
39 Ga0070663_100221661 3300005455 Bacteria 1485
40 Ga0070663_100666638 3300005455 Bacteria 881
41 Ga0070678_100396902 3300005456 Bacteria 1197
42 Ga0070678_100424497 3300005456 Bacteria 1160
43 Ga0070678_100464523 3300005456 Bacteria 1111
44 Ga0070662_100051948 3300005457 Bacteria 2962
45 Ga0070681_10399978 3300005458 Bacteria 1285
46 Ga0070681_10505101 3300005458 Bacteria 1122
47 Ga0070707_100454077 3300005468 Bacteria 1242
48 Ga0070699_100408732 3300005518 Bacteria 1228
49 Ga0070679_100088015 3300005530 Bacteria 3093
50 Ga0070679_100265064 3300005530 Bacteria 1673
51 Ga0070684_100018599 3300005535 Bacteria 5729
52 Ga0070684_100700122 3300005535 Bacteria 944
53 Ga0068853_100285853 3300005539 Bacteria 1521
54 Ga0070672_100501517 3300005543 Bacteria 1050
55 Ga0070672_100584638 3300005543 Bacteria 972
56 Ga0070686_101729858 3300005544 Bacteria 531
57 Ga0070693_100935875 3300005547 Bacteria 652
58 Ga0070665_100383287 3300005548 Bacteria 1413
59 Ga0070665_101405824 3300005548 Bacteria 707
60 Ga0070704_100181627 3300005549 Bacteria 1683
61 Ga0068855_100937246 3300005563 Bacteria 913
62 Ga0070664_100004701 3300005564 Bacteria 10950
63 Ga0070664_100471016 3300005564 Bacteria 1155
64 Ga0070664_100588136 3300005564 Bacteria 1032
65 Ga0070664_101054139 3300005564 Bacteria 765
66 Ga0068857_100372400 3300005577 Bacteria 1325
67 Ga0068857_100474031 3300005577 Bacteria 1172
68 Ga0068857_100946067 3300005577 Bacteria 827
69 Ga0068854_100141147 3300005578 Bacteria 1849
70 Ga0068854_100611415 3300005578 Bacteria 932
71 Ga0068856_100049655 3300005614 Bacteria 4135
72 Ga0068856_100769177 3300005614 Bacteria 983
73 Ga0070702_100019124 3300005615 Bacteria 3565
74 Ga0068852_100217899 3300005616 Bacteria 1814
75 Ga0068852_100312974 3300005616 Bacteria 1523
76 Ga0068859_100000154 3300005617 Bacteria 65719
77 Ga0068859_101339204 3300005617 Bacteria 789
78 Ga0068859_101376898 3300005617 Bacteria 778
79 Ga0068864_100078271 3300005618 Bacteria 2893
80 Ga0068864_100109942 3300005618 Bacteria 2454
81 Ga0068864_100598043 3300005618 Bacteria 1070
82 Ga0068866_10026408 3300005718 Bacteria 2742
83 Ga0068861_100065031 3300005719 Bacteria 2808
84 Ga0068861_100900185 3300005719 Bacteria 838
85 Ga0068861_101807545 3300005719 Bacteria 606
86 Ga0068863_100000396 3300005841 Bacteria 44275
87 Ga0068863_100127105 3300005841 Bacteria 2432
88 Ga0068863_100274438 3300005841 Bacteria 1632
89 Ga0068858_100056743 3300005842 Bacteria 3619
90 Ga0068862_100000021 3300005844 Bacteria 218035
91 Ga0068862_100045409 3300005844 Bacteria 3749
92 Ga0081455_10077476 3300005937 Bacteria 2735
93 Ga0081455_10182503 3300005937 Bacteria 1587
94 Ga0081455_10310483 3300005937 Bacteria 1127
95 Ga0081455_10446366 3300005937 Bacteria 885
96 Ga0081540_1000330 3300005983 Bacteria 49099
97 Ga0081540_1023100 3300005983 Bacteria 3650
98 Ga0081540_1124493 3300005983 Bacteria 1063
99 Ga0081539_10001061 3300005985 Bacteria 50266
100 Ga0081539_10005056 3300005985 Bacteria 13848
101 Ga0081539_10006076 3300005985 Bacteria 11808
102 Ga0081539_10032287 3300005985 Bacteria 3209
103 Ga0075364_10011580 3300006051 Bacteria 5360
104 Ga0075432_10046963 3300006058 Bacteria 1517
105 Ga0075432_10047115 3300006058 Bacteria 1515
106 Ga0070716_100022842 3300006173 Bacteria 3310
107 Ga0070716_100190303 3300006173 Bacteria 1355
108 Ga0075362_10190751 3300006177 Bacteria 995
109 Ga0075367_10046560 3300006178 Bacteria 2548
110 Ga0075369_10005526 3300006186 Bacteria 4730
111 Ga0075369_10008271 3300006186 Bacteria 3999
112 Ga0097621_100233258 3300006237 Bacteria 1607
113 Ga0097621_101176367 3300006237 Unclassified 722
114 Ga0075370_10013519 3300006353 Bacteria 4343
115 Ga0075428_100035067 3300006844 Bacteria 5531
116 Ga0075428_100078598 3300006844 Bacteria 3601
117 Ga0075428_100083061 3300006844 Bacteria 3495
118 Ga0075428_100085371 3300006844 Bacteria 3442
119 Ga0075428_100271714 3300006844 Bacteria 1824
120 Ga0075428_100891308 3300006844 Bacteria 944
121 Ga0075430_100009697 3300006846 Bacteria 8135
122 Ga0075430_100016404 3300006846 Bacteria 6306
123 Ga0075430_100052237 3300006846 Bacteria 3442
124 Ga0075431_100012493 3300006847 Bacteria 8574
125 Ga0075431_100077006 3300006847 Bacteria 3442
126 Ga0075431_100133189 3300006847 Bacteria 2563
127 Ga0075431_100336653 3300006847 Bacteria 1519
128 Ga0075431_100363542 3300006847 Bacteria 1453
129 Ga0075431_100368401 3300006847 Bacteria 1442
130 Ga0075431_101095491 3300006847 Bacteria 761
131 Ga0075433_10031189 3300006852 Bacteria 4555
132 Ga0075433_10226522 3300006852 Bacteria 1660
133 Ga0075433_10524168 3300006852 Bacteria 1042
134 Ga0075434_100112049 3300006871 Bacteria 2739
135 Ga0075434_100900179 3300006871 Bacteria 900
136 Ga0075429_100002650 3300006880 Bacteria 15052
137 Ga0075429_100134249 3300006880 Bacteria 2165
138 Ga0075429_101862067 3300006880 Bacteria 522
139 Ga0075436_100108698 3300006914 Bacteria 1935
140 Ga0097620_100000154 3300006931 Bacteria 65719
141 Ga0097620_101339171 3300006931 Bacteria 789
142 Ga0097620_101376940 3300006931 Bacteria 778
143 Ga0075435_100009714 3300007076 Bacteria 6990
144 Ga0075435_100360398 3300007076 Bacteria 1247
145 Ga0099795_10013838 3300007788 Bacteria 2487
146 Ga0105251_10079911 3300009011 Bacteria 1513
147 Ga0105240_10678583 3300009093 Bacteria 1127
148 Ga0105240_10905943 3300009093 Bacteria 948
149 Ga0111539_10005471 3300009094 Bacteria 16434
150 Ga0111539_10160291 3300009094 Bacteria 2631
151 Ga0105245_10011203 3300009098 Bacteria 7805
152 Ga0105245_10334566 3300009098 Bacteria 1496
153 Ga0105245_10704468 3300009098 Bacteria 1043
154 Ga0105245_10997034 3300009098 Bacteria 882
155 Ga0105245_11633508 3300009098 Bacteria 696
156 Ga0114129_10008762 3300009147 Bacteria 14428
157 Ga0114129_10024008 3300009147 Bacteria 8642
158 Ga0114129_10048939 3300009147 Bacteria 5941
159 Ga0114129_10333117 3300009147 Bacteria 2015
160 Ga0114129_12550797 3300009147 Bacteria 610
161 Ga0105243_10245858 3300009148 Bacteria 1594
162 Ga0105241_11363986 3300009174 Bacteria 677
163 Ga0105242_10892857 3300009176 Bacteria 888
164 Ga0105248_10670783 3300009177 Bacteria 1170
165 Ga0105237_10159322 3300009545 Bacteria 2255
166 Ga0105238_10107956 3300009551 Bacteria 2764
167 Ga0105238_10656712 3300009551 Bacteria 1059
168 Ga0105238_12868467 3300009551 Bacteria 518
169 Ga0105249_10132980 3300009553 Bacteria 2377
170 Ga0105249_11118061 3300009553 Bacteria 858
171 Ga0099796_10028410 3300010159 Bacteria 1795
172 Ga0105239_10316372 3300010375 Bacteria 1760
173 Ga0105239_10342206 3300010375 Bacteria 1688
174 Ga0105239_10403971 3300010375 Bacteria 1546
175 Ga0105246_10137085 3300011119 Bacteria 1836
176 Ga0157373_10705961 3300013100 Bacteria 739
177 Ga0157370_10123002 3300013104 Bacteria 2423
178 Ga0157369_10159646 3300013105 Bacteria 2380
179 Ga0157369_10173836 3300013105 Bacteria 2268
180 Ga0157369_11054083 3300013105 Bacteria 832
181 Ga0157369_11432325 3300013105 Bacteria 703
182 Ga0157378_10847571 3300013297 Bacteria 942
183 Ga0163162_10749041 3300013306 Bacteria 1096
184 Ga0157372_10112402 3300013307 Bacteria 3121
185 Ga0157372_10447402 3300013307 Bacteria 1506
186 Ga0157372_10646185 3300013307 Bacteria 1232
187 Ga0157372_10737959 3300013307 Bacteria 1145
188 Ga0157372_11411198 3300013307 Bacteria 803
189 Ga0163163_10011362 3300014325 Bacteria 8072
190 Ga0163163_10043824 3300014325 Bacteria 4389
191 Ga0163163_10307436 3300014325 Bacteria 1638
192 Ga0157380_10547839 3300014326 Bacteria 1134
193 Ga0157380_10801805 3300014326 Bacteria 959
194 Ga0157377_10011787 3300014745 Bacteria 4373
195 Ga0157379_10261039 3300014968 Bacteria 1574
196 Ga0157376_10203025 3300014969 Bacteria 1825
197 Ga0157376_10361318 3300014969 Bacteria 1393
198 Ga0157376_11809047 3300014969 Bacteria 647
199 Ga0197907_10814455 3300020069 Bacteria 1293
200 Ga0206356_10971613 3300020070 Bacteria 1318
201 Ga0206352_11296872 3300020078 Bacteria 585
202 Ga0206353_10354313 3300020082 Bacteria 3539
203 Ga0206353_11458692 3300020082 Bacteria 1091
204 Ga0213876_10023093 3300021384 Bacteria 3287
205 Ga0213876_10272987 3300021384 Bacteria 899
206 Ga0213875_10002508 3300021388 Bacteria 10966
207 Ga0224712_10009645 3300022467 Bacteria 2919
208 Ga0207692_10090044 3300025898 Bacteria 1662
209 Ga0207688_10047376 3300025901 Bacteria 2400
210 Ga0207647_10104749 3300025904 Bacteria 1676
211 Ga0207685_10031535 3300025905 Bacteria 1899
212 Ga0207699_10002187 3300025906 Bacteria 9228
213 Ga0207645_10228149 3300025907 Bacteria 1229
214 Ga0207705_10548847 3300025909 Bacteria 898
215 Ga0207705_11079394 3300025909 Bacteria 619
216 Ga0207707_10065622 3300025912 Bacteria 3161
217 Ga0207707_11245079 3300025912 Bacteria 600
218 Ga0207693_10009125 3300025915 Bacteria 8096
219 Ga0207663_10002997 3300025916 Bacteria 8177
220 Ga0207660_10124375 3300025917 Bacteria 1957
221 Ga0207657_10104817 3300025919 Bacteria 2342
222 Ga0207657_10158369 3300025919 Bacteria 1840
223 Ga0207649_10373821 3300025920 Bacteria 1061
224 Ga0207652_10054890 3300025921 Bacteria 3426
225 Ga0207646_10554252 3300025922 Bacteria 1033
226 Ga0207681_10347083 3300025923 Bacteria 1187
227 Ga0207694_10590379 3300025924 Bacteria 934
228 Ga0207650_10060418 3300025925 Bacteria 2828
229 Ga0207659_10005349 3300025926 Bacteria 7779
230 Ga0207687_10256625 3300025927 Bacteria 1392
231 Ga0207687_10315134 3300025927 Bacteria 1264
232 Ga0207700_10048206 3300025928 Bacteria 3162
233 Ga0207700_10064425 3300025928 Bacteria 2792
234 Ga0207700_10638585 3300025928 Bacteria 949
235 Ga0207664_10004489 3300025929 Bacteria 9456
236 Ga0207706_10035253 3300025933 Bacteria 4449
237 Ga0207706_10808091 3300025933 Bacteria 796
238 Ga0207686_10492295 3300025934 Bacteria 950
239 Ga0207709_10706310 3300025935 Bacteria 807
240 Ga0207669_10461232 3300025937 Bacteria 1009
241 Ga0207704_10028557 3300025938 Bacteria 3097
242 Ga0207665_10005974 3300025939 Bacteria 8096
243 Ga0207665_10232754 3300025939 Bacteria 1355
244 Ga0207691_10236690 3300025940 Bacteria 1580
245 Ga0207711_10000170 3300025941 Bacteria 70147
246 Ga0207689_10010048 3300025942 Bacteria 8157
247 Ga0207689_10283932 3300025942 Bacteria 1371
248 Ga0207661_10210545 3300025944 Bacteria 1713
249 Ga0207661_10258363 3300025944 Bacteria 1551
250 Ga0207679_10084248 3300025945 Bacteria 2439
251 Ga0207679_10478056 3300025945 Bacteria 1109
252 Ga0207667_10797456 3300025949 Bacteria 941
253 Ga0207651_10780771 3300025960 Bacteria 846
254 Ga0207712_10006290 3300025961 Bacteria 7490
255 Ga0207668_10993487 3300025972 Bacteria 750
256 Ga0207640_10116679 3300025981 Bacteria 1904
257 Ga0207640_11028784 3300025981 Bacteria 726
258 Ga0207658_10935225 3300025986 Unclassified 790
259 Ga0207677_10159836 3300026023 Bacteria 1749
260 Ga0207677_10591689 3300026023 Bacteria 972
261 Ga0207703_10199294 3300026035 Bacteria 1778
262 Ga0207678_10131084 3300026067 Bacteria 2138
263 Ga0207678_10155235 3300026067 Bacteria 1954
264 Ga0207678_10173854 3300026067 Bacteria 1839
265 Ga0207678_10448833 3300026067 Bacteria 1121
266 Ga0207678_10556493 3300026067 Bacteria 1003
267 Ga0207708_10063026 3300026075 Bacteria 2832
268 Ga0207702_10064029 3300026078 Bacteria 3146
269 Ga0207702_10444488 3300026078 Bacteria 1257
270 Ga0207641_10001578 3300026088 Bacteria 22254
271 Ga0207641_10016985 3300026088 Bacteria 5958
272 Ga0207676_10131885 3300026095 Bacteria 2126
273 Ga0207676_10341517 3300026095 Bacteria 1382
274 Ga0207676_10836588 3300026095 Bacteria 900
275 Ga0207674_10089136 3300026116 Bacteria 3077
276 Ga0207674_10173753 3300026116 Bacteria 2107
277 Ga0207674_10242446 3300026116 Bacteria 1750
278 Ga0207674_11321972 3300026116 Bacteria 690
279 Ga0207675_100131943 3300026118 Bacteria 2369
280 Ga0207675_101467661 3300026118 Bacteria 703
281 Ga0207683_10092634 3300026121 Bacteria 2693
282 Ga0207683_10099151 3300026121 Bacteria 2600
283 Ga0207683_10226622 3300026121 Bacteria 1704
284 Ga0207683_10390927 3300026121 Bacteria 1279
285 Ga0207683_10472344 3300026121 Bacteria 1157
286 Ga0207698_10233284 3300026142 Bacteria 1672
287 Ga0207698_10563792 3300026142 Bacteria 1118
288 Ga0207698_10882730 3300026142 Bacteria 901
289 Ga0207428_10118715 3300027907 Bacteria 2030
290 Ga0207428_10131813 3300027907 Bacteria 1912
291 Ga0207428_10506760 3300027907 Bacteria 876
292 Ga0268266_10090969 3300028379 Bacteria 2675
293 Ga0268266_10263142 3300028379 Bacteria 1599
294 Ga0268266_10274499 3300028379 Bacteria 1566
295 Ga0268266_10493173 3300028379 Bacteria 1169
296 Ga0268265_10000034 3300028380 Bacteria 218695
297 Ga0268265_10038881 3300028380 Bacteria 3503
298 Ga0268265_10423605 3300028380 Bacteria 1236
299 Ga0307513_10116141 3300031456 Bacteria 2656
300 Ga0307513_11045858 3300031456 Bacteria 527
301 Ga0307408_100074075 3300031548 Bacteria 2525
302 Ga0307408_100264442 3300031548 Bacteria 1425
303 Ga0307516_10749502 3300031730 Bacteria 636
304 Ga0307405_10741689 3300031731 Bacteria 817
305 Ga0307405_10775215 3300031731 Bacteria 801
306 Ga0307413_10268733 3300031824 Bacteria 1275
307 Ga0307413_10290028 3300031824 Bacteria 1235
308 Ga0307413_10749334 3300031824 Bacteria 816
309 Ga0307410_10105286 3300031852 Bacteria 2030
310 Ga0307410_10263800 3300031852 Bacteria 1344
311 Ga0326468_10000155 3300031889 Bacteria 6672
312 Ga0307406_10052243 3300031901 Bacteria 2599
313 Ga0307406_10089698 3300031901 Bacteria 2066
314 Ga0307406_10226821 3300031901 Bacteria 1392
315 Ga0307406_10498826 3300031901 Unclassified 986
316 Ga0307406_10724836 3300031901 Bacteria 832
317 Ga0307407_10010161 3300031903 Bacteria 4425
318 Ga0307407_10167335 3300031903 Bacteria 1444
319 Ga0307407_10276743 3300031903 Bacteria 1161
320 Ga0307412_11117768 3300031911 Bacteria 702
321 Ga0307409_100008660 3300031995 Bacteria 6190
322 Ga0307409_100015439 3300031995 Bacteria 5014
323 Ga0307409_100071358 3300031995 Bacteria 2761
324 Ga0307409_100313190 3300031995 Bacteria 1465
325 Ga0307409_100330896 3300031995 Bacteria 1429
326 Ga0307409_100955324 3300031995 Bacteria 873
327 Ga0307409_101320740 3300031995 Bacteria 747
328 Ga0307409_102891038 3300031995 Bacteria 507
329 Ga0307416_100012136 3300032002 Bacteria 5787
330 Ga0307416_100029413 3300032002 Bacteria 4104
331 Ga0307416_100037324 3300032002 Bacteria 3737
332 Ga0307416_100161594 3300032002 Bacteria 2071
333 Ga0307416_100194728 3300032002 Bacteria 1916
334 Ga0307416_100748197 3300032002 Bacteria 1070
335 Ga0307416_100899555 3300032002 Bacteria 985
336 Ga0307416_101027727 3300032002 Bacteria 928
337 Ga0307416_102652806 3300032002 Bacteria 598
338 Ga0307414_10186301 3300032004 Bacteria 1675
339 Ga0307414_10422814 3300032004 Bacteria 1162
340 Ga0307411_10261907 3300032005 Bacteria 1366
341 Ga0307411_10272240 3300032005 Bacteria 1343
342 Ga0307411_10399168 3300032005 Bacteria 1136
343 Ga0307411_10823758 3300032005 Bacteria 819
344 Ga0307415_100009799 3300032126 Bacteria 5393
345 Ga0307415_100025362 3300032126 Bacteria 3718
346 Ga0307415_100056096 3300032126 Bacteria 2699
347 Ga0307415_100062817 3300032126 Bacteria 2578
348 Ga0307415_100143005 3300032126 Bacteria 1830
349 Ga0307415_100444423 3300032126 Bacteria 1119
350 Ga0307415_100529325 3300032126 Bacteria 1036
351 Ga0307415_100583751 3300032126 Bacteria 992
352 Ga0307415_100875336 3300032126 Bacteria 826
353 Ga0307415_100985309 3300032126 Bacteria 782
354 Ga0307415_102170123 3300032126 Bacteria 543
355 Ga0307507_10107166 3300033179 Bacteria 2304
356 Ga0373930_0015702 3300034816 Bacteria 1424
357 Ga0373959_0001679 3300034820 Bacteria 3523
358 Ga0373938_0006150 3300034957 Bacteria 2065
359 Ga0373926_0051033 3300035083 Bacteria 1491
360 Ga0373928_0004837 3300035084 Bacteria 2568
361 Ga0373929_0005019 3300035085 Bacteria 2376
362 Ga0373934_0002980 3300035086 Bacteria 6190
363 Ga0373934_0019986 3300035086 Bacteria 2574
364 Ga0373934_0355768 3300035086 Bacteria 610
365 Ga0373940_0001674 3300035088 Bacteria 4092
366 Ga0373949_0004023 3300035090 Bacteria 3409
367 Ga0373951_0000057 3300035091 Bacteria 45426
368 Ga0373951_0078888 3300035091 Bacteria 849
369 Ga0373923_0129605 3300035111 Bacteria 1132
370 Ga0373923_0315700 3300035111 Bacteria 741
371 Ga0373939_0156835 3300035114 Bacteria 833
372 Ga0373941_0277264 3300035115 Bacteria 662
373 Ga0373945_0059236 3300035116 Bacteria 1425
374 Ga0373945_0389381 3300035116 Bacteria 609
375 Ga0373953_0000287 3300035117 Bacteria 13874
376 Ga0373953_0034130 3300035117 Bacteria 1993
377 Ga0373954_0008734 3300035118 Bacteria 4455
378 Ga0373954_0008943 3300035118 Bacteria 4408
379 Ga0373956_0000749 3300035119 Bacteria 13412
380 Ga0373956_0064883 3300035119 Bacteria 1658
381 Ga0373957_0000202 3300035120 Bacteria 15269
382 Ga0373957_0008081 3300035120 Bacteria 3395
383 Ga0373957_0119867 3300035120 Bacteria 1064
384 Ga0373960_0012087 3300035121 Bacteria 2139
385 Ga0373943_0074087 3300035170 Bacteria 1730
386 Ga0373943_0084358 3300035170 Bacteria 1634
387 Ga0373946_0190168 3300035171 Bacteria 978
388 Ga0373946_0681692 3300035171 Bacteria 536
389 Ga0373955_0000190 3300035172 Bacteria 25350
390 Ga0373955_0000949 3300035172 Bacteria 12376
391 Ga0373942_0025100 3300035207 Bacteria 1533
392 Ga0373962_0014259 3300035242 Bacteria 2024
393 Ga0373924_0000299 3300035410 Bacteria 15229
394 Ga0373924_0144848 3300035410 Bacteria 1037
395 Ga0373924_0177314 3300035410 Bacteria 937
396 Ga0373935_0207136 3300035692 Bacteria 1357
397 Ga0373935_0344441 3300035692 Bacteria 1061
398 Ga0373927_0064774 3300035695 Bacteria 2364
399 Ga0373927_0157548 3300035695 Bacteria 1487
400 Ga0373933_0000002 3300035724 Bacteria 151785
401 Ga0373933_0020754 3300035724 Bacteria 3724
402 Ga0373933_0030456 3300035724 Bacteria 3124
403 Ga0373947_0129876 3300035725 Bacteria 1607
404 Ga0373947_0274126 3300035725 Bacteria 1120
405 Ga0373937_0000014 3300036401 Bacteria 151785
406 Ga0373937_0010614 3300036401 Bacteria 8048
407 Ga0373937_0047451 3300036401 Bacteria 3929
408 Ga0373925_0007581 3300037068 Bacteria 7904
409 Ga0373925_0229642 3300037068 Bacteria 1483
410 Ga0373925_0755201 3300037068 Bacteria 802
411 Ga0373925_1076711 3300037068 Bacteria 661
412 Ga0395899_0008140 3300037312 Bacteria 8077
413 Ga0395900_0029876 3300037418 Bacteria 5593
414 Ga0395898_0003035 3300037466 Bacteria 19037
415 Ga0395898_0053104 3300037466 Bacteria 3958
416 Ga0395898_0417280 3300037466 Bacteria 1279
417 Ga0395898_0432312 3300037466 Bacteria 1254
418 Ga0395898_1190348 3300037466 Bacteria 693
419 Ga0395905_0003137 3300037471 Bacteria 17809
420 Ga0395905_0066430 3300037471 Bacteria 3378
421 Ga0395905_1099843 3300037471 Bacteria 698
422 Ga0436364_0847286 3300037853 Bacteria 1034
423 Ga0436364_0923522 3300037853 Bacteria 137390
424 Ga0436364_1394990 3300037853 Bacteria 3996
425 Ga0395901_0013845 3300038443 Bacteria 8205
426 Ga0395901_0023594 3300038443 Bacteria 6307
427 Ga0242420_035936 3300038996 Bacteria 934
428 Ga0436365_1135090 3300039437 Bacteria 5167
429 Ga0436365_1929710 3300039437 Unclassified 2678
430 Ga0439461_0001522 3300041410 Bacteria 3591
431 Ga0439466_0004315 3300041411 Bacteria 5488
432 Ga0439466_0004664 3300041411 Bacteria 5265
433 Ga0439465_0000501 3300041413 Bacteria 11678
434 Ga0439465_0003422 3300041413 Bacteria 5175
435 Ga0451789_0318381 3300041443 Bacteria 2934
436 Ga0451797_1028095 3300041453 Bacteria 2826
437 Ga0451795_0617988 3300041456 Bacteria 2422
438 Ga0451800_0925617 3300041459 Bacteria 2819
439 Ga0451807_0590601 3300041486 Bacteria 1625
440 Ga0451837_0856061 3300041494 Bacteria 900
441 Ga0451839_1323259 3300041496 Bacteria 1779
442 Ga0451849_0436125 3300041505 Bacteria 694
443 Ga0451853_1902101 3300041512 Bacteria 1566
444 Ga0451853_3855507 3300041512 Bacteria 548
445 Ga0439442_016837 3300042002 Bacteria 1508
446 Ga0439445_0008773 3300042004 Bacteria 2372
447 Ga0450900_034202 3300042136 Bacteria 746
448 Ga0450905_035629 3300042142 Bacteria 779
449 Ga0439434_0024650 3300042435 Bacteria 1815
450 Ga0439460_0096003 3300042461 Bacteria 947
451 Ga0466972_0016477 3300044658 Bacteria 3697
452 Ga0466960_0104052 3300044901 Bacteria 1466
453 Ga0466960_0383520 3300044901 Bacteria 807
454 Ga0466960_1025719 3300044901 Bacteria 508
455 Ga0466967_0135769 3300045976 Bacteria 2287
456 Ga0466967_0138658 3300045976 Bacteria 2264
457 Ga0466967_0197043 3300045976 Bacteria 1906
458 Ga0495592_0000133 3300046454 Bacteria 66075
459 Ga0495592_0053180 3300046454 Bacteria 3004
460 Ga0495603_0097511 3300046455 Bacteria 1717
461 Ga0495629_0033812 3300046459 Bacteria 3615
462 Ga0495629_0162594 3300046459 Bacteria 1550
463 Ga0495629_0566635 3300046459 Bacteria 761
464 Ga0495651_0000019 3300046462 Bacteria 120970
465 Ga0495651_0121564 3300046462 Bacteria 1917
466 Ga0495651_0245518 3300046462 Bacteria 1225
467 Ga0495651_0832100 3300046462 Bacteria 568
468 Ga0495653_0000763 3300046463 Bacteria 24698
469 Ga0495653_0075842 3300046463 Bacteria 2501
470 Ga0495653_0141416 3300046463 Bacteria 1692
471 Ga0495653_0652885 3300046463 Bacteria 642
472 Ga0495580_0085117 3300046472 Bacteria 2202
473 Ga0495582_0045125 3300046473 Bacteria 2427
474 Ga0495582_0166673 3300046473 Bacteria 1254
475 Ga0495639_0083470 3300046475 Bacteria 1490
476 Ga0495639_0153548 3300046475 Bacteria 1111
477 Ga0495639_0249224 3300046475 Bacteria 878
478 Ga0495639_0606976 3300046475 Bacteria 563
479 Ga0495662_0026275 3300046476 Bacteria 2812
480 Ga0495662_0302037 3300046476 Bacteria 787
481 Ga0495664_0004853 3300046477 Bacteria 7353
482 Ga0495664_0222941 3300046477 Bacteria 1141
483 Ga0495594_0152100 3300046499 Bacteria 1314
484 Ga0495594_0220935 3300046499 Bacteria 1080
485 Ga0495606_0000540 3300046507 Bacteria 60764
486 Ga0495608_0000028 3300046511 Bacteria 151829
487 Ga0495608_0012844 3300046511 Bacteria 5810
488 Ga0495608_0350330 3300046511 Bacteria 909
489 Ga0495618_0046453 3300046514 Bacteria 2740
490 Ga0495618_0211842 3300046514 Bacteria 1224
491 Ga0495628_0000371 3300046516 Bacteria 41228
492 Ga0495630_0476805 3300046517 Bacteria 956
493 Ga0495630_0933343 3300046517 Bacteria 660
494 Ga0495666_0040822 3300046526 Bacteria 2249
495 Ga0495652_0000031 3300046529 Bacteria 151765
496 Ga0495652_0019012 3300046529 Bacteria 6121
497 Ga0495665_0114177 3300046531 Bacteria 1415
498 Ga0495665_0310803 3300046531 Bacteria 806
499 Ga0495665_0333538 3300046531 Bacteria 774
500 Ga0495640_0044467 3300046533 Bacteria 3087
501 Ga0495640_0097108 3300046533 Bacteria 1938
502 Ga0495586_0138003 3300046535 Bacteria 1367
503 Ga0495587_0000023 3300046536 Bacteria 151763
504 Ga0495587_0033842 3300046536 Bacteria 3083
505 Ga0495645_0039761 3300046543 Bacteria 3429
506 Ga0495645_0076335 3300046543 Bacteria 2411
507 Ga0495645_0361009 3300046543 Bacteria 934
508 Ga0495645_0383687 3300046543 Bacteria 898
509 Ga0495667_0000054 3300046559 Bacteria 105009
510 Ga0495667_0013775 3300046559 Bacteria 5461
511 Ga0495668_0000362 3300046616 Bacteria 60088
512 Ga0495634_0017630 3300046642 Bacteria 5093
513 Ga0495634_0021812 3300046642 Bacteria 4520
514 Ga0495625_0001125 3300046660 Bacteria 34598
515 Ga0495635_0150846 3300046663 Bacteria 1582
516 Ga0495588_0134247 3300046674 Bacteria 1306
517 Ga0495657_0000022 3300046675 Bacteria 151837
518 Ga0495657_0026800 3300046675 Bacteria 4077
519 Ga0495599_0000700 3300046678 Bacteria 18940
520 Ga0495599_0039315 3300046678 Bacteria 2972
521 Ga0495599_0244098 3300046678 Bacteria 1094
522 Ga0495623_0000416 3300046679 Bacteria 28025
523 Ga0495623_0014675 3300046679 Bacteria 5067
524 Ga0495623_0039229 3300046679 Bacteria 3027
525 Ga0495646_0082566 3300046680 Bacteria 1869
526 Ga0495647_0031756 3300046681 Bacteria 1965
527 Ga0495647_0406933 3300046681 Bacteria 625
528 Ga0495658_0059288 3300046683 Bacteria 2191
529 Ga0495624_0115440 3300046690 Bacteria 1650
530 Ga0495624_0137278 3300046690 Bacteria 1498
531 Ga0495649_0256636 3300046694 Bacteria 897
532 Ga0495600_0006882 3300046809 Bacteria 6935
533 Ga0495600_0033354 3300046809 Bacteria 3342
534 Ga0495600_0531159 3300046809 Bacteria 720
535 Ga0495581_0020178 3300047315 Bacteria 3869
536 Ga0495581_0179609 3300047315 Bacteria 1237
537 Ga0495604_0000022 3300047317 Bacteria 151744
538 Ga0495604_0019904 3300047317 Bacteria 5367
539 Ga0495604_0126603 3300047317 Bacteria 1841
540 Ga0495674_0534500 3300047319 Bacteria 935
541 Ga0495674_0736390 3300047319 Bacteria 771
542 Ga0495676_0179158 3300047321 Bacteria 1486
543 Ga0495680_0000271 3300047322 Bacteria 57595
544 Ga0495680_0048669 3300047322 Bacteria 3327
545 Ga0495675_0025084 3300047444 Bacteria 3802
546 Ga0495675_0039659 3300047444 Bacteria 2999
547 Ga0495675_0177759 3300047444 Bacteria 1304
548 Ga0495684_0121849 3300047471 Bacteria 1963
549 Ga0495684_0168631 3300047471 Bacteria 1629
550 Ga0495593_0013816 3300047673 Bacteria 4599
551 Ga0495602_0000390 3300048088 Bacteria 41015
552 Ga0495602_0114839 3300048088 Bacteria 2179
553 Ga0495602_0272128 3300048088 Bacteria 1251
554 Ga0495614_0008545 3300048089 Bacteria 4551
555 Ga0495614_0230228 3300048089 Bacteria 844
556 Ga0495626_0000118 3300048091 Bacteria 103373
557 Ga0496100_0239311 3300048903 Bacteria 1338
558 Ga0496100_1343890 3300048903 Bacteria 564
559 Ga0496101_0369046 3300048904 Bacteria 1129
560 Ga0496101_0527182 3300048904 Bacteria 934
561 Ga0496101_0762737 3300048904 Bacteria 763
562 Ga0496102_0005945 3300048905 Bacteria 10390
563 Ga0496102_0019672 3300048905 Bacteria 5949
564 Ga0496102_0217541 3300048905 Bacteria 1801
565 Ga0496102_0548385 3300048905 Bacteria 1079
566 Ga0496102_0879014 3300048905 Bacteria 818
567 Ga0496102_1377964 3300048905 Bacteria 624
568 Ga0496104_0105151 3300048907 Bacteria 2705
569 Ga0496104_0638732 3300048907 Bacteria 973
570 Ga0496104_1485425 3300048907 Bacteria 581
571 Ga0496105_0004687 3300048908 Bacteria 10307
572 Ga0496105_0432779 3300048908 Bacteria 1040
573 Ga0496106_0308531 3300048909 Bacteria 1269
574 Ga0496107_0074401 3300048910 Bacteria 2471
575 Ga0496108_0028194 3300048911 Bacteria 4645
576 Ga0496108_0030255 3300048911 Bacteria 4487
577 Ga0496108_0239073 3300048911 Bacteria 1580
578 Ga0496109_0011048 3300048912 Bacteria 7741
579 Ga0496109_0088322 3300048912 Bacteria 2865
580 Ga0496110_0001522 3300048913 Bacteria 16827
581 Ga0496110_0933515 3300048913 Bacteria 774
582 Ga0496111_0001467 3300048914 Bacteria 13490
583 Ga0496111_0230491 3300048914 Bacteria 1376
584 Ga0496112_0141119 3300048915 Bacteria 2378
585 Ga0496112_0200742 3300048915 Bacteria 1953
586 Ga0496112_0562749 3300048915 Bacteria 1073
587 Ga0496113_0043573 3300048916 Bacteria 3321
588 Ga0496113_0509711 3300048916 Bacteria 966
589 Ga0496114_0061747 3300048917 Bacteria 3135
590 Ga0496114_0074029 3300048917 Bacteria 2867
591 Ga0496114_0115938 3300048917 Bacteria 2299
592 Ga0496114_0133740 3300048917 Bacteria 2143
593 Ga0496114_0756230 3300048917 Bacteria 849
594 Ga0496115_0123719 3300048918 Bacteria 2129
595 Ga0496115_0529364 3300048918 Bacteria 944
596 Ga0496116_0000165 3300048919 Bacteria 133688
597 Ga0496117_0004187 3300048920 Bacteria 16111
598 Ga0496117_0020011 3300048920 Bacteria 5474
599 Ga0496118_0008074 3300048921 Bacteria 10977
600 Ga0496118_0018480 3300048921 Bacteria 6288
601 Ga0496119_0003213 3300048922 Bacteria 17095
602 Ga0496120_0057441 3300048923 Bacteria 2190
603 Ga0496121_0068252 3300048924 Bacteria 2877
604 Ga0496126_0073734 3300048929 Bacteria 3033
605 Ga0501317_081527 3300049533 Bacteria 560
606 Ga0501034_1114876 3300049571 Bacteria 670
607 Ga0501044_0327691 3300049823 Bacteria 1455
608 nmdc:mga03n38_80747_c1 3300050490 Bacteria 1528
609 nmdc:mga00v17_166583_c1 3300050491 Bacteria 1420
610 nmdc:mga0yw44_87683_c1 3300050492 Bacteria 1962
611 nmdc:mga06z11_28004_c1 3300050494 Bacteria 2699
612 nmdc:mga05p37_1840993_c1 3300050507 Bacteria 582
613 nmdc:mga05p37_192167_c1 3300050507 Bacteria 2477
614 nmdc:mga05p37_33850_c1 3300050507 Bacteria 6259
615 nmdc:mga05p37_396093_c1 3300050507 Bacteria 1613
616 nmdc:mga05p37_7263_c1 3300050507 Bacteria 13071
617 nmdc:mga09592_111_c1 3300050508 Bacteria 51033
618 nmdc:mga09592_399956_c1 3300050508 Bacteria 1187
619 nmdc:mga09592_56070_c1 3300050508 Bacteria 3330
620 nmdc:mga0qj67_1531853_c1 3300050509 Bacteria 512
621 nmdc:mga0qj67_2591_c1 3300050509 Bacteria 12943
622 nmdc:mga0qj67_925_c1 3300050509 Bacteria 20198
623 nmdc:mga0qj67_95500_c1 3300050509 Bacteria 2393
624 nmdc:mga06r32_3493_c1 3300050510 Bacteria 14021
625 nmdc:mga06r32_373743_c1 3300050510 Bacteria 1408
626 nmdc:mga06r32_426287_c1 3300050510 Bacteria 1308
627 nmdc:mga06r32_5589_c1 3300050510 Bacteria 11312
628 nmdc:mga08y16_260342_c1 3300050511 Bacteria 1791
629 nmdc:mga08y16_3789_c1 3300050511 Bacteria 15747
630 nmdc:mga0n895_165005_c1 3300050512 Bacteria 2247
631 nmdc:mga0n895_21202_c1 3300050512 Bacteria 6071
632 nmdc:mga0rr50_132590_c1 3300050513 Bacteria 1997
633 nmdc:mga0rr50_552618_c1 3300050513 Bacteria 980
634 nmdc:mga0rr50_90223_c1 3300050513 Bacteria 2385
635 nmdc:mga08x19_128113_c1 3300050514 Bacteria 1706
636 nmdc:mga08x19_86485_c1 3300050514 Bacteria 2064
637 nmdc:mga0a205_305755_c1 3300050515 Bacteria 1463
638 nmdc:mga0a205_42248_c1 3300050515 Bacteria 4392
639 nmdc:mga0sz30_6870_c1 3300050516 Bacteria 4249
640 Ga0495601_0052770 3300053077 Bacteria 2568
641 Ga0495612_0056392 3300053078 Bacteria 1621
642 Ga0495595_0003523 3300053084 Bacteria 6212
643 Ga0495595_0094614 3300053084 Bacteria 1436
644 Ga0495619_0079069 3300053085 Bacteria 2211
645 Ga0495619_0756072 3300053085 Bacteria 659
646 Ga0500646_0065399 3300053090 Bacteria 1080
647 Ga0500583_0134705 3300053092 Bacteria 1226
648 Ga0500616_0076858 3300053153 Bacteria 1687
649 Ga0587073_0022333 3300059492 Bacteria 1227
650 Ga0587082_016845 3300059504 Bacteria 1145
651 Ga0587085_020364 3300059506 Bacteria 1002
652 Ga0587071_032102 3300060344 Bacteria 1016

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041512 Ga0451853_3855507 Ga0451853_3855507_14_421 134
2 3300013105 Ga0157369_11054083 Ga0157369_110540832 135
3 3300046499 Ga0495594_0152100 Ga0495594_0152100_289_699 135
4 3300005436 Ga0070713_100830352 Ga0070713_1008303522 136
5 3300005437 Ga0070710_10486792 Ga0070710_104867922 136
6 3300037418 Ga0395900_0029876 Ga0395900_0029876_3676_4086 136
7 3300037466 Ga0395898_0003035 Ga0395898_0003035_7969_8379 136
8 3300037471 Ga0395905_0003137 Ga0395905_0003137_12636_13046 136
9 3300046475 Ga0495639_0606976 Ga0495639_0606976_14_439 136
10 3300005347 Ga0070668_100011862 Ga0070668_1000118627 138
11 3300005617 Ga0068859_101339204 Ga0068859_1013392042 138
12 3300005719 Ga0068861_100065031 Ga0068861_1000650312 138
13 3300006931 Ga0097620_101339171 Ga0097620_1013391712 138
14 3300026118 Ga0207675_100131943 Ga0207675_1001319432 138
15 3300028380 Ga0268265_10423605 Ga0268265_104236051 138
16 iso_pu_bacteria 2508501039 2508678318 138
17 iso_pu_bacteria 2684623035 2686539172 138
18 iso_pu_bacteria 2887478801 2887481649 138
19 iso_pu_bacteria 2895880812 2895890839 138
20 iso_pu_bacteria 8001781756 8001789108 138
21 iso_pu_bacteria 8002775197 8002781693 138
22 iso_pu_bacteria 8002784119 8002788693 138
23 iso_pu_bacteria 8055172936 8055173895 138
24 3300032126 Ga0307415_100875336 Ga0307415_1008753362 139
25 3300042461 Ga0439460_0096003 Ga0439460_0096003_183_608 139
26 3300003203 JGI25406J46586_10069493 JGI25406J46586_100694932 140
27 3300005985 Ga0081539_10005056 Ga0081539_1000505618 140
28 3300003203 JGI25406J46586_10047135 JGI25406J46586_100471352 141
29 3300005564 Ga0070664_100588136 Ga0070664_1005881362 141
30 3300005983 Ga0081540_1023100 Ga0081540_10231006 141
31 3300005985 Ga0081539_10001061 Ga0081539_1000106137 141
32 3300005985 Ga0081539_10032287 Ga0081539_100322872 141
33 3300013105 Ga0157369_11432325 Ga0157369_114323251 141
34 3300025944 Ga0207661_10258363 Ga0207661_102583633 141
35 3300026067 Ga0207678_10556493 Ga0207678_105564931 141
36 3300028379 Ga0268266_10493173 Ga0268266_104931732 141
37 3300031730 Ga0307516_10749502 Ga0307516_107495022 141
38 3300031731 Ga0307405_10741689 Ga0307405_107416892 141
39 3300031824 Ga0307413_10749334 Ga0307413_107493341 141
40 3300031852 Ga0307410_10263800 Ga0307410_102638003 141
41 3300031889 Ga0326468_10000155 Ga0326468_1000015510 141
42 3300031901 Ga0307406_10089698 Ga0307406_100896983 141
43 3300031901 Ga0307406_10226821 Ga0307406_102268212 141
44 3300031901 Ga0307406_10724836 Ga0307406_107248361 141
45 3300031903 Ga0307407_10010161 Ga0307407_100101616 141
46 3300031911 Ga0307412_11117768 Ga0307412_111177681 141
47 3300031995 Ga0307409_100015439 Ga0307409_1000154396 141
48 3300031995 Ga0307409_100330896 Ga0307409_1003308962 141
49 3300032002 Ga0307416_100029413 Ga0307416_1000294135 141
50 3300032002 Ga0307416_100194728 Ga0307416_1001947283 141
51 3300032004 Ga0307414_10186301 Ga0307414_101863012 141
52 3300032005 Ga0307411_10399168 Ga0307411_103991683 141
53 3300032005 Ga0307411_10823758 Ga0307411_108237581 141
54 3300032126 Ga0307415_100025362 Ga0307415_1000253626 141
55 3300032126 Ga0307415_100985309 Ga0307415_1009853092 141
56 3300033179 Ga0307507_10107166 Ga0307507_101071663 141
57 3300037466 Ga0395898_0053104 Ga0395898_0053104_1324_1749 141
58 3300037471 Ga0395905_0066430 Ga0395905_0066430_2563_2988 141
59 3300037853 Ga0436364_0847286 Ga0436364_0847286_564_995 141
60 3300038443 Ga0395901_0023594 Ga0395901_0023594_4001_4426 141
61 3300042136 Ga0450900_034202 Ga0450900_034202_276_701 141
62 3300042142 Ga0450905_035629 Ga0450905_035629_53_478 141
63 3300045976 Ga0466967_0197043 Ga0466967_0197043_112_546 141
64 3300049533 Ga0501317_081527 Ga0501317_081527_80_505 141
65 3300053090 Ga0500646_0065399 Ga0500646_0065399_410_841 141
66 3300002077 JGI24744J21845_10088469 JGI24744J21845_100884691 142
67 3300003203 JGI25406J46586_10114731 JGI25406J46586_101147312 142
68 3300004800 Ga0058861_12044538 Ga0058861_120445382 142
69 3300005327 Ga0070658_10445188 Ga0070658_104451882 142
70 3300005328 Ga0070676_10234244 Ga0070676_102342442 142
71 3300005329 Ga0070683_100004578 Ga0070683_1000045784 142
72 3300005331 Ga0070670_100540284 Ga0070670_1005402841 142
73 3300005334 Ga0068869_100008619 Ga0068869_1000086191 142
74 3300005335 Ga0070666_10859439 Ga0070666_108594391 142
75 3300005336 Ga0070680_100104608 Ga0070680_1001046082 142
76 3300005337 Ga0070682_100022080 Ga0070682_1000220804 142
77 3300005337 Ga0070682_100045776 Ga0070682_1000457763 142
78 3300005337 Ga0070682_100290382 Ga0070682_1002903821 142
79 3300005338 Ga0068868_100008936 Ga0068868_1000089364 142
80 3300005339 Ga0070660_100151329 Ga0070660_1001513292 142
81 3300005339 Ga0070660_101163086 Ga0070660_1011630861 142
82 3300005341 Ga0070691_10149956 Ga0070691_101499561 142
83 3300005344 Ga0070661_100004316 Ga0070661_1000043167 142
84 3300005345 Ga0070692_10201040 Ga0070692_102010402 142
85 3300005353 Ga0070669_100301732 Ga0070669_1003017322 142
86 3300005354 Ga0070675_100004936 Ga0070675_1000049363 142
87 3300005355 Ga0070671_100603280 Ga0070671_1006032802 142
88 3300005356 Ga0070674_100101872 Ga0070674_1001018722 142
89 3300005356 Ga0070674_100193779 Ga0070674_1001937792 142
90 3300005366 Ga0070659_100279830 Ga0070659_1002798302 142
91 3300005366 Ga0070659_100493504 Ga0070659_1004935042 142
92 3300005367 Ga0070667_100832163 Ga0070667_1008321632 142
93 3300005367 Ga0070667_101401293 Ga0070667_1014012931 142
94 3300005435 Ga0070714_100308157 Ga0070714_1003081572 142
95 3300005436 Ga0070713_100080884 Ga0070713_1000808842 142
96 3300005436 Ga0070713_100708539 Ga0070713_1007085392 142
97 3300005440 Ga0070705_100096038 Ga0070705_1000960382 142
98 3300005441 Ga0070700_100042312 Ga0070700_1000423122 142
99 3300005455 Ga0070663_100221661 Ga0070663_1002216612 142
100 3300005455 Ga0070663_100666638 Ga0070663_1006666381 142
101 3300005456 Ga0070678_100396902 Ga0070678_1003969022 142
102 3300005456 Ga0070678_100424497 Ga0070678_1004244972 142
103 3300005456 Ga0070678_100464523 Ga0070678_1004645232 142
104 3300005457 Ga0070662_100051948 Ga0070662_1000519482 142
105 3300005458 Ga0070681_10399978 Ga0070681_103999782 142
106 3300005458 Ga0070681_10505101 Ga0070681_105051011 142
107 3300005468 Ga0070707_100454077 Ga0070707_1004540772 142
108 3300005518 Ga0070699_100408732 Ga0070699_1004087322 142
109 3300005530 Ga0070679_100088015 Ga0070679_1000880153 142
110 3300005530 Ga0070679_100265064 Ga0070679_1002650642 142
111 3300005535 Ga0070684_100018599 Ga0070684_1000185995 142
112 3300005535 Ga0070684_100700122 Ga0070684_1007001221 142
113 3300005539 Ga0068853_100285853 Ga0068853_1002858532 142
114 3300005543 Ga0070672_100501517 Ga0070672_1005015172 142
115 3300005543 Ga0070672_100584638 Ga0070672_1005846382 142
116 3300005544 Ga0070686_101729858 Ga0070686_1017298581 142
117 3300005547 Ga0070693_100935875 Ga0070693_1009358751 142
118 3300005548 Ga0070665_100383287 Ga0070665_1003832872 142
119 3300005548 Ga0070665_101405824 Ga0070665_1014058242 142
120 3300005549 Ga0070704_100181627 Ga0070704_1001816272 142
121 3300005563 Ga0068855_100937246 Ga0068855_1009372462 142
122 3300005564 Ga0070664_100004701 Ga0070664_10000470110 142
123 3300005564 Ga0070664_100471016 Ga0070664_1004710162 142
124 3300005564 Ga0070664_101054139 Ga0070664_1010541392 142
125 3300005577 Ga0068857_100372400 Ga0068857_1003724002 142
126 3300005577 Ga0068857_100474031 Ga0068857_1004740311 142
127 3300005577 Ga0068857_100946067 Ga0068857_1009460671 142
128 3300005578 Ga0068854_100141147 Ga0068854_1001411472 142
129 3300005578 Ga0068854_100611415 Ga0068854_1006114152 142
130 3300005614 Ga0068856_100049655 Ga0068856_1000496552 142
131 3300005614 Ga0068856_100769177 Ga0068856_1007691772 142
132 3300005615 Ga0070702_100019124 Ga0070702_1000191241 142
133 3300005616 Ga0068852_100217899 Ga0068852_1002178992 142
134 3300005616 Ga0068852_100312974 Ga0068852_1003129743 142
135 3300005617 Ga0068859_100000154 Ga0068859_10000015452 142
136 3300005617 Ga0068859_101376898 Ga0068859_1013768982 142
137 3300005618 Ga0068864_100078271 Ga0068864_1000782713 142
138 3300005618 Ga0068864_100109942 Ga0068864_1001099422 142
139 3300005618 Ga0068864_100598043 Ga0068864_1005980432 142
140 3300005718 Ga0068866_10026408 Ga0068866_100264082 142
141 3300005719 Ga0068861_100900185 Ga0068861_1009001852 142
142 3300005719 Ga0068861_101807545 Ga0068861_1018075452 142
143 3300005841 Ga0068863_100000396 Ga0068863_10000039616 142
144 3300005841 Ga0068863_100127105 Ga0068863_1001271052 142
145 3300005841 Ga0068863_100274438 Ga0068863_1002744382 142
146 3300005842 Ga0068858_100056743 Ga0068858_1000567434 142
147 3300005844 Ga0068862_100000021 Ga0068862_10000002193 142
148 3300005844 Ga0068862_100045409 Ga0068862_1000454093 142
149 3300005937 Ga0081455_10077476 Ga0081455_100774762 142
150 3300005937 Ga0081455_10182503 Ga0081455_101825032 142
151 3300005937 Ga0081455_10310483 Ga0081455_103104832 142
152 3300005937 Ga0081455_10446366 Ga0081455_104463662 142
153 3300005983 Ga0081540_1000330 Ga0081540_100033037 142
154 3300005983 Ga0081540_1124493 Ga0081540_11244932 142
155 3300005985 Ga0081539_10006076 Ga0081539_100060764 142
156 3300006051 Ga0075364_10011580 Ga0075364_100115803 142
157 3300006058 Ga0075432_10046963 Ga0075432_100469631 142
158 3300006058 Ga0075432_10047115 Ga0075432_100471151 142
159 3300006173 Ga0070716_100022842 Ga0070716_1000228425 142
160 3300006173 Ga0070716_100190303 Ga0070716_1001903032 142
161 3300006177 Ga0075362_10190751 Ga0075362_101907511 142
162 3300006178 Ga0075367_10046560 Ga0075367_100465603 142
163 3300006186 Ga0075369_10005526 Ga0075369_100055264 142
164 3300006186 Ga0075369_10008271 Ga0075369_100082714 142
165 3300006237 Ga0097621_100233258 Ga0097621_1002332582 142
166 3300006237 Ga0097621_101176367 Ga0097621_1011763672 142
167 3300006353 Ga0075370_10013519 Ga0075370_100135194 142
168 3300006844 Ga0075428_100035067 Ga0075428_1000350673 142
169 3300006844 Ga0075428_100078598 Ga0075428_1000785982 142
170 3300006844 Ga0075428_100083061 Ga0075428_1000830612 142
171 3300006844 Ga0075428_100085371 Ga0075428_1000853712 142
172 3300006844 Ga0075428_100271714 Ga0075428_1002717143 142
173 3300006844 Ga0075428_100891308 Ga0075428_1008913082 142
174 3300006846 Ga0075430_100009697 Ga0075430_1000096973 142
175 3300006846 Ga0075430_100016404 Ga0075430_1000164046 142
176 3300006846 Ga0075430_100052237 Ga0075430_1000522373 142
177 3300006847 Ga0075431_100012493 Ga0075431_1000124935 142
178 3300006847 Ga0075431_100077006 Ga0075431_1000770062 142
179 3300006847 Ga0075431_100133189 Ga0075431_1001331892 142
180 3300006847 Ga0075431_100336653 Ga0075431_1003366533 142
181 3300006847 Ga0075431_100363542 Ga0075431_1003635422 142
182 3300006847 Ga0075431_100368401 Ga0075431_1003684012 142
183 3300006847 Ga0075431_101095491 Ga0075431_1010954912 142
184 3300006852 Ga0075433_10031189 Ga0075433_100311893 142
185 3300006852 Ga0075433_10226522 Ga0075433_102265222 142
186 3300006852 Ga0075433_10524168 Ga0075433_105241682 142
187 3300006871 Ga0075434_100112049 Ga0075434_1001120492 142
188 3300006871 Ga0075434_100900179 Ga0075434_1009001792 142
189 3300006880 Ga0075429_100002650 Ga0075429_10000265011 142
190 3300006880 Ga0075429_100134249 Ga0075429_1001342492 142
191 3300006880 Ga0075429_101862067 Ga0075429_1018620671 142
192 3300006914 Ga0075436_100108698 Ga0075436_1001086982 142
193 3300006931 Ga0097620_100000154 Ga0097620_10000015412 142
194 3300006931 Ga0097620_101376940 Ga0097620_1013769402 142
195 3300007076 Ga0075435_100009714 Ga0075435_1000097145 142
196 3300007076 Ga0075435_100360398 Ga0075435_1003603982 142
197 3300007788 Ga0099795_10013838 Ga0099795_100138381 142
198 3300009011 Ga0105251_10079911 Ga0105251_100799113 142
199 3300009093 Ga0105240_10678583 Ga0105240_106785832 142
200 3300009093 Ga0105240_10905943 Ga0105240_109059432 142
201 3300009094 Ga0111539_10005471 Ga0111539_1000547110 142
202 3300009094 Ga0111539_10160291 Ga0111539_101602914 142
203 3300009098 Ga0105245_10011203 Ga0105245_100112039 142
204 3300009098 Ga0105245_10334566 Ga0105245_103345662 142
205 3300009098 Ga0105245_10704468 Ga0105245_107044682 142
206 3300009098 Ga0105245_10997034 Ga0105245_109970342 142
207 3300009098 Ga0105245_11633508 Ga0105245_116335081 142
208 3300009147 Ga0114129_10008762 Ga0114129_100087622 142
209 3300009147 Ga0114129_10024008 Ga0114129_100240085 142
210 3300009147 Ga0114129_10048939 Ga0114129_100489395 142
211 3300009147 Ga0114129_10333117 Ga0114129_103331173 142
212 3300009147 Ga0114129_12550797 Ga0114129_125507971 142
213 3300009148 Ga0105243_10245858 Ga0105243_102458582 142
214 3300009174 Ga0105241_11363986 Ga0105241_113639861 142
215 3300009176 Ga0105242_10892857 Ga0105242_108928572 142
216 3300009177 Ga0105248_10670783 Ga0105248_106707831 142
217 3300009545 Ga0105237_10159322 Ga0105237_101593223 142
218 3300009551 Ga0105238_10107956 Ga0105238_101079562 142
219 3300009551 Ga0105238_10656712 Ga0105238_106567122 142
220 3300009551 Ga0105238_12868467 Ga0105238_128684671 142
221 3300009553 Ga0105249_10132980 Ga0105249_101329802 142
222 3300009553 Ga0105249_11118061 Ga0105249_111180612 142
223 3300010159 Ga0099796_10028410 Ga0099796_100284103 142
224 3300010375 Ga0105239_10316372 Ga0105239_103163723 142
225 3300010375 Ga0105239_10342206 Ga0105239_103422062 142
226 3300010375 Ga0105239_10403971 Ga0105239_104039712 142
227 3300011119 Ga0105246_10137085 Ga0105246_101370853 142
228 3300013100 Ga0157373_10705961 Ga0157373_107059611 142
229 3300013104 Ga0157370_10123002 Ga0157370_101230022 142
230 3300013105 Ga0157369_10159646 Ga0157369_101596462 142
231 3300013105 Ga0157369_10173836 Ga0157369_101738362 142
232 3300013297 Ga0157378_10847571 Ga0157378_108475712 142
233 3300013306 Ga0163162_10749041 Ga0163162_107490412 142
234 3300013307 Ga0157372_10112402 Ga0157372_101124023 142
235 3300013307 Ga0157372_10447402 Ga0157372_104474022 142
236 3300013307 Ga0157372_10646185 Ga0157372_106461852 142
237 3300013307 Ga0157372_10737959 Ga0157372_107379591 142
238 3300013307 Ga0157372_11411198 Ga0157372_114111981 142
239 3300014325 Ga0163163_10011362 Ga0163163_100113623 142
240 3300014325 Ga0163163_10043824 Ga0163163_100438245 142
241 3300014325 Ga0163163_10307436 Ga0163163_103074362 142
242 3300014326 Ga0157380_10547839 Ga0157380_105478391 142
243 3300014326 Ga0157380_10801805 Ga0157380_108018051 142
244 3300014745 Ga0157377_10011787 Ga0157377_100117873 142
245 3300014968 Ga0157379_10261039 Ga0157379_102610391 142
246 3300014969 Ga0157376_10203025 Ga0157376_102030252 142
247 3300014969 Ga0157376_10361318 Ga0157376_103613182 142
248 3300014969 Ga0157376_11809047 Ga0157376_118090472 142
249 3300020069 Ga0197907_10814455 Ga0197907_108144551 142
250 3300020070 Ga0206356_10971613 Ga0206356_109716132 142
251 3300020078 Ga0206352_11296872 Ga0206352_112968721 142
252 3300020082 Ga0206353_10354313 Ga0206353_103543132 142
253 3300020082 Ga0206353_11458692 Ga0206353_114586923 142
254 3300021384 Ga0213876_10023093 Ga0213876_100230932 142
255 3300021384 Ga0213876_10272987 Ga0213876_102729872 142
256 3300021388 Ga0213875_10002508 Ga0213875_100025083 142
257 3300022467 Ga0224712_10009645 Ga0224712_100096452 142
258 3300025898 Ga0207692_10090044 Ga0207692_100900443 142
259 3300025901 Ga0207688_10047376 Ga0207688_100473763 142
260 3300025904 Ga0207647_10104749 Ga0207647_101047492 142
261 3300025905 Ga0207685_10031535 Ga0207685_100315351 142
262 3300025906 Ga0207699_10002187 Ga0207699_100021872 142
263 3300025907 Ga0207645_10228149 Ga0207645_102281492 142
264 3300025909 Ga0207705_10548847 Ga0207705_105488471 142
265 3300025909 Ga0207705_11079394 Ga0207705_110793942 142
266 3300025912 Ga0207707_10065622 Ga0207707_100656223 142
267 3300025912 Ga0207707_11245079 Ga0207707_112450792 142
268 3300025915 Ga0207693_10009125 Ga0207693_100091257 142
269 3300025916 Ga0207663_10002997 Ga0207663_100029972 142
270 3300025917 Ga0207660_10124375 Ga0207660_101243751 142
271 3300025919 Ga0207657_10104817 Ga0207657_101048172 142
272 3300025919 Ga0207657_10158369 Ga0207657_101583693 142
273 3300025920 Ga0207649_10373821 Ga0207649_103738212 142
274 3300025921 Ga0207652_10054890 Ga0207652_100548902 142
275 3300025922 Ga0207646_10554252 Ga0207646_105542521 142
276 3300025923 Ga0207681_10347083 Ga0207681_103470832 142
277 3300025924 Ga0207694_10590379 Ga0207694_105903792 142
278 3300025925 Ga0207650_10060418 Ga0207650_100604182 142
279 3300025926 Ga0207659_10005349 Ga0207659_100053494 142
280 3300025927 Ga0207687_10256625 Ga0207687_102566253 142
281 3300025927 Ga0207687_10315134 Ga0207687_103151341 142
282 3300025928 Ga0207700_10048206 Ga0207700_100482062 142
283 3300025928 Ga0207700_10064425 Ga0207700_100644252 142
284 3300025928 Ga0207700_10638585 Ga0207700_106385852 142
285 3300025929 Ga0207664_10004489 Ga0207664_100044892 142
286 3300025933 Ga0207706_10035253 Ga0207706_100352532 142
287 3300025933 Ga0207706_10808091 Ga0207706_108080911 142
288 3300025934 Ga0207686_10492295 Ga0207686_104922952 142
289 3300025935 Ga0207709_10706310 Ga0207709_107063101 142
290 3300025937 Ga0207669_10461232 Ga0207669_104612322 142
291 3300025938 Ga0207704_10028557 Ga0207704_100285575 142
292 3300025939 Ga0207665_10005974 Ga0207665_100059747 142
293 3300025939 Ga0207665_10232754 Ga0207665_102327542 142
294 3300025940 Ga0207691_10236690 Ga0207691_102366903 142
295 3300025941 Ga0207711_10000170 Ga0207711_1000017050 142
296 3300025942 Ga0207689_10010048 Ga0207689_100100487 142
297 3300025942 Ga0207689_10283932 Ga0207689_102839322 142
298 3300025944 Ga0207661_10210545 Ga0207661_102105451 142
299 3300025945 Ga0207679_10084248 Ga0207679_100842484 142
300 3300025945 Ga0207679_10478056 Ga0207679_104780562 142
301 3300025949 Ga0207667_10797456 Ga0207667_107974562 142
302 3300025960 Ga0207651_10780771 Ga0207651_107807711 142
303 3300025961 Ga0207712_10006290 Ga0207712_100062907 142
304 3300025972 Ga0207668_10993487 Ga0207668_109934872 142
305 3300025981 Ga0207640_10116679 Ga0207640_101166793 142
306 3300025981 Ga0207640_11028784 Ga0207640_110287841 142
307 3300025986 Ga0207658_10935225 Ga0207658_109352252 142
308 3300026023 Ga0207677_10159836 Ga0207677_101598363 142
309 3300026023 Ga0207677_10591689 Ga0207677_105916891 142
310 3300026035 Ga0207703_10199294 Ga0207703_101992943 142
311 3300026067 Ga0207678_10131084 Ga0207678_101310842 142
312 3300026067 Ga0207678_10155235 Ga0207678_101552353 142
313 3300026067 Ga0207678_10173854 Ga0207678_101738543 142
314 3300026067 Ga0207678_10448833 Ga0207678_104488331 142
315 3300026075 Ga0207708_10063026 Ga0207708_100630262 142
316 3300026078 Ga0207702_10064029 Ga0207702_100640292 142
317 3300026078 Ga0207702_10444488 Ga0207702_104444882 142
318 3300026088 Ga0207641_10001578 Ga0207641_1000157815 142
319 3300026088 Ga0207641_10016985 Ga0207641_100169856 142
320 3300026095 Ga0207676_10131885 Ga0207676_101318853 142
321 3300026095 Ga0207676_10341517 Ga0207676_103415173 142
322 3300026095 Ga0207676_10836588 Ga0207676_108365882 142
323 3300026116 Ga0207674_10089136 Ga0207674_100891362 142
324 3300026116 Ga0207674_10173753 Ga0207674_101737532 142
325 3300026116 Ga0207674_10242446 Ga0207674_102424462 142
326 3300026116 Ga0207674_11321972 Ga0207674_113219722 142
327 3300026118 Ga0207675_101467661 Ga0207675_1014676611 142
328 3300026121 Ga0207683_10092634 Ga0207683_100926344 142
329 3300026121 Ga0207683_10099151 Ga0207683_100991511 142
330 3300026121 Ga0207683_10226622 Ga0207683_102266222 142
331 3300026121 Ga0207683_10390927 Ga0207683_103909272 142
332 3300026121 Ga0207683_10472344 Ga0207683_104723442 142
333 3300026142 Ga0207698_10233284 Ga0207698_102332841 142
334 3300026142 Ga0207698_10563792 Ga0207698_105637922 142
335 3300026142 Ga0207698_10882730 Ga0207698_108827302 142
336 3300027907 Ga0207428_10118715 Ga0207428_101187151 142
337 3300027907 Ga0207428_10131813 Ga0207428_101318131 142
338 3300027907 Ga0207428_10506760 Ga0207428_105067602 142
339 3300028379 Ga0268266_10090969 Ga0268266_100909693 142
340 3300028379 Ga0268266_10263142 Ga0268266_102631422 142
341 3300028379 Ga0268266_10274499 Ga0268266_102744991 142
342 3300028380 Ga0268265_10000034 Ga0268265_10000034100 142
343 3300028380 Ga0268265_10038881 Ga0268265_100388813 142
344 3300031456 Ga0307513_10116141 Ga0307513_101161413 142
345 3300031456 Ga0307513_11045858 Ga0307513_110458581 142
346 3300031548 Ga0307408_100074075 Ga0307408_1000740753 142
347 3300031548 Ga0307408_100264442 Ga0307408_1002644422 142
348 3300031731 Ga0307405_10775215 Ga0307405_107752151 142
349 3300031824 Ga0307413_10268733 Ga0307413_102687331 142
350 3300031824 Ga0307413_10290028 Ga0307413_102900282 142
351 3300031852 Ga0307410_10105286 Ga0307410_101052864 142
352 3300031901 Ga0307406_10052243 Ga0307406_100522432 142
353 3300031901 Ga0307406_10498826 Ga0307406_104988261 142
354 3300031903 Ga0307407_10167335 Ga0307407_101673352 142
355 3300031903 Ga0307407_10276743 Ga0307407_102767432 142
356 3300031995 Ga0307409_100008660 Ga0307409_1000086604 142
357 3300031995 Ga0307409_100071358 Ga0307409_1000713584 142
358 3300031995 Ga0307409_100313190 Ga0307409_1003131903 142
359 3300031995 Ga0307409_100955324 Ga0307409_1009553241 142
360 3300031995 Ga0307409_101320740 Ga0307409_1013207402 142
361 3300031995 Ga0307409_102891038 Ga0307409_1028910381 142
362 3300032002 Ga0307416_100012136 Ga0307416_1000121365 142
363 3300032002 Ga0307416_100037324 Ga0307416_1000373244 142
364 3300032002 Ga0307416_100161594 Ga0307416_1001615942 142
365 3300032002 Ga0307416_100748197 Ga0307416_1007481972 142
366 3300032002 Ga0307416_100899555 Ga0307416_1008995552 142
367 3300032002 Ga0307416_101027727 Ga0307416_1010277272 142
368 3300032002 Ga0307416_102652806 Ga0307416_1026528061 142
369 3300032004 Ga0307414_10422814 Ga0307414_104228141 142
370 3300032005 Ga0307411_10261907 Ga0307411_102619072 142
371 3300032005 Ga0307411_10272240 Ga0307411_102722401 142
372 3300032126 Ga0307415_100009799 Ga0307415_1000097992 142
373 3300032126 Ga0307415_100056096 Ga0307415_1000560963 142
374 3300032126 Ga0307415_100062817 Ga0307415_1000628171 142
375 3300032126 Ga0307415_100143005 Ga0307415_1001430053 142
376 3300032126 Ga0307415_100444423 Ga0307415_1004444232 142
377 3300032126 Ga0307415_100529325 Ga0307415_1005293252 142
378 3300032126 Ga0307415_100583751 Ga0307415_1005837512 142
379 3300032126 Ga0307415_102170123 Ga0307415_1021701231 142
380 3300034816 Ga0373930_0015702 Ga0373930_0015702_710_1138 142
381 3300034820 Ga0373959_0001679 Ga0373959_0001679_949_1377 142
382 3300034957 Ga0373938_0006150 Ga0373938_0006150_334_762 142
383 3300035083 Ga0373926_0051033 Ga0373926_0051033_909_1337 142
384 3300035084 Ga0373928_0004837 Ga0373928_0004837_964_1392 142
385 3300035085 Ga0373929_0005019 Ga0373929_0005019_488_916 142
386 3300035086 Ga0373934_0002980 Ga0373934_0002980_4039_4467 142
387 3300035086 Ga0373934_0019986 Ga0373934_0019986_621_1049 142
388 3300035086 Ga0373934_0355768 Ga0373934_0355768_145_573 142
389 3300035088 Ga0373940_0001674 Ga0373940_0001674_1793_2221 142
390 3300035090 Ga0373949_0004023 Ga0373949_0004023_214_642 142
391 3300035091 Ga0373951_0000057 Ga0373951_0000057_1216_1644 142
392 3300035091 Ga0373951_0078888 Ga0373951_0078888_380_808 142
393 3300035111 Ga0373923_0129605 Ga0373923_0129605_308_736 142
394 3300035111 Ga0373923_0315700 Ga0373923_0315700_250_678 142
395 3300035114 Ga0373939_0156835 Ga0373939_0156835_202_630 142
396 3300035115 Ga0373941_0277264 Ga0373941_0277264_97_525 142
397 3300035116 Ga0373945_0059236 Ga0373945_0059236_664_1092 142
398 3300035116 Ga0373945_0389381 Ga0373945_0389381_17_445 142
399 3300035117 Ga0373953_0000287 Ga0373953_0000287_11809_12237 142
400 3300035117 Ga0373953_0034130 Ga0373953_0034130_1160_1588 142
401 3300035118 Ga0373954_0008734 Ga0373954_0008734_2611_3039 142
402 3300035118 Ga0373954_0008943 Ga0373954_0008943_2723_3151 142
403 3300035119 Ga0373956_0000749 Ga0373956_0000749_1675_2103 142
404 3300035119 Ga0373956_0064883 Ga0373956_0064883_1102_1530 142
405 3300035120 Ga0373957_0000202 Ga0373957_0000202_4533_4961 142
406 3300035120 Ga0373957_0008081 Ga0373957_0008081_399_827 142
407 3300035120 Ga0373957_0119867 Ga0373957_0119867_349_777 142
408 3300035121 Ga0373960_0012087 Ga0373960_0012087_322_750 142
409 3300035170 Ga0373943_0074087 Ga0373943_0074087_518_946 142
410 3300035170 Ga0373943_0084358 Ga0373943_0084358_974_1402 142
411 3300035171 Ga0373946_0190168 Ga0373946_0190168_339_767 142
412 3300035171 Ga0373946_0681692 Ga0373946_0681692_10_438 142
413 3300035172 Ga0373955_0000190 Ga0373955_0000190_7977_8405 142
414 3300035172 Ga0373955_0000949 Ga0373955_0000949_10949_11377 142
415 3300035207 Ga0373942_0025100 Ga0373942_0025100_682_1110 142
416 3300035242 Ga0373962_0014259 Ga0373962_0014259_1553_1981 142
417 3300035410 Ga0373924_0000299 Ga0373924_0000299_12611_13039 142
418 3300035410 Ga0373924_0144848 Ga0373924_0144848_73_501 142
419 3300035410 Ga0373924_0177314 Ga0373924_0177314_51_479 142
420 3300035692 Ga0373935_0207136 Ga0373935_0207136_44_472 142
421 3300035692 Ga0373935_0344441 Ga0373935_0344441_304_732 142
422 3300035695 Ga0373927_0064774 Ga0373927_0064774_1790_2218 142
423 3300035695 Ga0373927_0157548 Ga0373927_0157548_992_1420 142
424 3300035724 Ga0373933_0000002 Ga0373933_0000002_36677_37105 142
425 3300035724 Ga0373933_0020754 Ga0373933_0020754_741_1169 142
426 3300035724 Ga0373933_0030456 Ga0373933_0030456_591_1019 142
427 3300035725 Ga0373947_0129876 Ga0373947_0129876_340_768 142
428 3300035725 Ga0373947_0274126 Ga0373947_0274126_519_947 142
429 3300036401 Ga0373937_0000014 Ga0373937_0000014_114681_115109 142
430 3300036401 Ga0373937_0010614 Ga0373937_0010614_5696_6124 142
431 3300036401 Ga0373937_0047451 Ga0373937_0047451_2746_3174 142
432 3300037068 Ga0373925_0007581 Ga0373925_0007581_5336_5764 142
433 3300037068 Ga0373925_0229642 Ga0373925_0229642_373_801 142
434 3300037068 Ga0373925_0755201 Ga0373925_0755201_189_617 142
435 3300037068 Ga0373925_1076711 Ga0373925_1076711_164_592 142
436 3300037312 Ga0395899_0008140 Ga0395899_0008140_3766_4194 142
437 3300037466 Ga0395898_0417280 Ga0395898_0417280_624_1052 142
438 3300037466 Ga0395898_0432312 Ga0395898_0432312_794_1222 142
439 3300037466 Ga0395898_1190348 Ga0395898_1190348_80_508 142
440 3300037471 Ga0395905_1099843 Ga0395905_1099843_220_648 142
441 3300037853 Ga0436364_0923522 Ga0436364_0923522_90714_91142 142
442 3300037853 Ga0436364_1394990 Ga0436364_1394990_1792_2223 142
443 3300038443 Ga0395901_0013845 Ga0395901_0013845_4115_4543 142
444 3300038996 Ga0242420_035936 Ga0242420_035936_459_887 142
445 3300039437 Ga0436365_1135090 Ga0436365_1135090_1291_1719 142
446 3300039437 Ga0436365_1929710 Ga0436365_1929710_392_823 142
447 3300041410 Ga0439461_0001522 Ga0439461_0001522_1814_2242 142
448 3300041411 Ga0439466_0004315 Ga0439466_0004315_3244_3672 142
449 3300041411 Ga0439466_0004664 Ga0439466_0004664_2259_2687 142
450 3300041413 Ga0439465_0000501 Ga0439465_0000501_3136_3564 142
451 3300041413 Ga0439465_0003422 Ga0439465_0003422_1109_1537 142
452 3300041443 Ga0451789_0318381 Ga0451789_0318381_1105_1533 142
453 3300041453 Ga0451797_1028095 Ga0451797_1028095_1192_1620 142
454 3300041456 Ga0451795_0617988 Ga0451795_0617988_1662_2090 142
455 3300041459 Ga0451800_0925617 Ga0451800_0925617_1929_2357 142
456 3300041486 Ga0451807_0590601 Ga0451807_0590601_107_535 142
457 3300041494 Ga0451837_0856061 Ga0451837_0856061_134_562 142
458 3300041496 Ga0451839_1323259 Ga0451839_1323259_1267_1695 142
459 3300041505 Ga0451849_0436125 Ga0451849_0436125_197_625 142
460 3300041512 Ga0451853_1902101 Ga0451853_1902101_1078_1506 142
461 3300042002 Ga0439442_016837 Ga0439442_016837_558_986 142
462 3300042004 Ga0439445_0008773 Ga0439445_0008773_37_465 142
463 3300042435 Ga0439434_0024650 Ga0439434_0024650_427_855 142
464 3300044658 Ga0466972_0016477 Ga0466972_0016477_1901_2329 142
465 3300044901 Ga0466960_0104052 Ga0466960_0104052_975_1403 142
466 3300044901 Ga0466960_0383520 Ga0466960_0383520_164_592 142
467 3300044901 Ga0466960_1025719 Ga0466960_1025719_49_477 142
468 3300045976 Ga0466967_0135769 Ga0466967_0135769_569_997 142
469 3300045976 Ga0466967_0138658 Ga0466967_0138658_1226_1654 142
470 3300046454 Ga0495592_0000133 Ga0495592_0000133_36677_37105 142
471 3300046454 Ga0495592_0053180 Ga0495592_0053180_1572_2000 142
472 3300046455 Ga0495603_0097511 Ga0495603_0097511_464_892 142
473 3300046459 Ga0495629_0033812 Ga0495629_0033812_312_740 142
474 3300046459 Ga0495629_0162594 Ga0495629_0162594_432_860 142
475 3300046459 Ga0495629_0566635 Ga0495629_0566635_23_451 142
476 3300046462 Ga0495651_0000019 Ga0495651_0000019_114681_115109 142
477 3300046462 Ga0495651_0121564 Ga0495651_0121564_1446_1874 142
478 3300046462 Ga0495651_0245518 Ga0495651_0245518_399_827 142
479 3300046462 Ga0495651_0832100 Ga0495651_0832100_89_517 142
480 3300046463 Ga0495653_0000763 Ga0495653_0000763_9076_9504 142
481 3300046463 Ga0495653_0075842 Ga0495653_0075842_1778_2206 142
482 3300046463 Ga0495653_0141416 Ga0495653_0141416_1046_1477 142
483 3300046463 Ga0495653_0652885 Ga0495653_0652885_21_455 142
484 3300046472 Ga0495580_0085117 Ga0495580_0085117_1328_1756 142
485 3300046473 Ga0495582_0045125 Ga0495582_0045125_1020_1448 142
486 3300046473 Ga0495582_0166673 Ga0495582_0166673_792_1235 142
487 3300046475 Ga0495639_0083470 Ga0495639_0083470_1044_1472 142
488 3300046475 Ga0495639_0153548 Ga0495639_0153548_555_983 142
489 3300046475 Ga0495639_0249224 Ga0495639_0249224_331_768 142
490 3300046476 Ga0495662_0026275 Ga0495662_0026275_1654_2082 142
491 3300046476 Ga0495662_0302037 Ga0495662_0302037_294_722 142
492 3300046477 Ga0495664_0004853 Ga0495664_0004853_5069_5497 142
493 3300046477 Ga0495664_0222941 Ga0495664_0222941_409_858 142
494 3300046499 Ga0495594_0220935 Ga0495594_0220935_110_538 142
495 3300046507 Ga0495606_0000540 Ga0495606_0000540_5348_5788 142
496 3300046511 Ga0495608_0000028 Ga0495608_0000028_36669_37097 142
497 3300046511 Ga0495608_0012844 Ga0495608_0012844_1136_1564 142
498 3300046511 Ga0495608_0350330 Ga0495608_0350330_434_862 142
499 3300046514 Ga0495618_0046453 Ga0495618_0046453_494_922 142
500 3300046514 Ga0495618_0211842 Ga0495618_0211842_784_1212 142
501 3300046516 Ga0495628_0000371 Ga0495628_0000371_20437_20865 142
502 3300046517 Ga0495630_0476805 Ga0495630_0476805_293_721 142
503 3300046517 Ga0495630_0933343 Ga0495630_0933343_34_462 142
504 3300046526 Ga0495666_0040822 Ga0495666_0040822_1760_2188 142
505 3300046529 Ga0495652_0000031 Ga0495652_0000031_36657_37085 142
506 3300046529 Ga0495652_0019012 Ga0495652_0019012_4248_4676 142
507 3300046531 Ga0495665_0114177 Ga0495665_0114177_285_713 142
508 3300046531 Ga0495665_0310803 Ga0495665_0310803_336_764 142
509 3300046531 Ga0495665_0333538 Ga0495665_0333538_162_605 142
510 3300046533 Ga0495640_0044467 Ga0495640_0044467_829_1257 142
511 3300046533 Ga0495640_0097108 Ga0495640_0097108_133_561 142
512 3300046535 Ga0495586_0138003 Ga0495586_0138003_611_1039 142
513 3300046536 Ga0495587_0000023 Ga0495587_0000023_114659_115087 142
514 3300046536 Ga0495587_0033842 Ga0495587_0033842_1695_2123 142
515 3300046543 Ga0495645_0039761 Ga0495645_0039761_1182_1610 142
516 3300046543 Ga0495645_0076335 Ga0495645_0076335_1336_1764 142
517 3300046543 Ga0495645_0361009 Ga0495645_0361009_147_581 142
518 3300046543 Ga0495645_0383687 Ga0495645_0383687_446_874 142
519 3300046559 Ga0495667_0000054 Ga0495667_0000054_36669_37097 142
520 3300046559 Ga0495667_0013775 Ga0495667_0013775_1803_2231 142
521 3300046616 Ga0495668_0000362 Ga0495668_0000362_29483_29923 142
522 3300046642 Ga0495634_0017630 Ga0495634_0017630_1606_2034 142
523 3300046642 Ga0495634_0021812 Ga0495634_0021812_3971_4399 142
524 3300046660 Ga0495625_0001125 Ga0495625_0001125_3985_4425 142
525 3300046663 Ga0495635_0150846 Ga0495635_0150846_809_1237 142
526 3300046674 Ga0495588_0134247 Ga0495588_0134247_313_741 142
527 3300046675 Ga0495657_0000022 Ga0495657_0000022_36677_37105 142
528 3300046675 Ga0495657_0026800 Ga0495657_0026800_1569_1997 142
529 3300046678 Ga0495599_0000700 Ga0495599_0000700_2131_2559 142
530 3300046678 Ga0495599_0039315 Ga0495599_0039315_953_1381 142
531 3300046678 Ga0495599_0244098 Ga0495599_0244098_540_968 142
532 3300046679 Ga0495623_0000416 Ga0495623_0000416_150_578 142
533 3300046679 Ga0495623_0014675 Ga0495623_0014675_2613_3041 142
534 3300046679 Ga0495623_0039229 Ga0495623_0039229_1109_1537 142
535 3300046680 Ga0495646_0082566 Ga0495646_0082566_993_1421 142
536 3300046681 Ga0495647_0031756 Ga0495647_0031756_593_1021 142
537 3300046681 Ga0495647_0406933 Ga0495647_0406933_63_491 142
538 3300046683 Ga0495658_0059288 Ga0495658_0059288_340_768 142
539 3300046690 Ga0495624_0115440 Ga0495624_0115440_938_1366 142
540 3300046690 Ga0495624_0137278 Ga0495624_0137278_197_625 142
541 3300046694 Ga0495649_0256636 Ga0495649_0256636_359_787 142
542 3300046809 Ga0495600_0006882 Ga0495600_0006882_2665_3093 142
543 3300046809 Ga0495600_0033354 Ga0495600_0033354_1182_1610 142
544 3300046809 Ga0495600_0531159 Ga0495600_0531159_264_695 142
545 3300047315 Ga0495581_0020178 Ga0495581_0020178_79_507 142
546 3300047315 Ga0495581_0179609 Ga0495581_0179609_393_821 142
547 3300047317 Ga0495604_0000022 Ga0495604_0000022_36654_37082 142
548 3300047317 Ga0495604_0019904 Ga0495604_0019904_657_1085 142
549 3300047317 Ga0495604_0126603 Ga0495604_0126603_891_1319 142
550 3300047319 Ga0495674_0534500 Ga0495674_0534500_57_491 142
551 3300047319 Ga0495674_0736390 Ga0495674_0736390_133_564 142
552 3300047321 Ga0495676_0179158 Ga0495676_0179158_73_501 142
553 3300047322 Ga0495680_0000271 Ga0495680_0000271_20491_20919 142
554 3300047322 Ga0495680_0048669 Ga0495680_0048669_2857_3285 142
555 3300047444 Ga0495675_0025084 Ga0495675_0025084_1936_2364 142
556 3300047444 Ga0495675_0039659 Ga0495675_0039659_2282_2710 142
557 3300047444 Ga0495675_0177759 Ga0495675_0177759_753_1181 142
558 3300047471 Ga0495684_0121849 Ga0495684_0121849_1181_1609 142
559 3300047471 Ga0495684_0168631 Ga0495684_0168631_311_739 142
560 3300047673 Ga0495593_0013816 Ga0495593_0013816_3826_4254 142
561 3300048088 Ga0495602_0000390 Ga0495602_0000390_36677_37105 142
562 3300048088 Ga0495602_0114839 Ga0495602_0114839_1538_1966 142
563 3300048088 Ga0495602_0272128 Ga0495602_0272128_43_471 142
564 3300048089 Ga0495614_0008545 Ga0495614_0008545_976_1404 142
565 3300048089 Ga0495614_0230228 Ga0495614_0230228_365_802 142
566 3300048091 Ga0495626_0000118 Ga0495626_0000118_36021_36461 142
567 3300048903 Ga0496100_0239311 Ga0496100_0239311_325_753 142
568 3300048903 Ga0496100_1343890 Ga0496100_1343890_24_458 142
569 3300048904 Ga0496101_0369046 Ga0496101_0369046_559_999 142
570 3300048904 Ga0496101_0527182 Ga0496101_0527182_475_909 142
571 3300048904 Ga0496101_0762737 Ga0496101_0762737_306_749 142
572 3300048905 Ga0496102_0005945 Ga0496102_0005945_6784_7218 142
573 3300048905 Ga0496102_0019672 Ga0496102_0019672_439_867 142
574 3300048905 Ga0496102_0217541 Ga0496102_0217541_334_774 142
575 3300048905 Ga0496102_0548385 Ga0496102_0548385_503_931 142
576 3300048905 Ga0496102_0879014 Ga0496102_0879014_376_804 142
577 3300048905 Ga0496102_1377964 Ga0496102_1377964_27_464 142
578 3300048907 Ga0496104_0105151 Ga0496104_0105151_1440_1874 142
579 3300048907 Ga0496104_0638732 Ga0496104_0638732_104_532 142
580 3300048907 Ga0496104_1485425 Ga0496104_1485425_56_499 142
581 3300048908 Ga0496105_0004687 Ga0496105_0004687_355_783 142
582 3300048908 Ga0496105_0432779 Ga0496105_0432779_103_537 142
583 3300048909 Ga0496106_0308531 Ga0496106_0308531_159_587 142
584 3300048910 Ga0496107_0074401 Ga0496107_0074401_1337_1765 142
585 3300048911 Ga0496108_0028194 Ga0496108_0028194_2890_3318 142
586 3300048911 Ga0496108_0030255 Ga0496108_0030255_1448_1882 142
587 3300048911 Ga0496108_0239073 Ga0496108_0239073_659_1087 142
588 3300048912 Ga0496109_0011048 Ga0496109_0011048_6944_7378 142
589 3300048912 Ga0496109_0088322 Ga0496109_0088322_1027_1455 142
590 3300048913 Ga0496110_0001522 Ga0496110_0001522_2415_2849 142
591 3300048913 Ga0496110_0933515 Ga0496110_0933515_164_592 142
592 3300048914 Ga0496111_0001467 Ga0496111_0001467_9031_9465 142
593 3300048914 Ga0496111_0230491 Ga0496111_0230491_466_894 142
594 3300048915 Ga0496112_0141119 Ga0496112_0141119_748_1191 142
595 3300048915 Ga0496112_0200742 Ga0496112_0200742_1465_1908 142
596 3300048915 Ga0496112_0562749 Ga0496112_0562749_37_465 142
597 3300048916 Ga0496113_0043573 Ga0496113_0043573_2064_2492 142
598 3300048916 Ga0496113_0509711 Ga0496113_0509711_424_852 142
599 3300048917 Ga0496114_0061747 Ga0496114_0061747_1561_2004 142
600 3300048917 Ga0496114_0074029 Ga0496114_0074029_1504_1938 142
601 3300048917 Ga0496114_0115938 Ga0496114_0115938_1775_2215 142
602 3300048917 Ga0496114_0133740 Ga0496114_0133740_1552_1980 142
603 3300048917 Ga0496114_0756230 Ga0496114_0756230_213_653 142
604 3300048918 Ga0496115_0123719 Ga0496115_0123719_681_1109 142
605 3300048918 Ga0496115_0529364 Ga0496115_0529364_118_546 142
606 3300048919 Ga0496116_0000165 Ga0496116_0000165_21237_21665 142
607 3300048920 Ga0496117_0004187 Ga0496117_0004187_12918_13346 142
608 3300048920 Ga0496117_0020011 Ga0496117_0020011_998_1426 142
609 3300048921 Ga0496118_0008074 Ga0496118_0008074_2739_3167 142
610 3300048921 Ga0496118_0018480 Ga0496118_0018480_5778_6206 142
611 3300048922 Ga0496119_0003213 Ga0496119_0003213_6620_7048 142
612 3300048923 Ga0496120_0057441 Ga0496120_0057441_842_1270 142
613 3300048924 Ga0496121_0068252 Ga0496121_0068252_250_678 142
614 3300048929 Ga0496126_0073734 Ga0496126_0073734_51_479 142
615 3300049571 Ga0501034_1114876 Ga0501034_1114876_58_486 142
616 3300049823 Ga0501044_0327691 Ga0501044_0327691_621_1049 142
617 3300050490 nmdc:mga03n38_80747_c1 nmdc:mga03n38_80747_c1_872_1300 142
618 3300050491 nmdc:mga00v17_166583_c1 nmdc:mga00v17_166583_c1_548_976 142
619 3300050492 nmdc:mga0yw44_87683_c1 nmdc:mga0yw44_87683_c1_1036_1464 142
620 3300050494 nmdc:mga06z11_28004_c1 nmdc:mga06z11_28004_c1_1558_1986 142
621 3300050507 nmdc:mga05p37_1840993_c1 nmdc:mga05p37_1840993_c1_128_556 142
622 3300050507 nmdc:mga05p37_192167_c1 nmdc:mga05p37_192167_c1_358_786 142
623 3300050507 nmdc:mga05p37_33850_c1 nmdc:mga05p37_33850_c1_788_1216 142
624 3300050507 nmdc:mga05p37_396093_c1 nmdc:mga05p37_396093_c1_551_979 142
625 3300050507 nmdc:mga05p37_7263_c1 nmdc:mga05p37_7263_c1_11886_12314 142
626 3300050508 nmdc:mga09592_111_c1 nmdc:mga09592_111_c1_758_1186 142
627 3300050508 nmdc:mga09592_399956_c1 nmdc:mga09592_399956_c1_91_519 142
628 3300050508 nmdc:mga09592_56070_c1 nmdc:mga09592_56070_c1_593_1021 142
629 3300050509 nmdc:mga0qj67_1531853_c1 nmdc:mga0qj67_1531853_c1_46_474 142
630 3300050509 nmdc:mga0qj67_2591_c1 nmdc:mga0qj67_2591_c1_11758_12186 142
631 3300050509 nmdc:mga0qj67_925_c1 nmdc:mga0qj67_925_c1_10095_10523 142
632 3300050509 nmdc:mga0qj67_95500_c1 nmdc:mga0qj67_95500_c1_851_1279 142
633 3300050510 nmdc:mga06r32_3493_c1 nmdc:mga06r32_3493_c1_758_1186 142
634 3300050510 nmdc:mga06r32_373743_c1 nmdc:mga06r32_373743_c1_153_581 142
635 3300050510 nmdc:mga06r32_426287_c1 nmdc:mga06r32_426287_c1_740_1168 142
636 3300050510 nmdc:mga06r32_5589_c1 nmdc:mga06r32_5589_c1_4198_4626 142
637 3300050511 nmdc:mga08y16_260342_c1 nmdc:mga08y16_260342_c1_242_670 142
638 3300050511 nmdc:mga08y16_3789_c1 nmdc:mga08y16_3789_c1_355_783 142
639 3300050512 nmdc:mga0n895_165005_c1 nmdc:mga0n895_165005_c1_675_1103 142
640 3300050512 nmdc:mga0n895_21202_c1 nmdc:mga0n895_21202_c1_1513_1941 142
641 3300050513 nmdc:mga0rr50_132590_c1 nmdc:mga0rr50_132590_c1_935_1363 142
642 3300050513 nmdc:mga0rr50_552618_c1 nmdc:mga0rr50_552618_c1_366_794 142
643 3300050513 nmdc:mga0rr50_90223_c1 nmdc:mga0rr50_90223_c1_1139_1567 142
644 3300050514 nmdc:mga08x19_128113_c1 nmdc:mga08x19_128113_c1_447_875 142
645 3300050514 nmdc:mga08x19_86485_c1 nmdc:mga08x19_86485_c1_1469_1897 142
646 3300050515 nmdc:mga0a205_305755_c1 nmdc:mga0a205_305755_c1_651_1079 142
647 3300050515 nmdc:mga0a205_42248_c1 nmdc:mga0a205_42248_c1_1566_1994 142
648 3300050516 nmdc:mga0sz30_6870_c1 nmdc:mga0sz30_6870_c1_3491_3919 142
649 3300053077 Ga0495601_0052770 Ga0495601_0052770_1749_2177 142
650 3300053078 Ga0495612_0056392 Ga0495612_0056392_183_611 142
651 3300053084 Ga0495595_0003523 Ga0495595_0003523_3024_3452 142
652 3300053084 Ga0495595_0094614 Ga0495595_0094614_384_812 142
653 3300053085 Ga0495619_0079069 Ga0495619_0079069_1272_1700 142
654 3300053085 Ga0495619_0756072 Ga0495619_0756072_165_596 142
655 3300053092 Ga0500583_0134705 Ga0500583_0134705_631_1059 142
656 3300053153 Ga0500616_0076858 Ga0500616_0076858_195_623 142
657 3300059492 Ga0587073_0022333 Ga0587073_0022333_608_1036 142
658 3300059504 Ga0587082_016845 Ga0587082_016845_180_608 142
659 3300059506 Ga0587085_020364 Ga0587085_020364_431_859 142
660 3300060344 Ga0587071_032102 Ga0587071_032102_397_825 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

4

129

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9215 1 132
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9181 2 135
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9116 2 135
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.9113 1 133
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9083 1 132
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8955 82 132 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8792 82 132 3.30.720.110
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8608 4 130 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8587 1 134 3.10.180.10
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8529 82 132 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A5N6BL37-F1-model_v4 VOC family protein 0.9846 1 142
AF-A0A4R1HPW1-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9824 24 141
AF-A0A5N6BL37-F1-model_v4 VOC family protein 0.9777 1 142
AF-M3TGK3-F1-model_v4 VOC domain-containing protein 0.9765 1 141
AF-A0A2E0RSF9-F1-model_v4 Glyoxalase 0.9743 1 141

Feature Viewer

pLDDT pTM Quality
96.09 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map