F473221

General Info

Members Datasets Scaffolds Average Seq Length
658 343 629 254

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|643348564|643599895
Length 276
Sequence FIGAGPGAADLITLRGRDLIARCPVCLYAGSIVAPEILAWCPPGVRLVDTAPLDLDAILAEMRAAHARGEDVARLHSGDLSVYSAVAEQTRRLEALGIPYTLTPGVPAFATAAAALGRELTVPEVAQSVVLTRTSGRASAMPAPERLALFAQTQATLAIHLSIHVIAEVAAELIPHYGPDCPVGVVYRASWPDERVLRGTLADIAEQVAAARFERTALILVGRALAAGDFRESALYSAGYDRRFRPGGGTRVLGDEVQLSPVRRGNPSPEWERGRG

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
4 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
5 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
6 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
7 2643221558 Rhizobium sp. Root149 Isolate Unclassified
8 2773857925 Microvirga vignae BR3299 Isolate Unclassified
9 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
10 2818991467 Bosea vestrisii 3192 Isolate Unclassified
11 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
12 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
13 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
14 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
15 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
16 2842694124 Methylopila sp. R-72369 Isolate Unclassified
17 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
18 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
19 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
20 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
21 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
22 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
23 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
24 2909042592 Labrys sp. LIt4 Isolate Nodule
25 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
151 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
152 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
153 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
183 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
187 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
188 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
189 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
190 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
213 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
231 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
252 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
288 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
302 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
308 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
316 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
324 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
327 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
328 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
329 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
330 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
331 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
332 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
333 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
334 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
335 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
336 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
340 641522639 Methylobacterium sp. 4-46 Isolate Nodule
341 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
342 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
343 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.59
Metatranscriptomes 0
Isolates 4.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.97
Nodule 2.43
Rhizoplane 8.36
Rhizosphere 74.47
Stem 0
Stem Tuber 0
Unclassified 5.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10051438 3300003316 Bacteria 4835
2 rootH2_10064931 3300003320 Bacteria 3425
3 rootL2_10285924 3300003322 Bacteria 2896
4 JGI25160J50197_1008385 3300003354 Bacteria 3943
5 Ga0070658_10068440 3300005327 Bacteria 2902
6 Ga0070676_10187874 3300005328 Bacteria 1347
7 Ga0070666_10110658 3300005335 Bacteria 1899
8 Ga0070682_100022805 3300005337 Bacteria 3712
9 Ga0068868_100404277 3300005338 Bacteria 1179
10 Ga0070689_100000836 3300005340 Bacteria 19082
11 Ga0070689_100301370 3300005340 Bacteria 1334
12 Ga0070691_10010035 3300005341 Bacteria 4316
13 Ga0070661_100322926 3300005344 Bacteria 1206
14 Ga0070669_100331954 3300005353 Bacteria 1230
15 Ga0070675_100059625 3300005354 Bacteria 3149
16 Ga0070671_100000729 3300005355 Bacteria 23534
17 Ga0070671_100018992 3300005355 Bacteria 5591
18 Ga0070674_100222139 3300005356 Bacteria 1470
19 Ga0070674_100439331 3300005356 Bacteria 1075
20 Ga0070673_100001534 3300005364 Bacteria 13599
21 Ga0070673_100108649 3300005364 Bacteria 2297
22 Ga0070688_100055045 3300005365 Bacteria 2494
23 Ga0070659_100136961 3300005366 Bacteria 1991
24 Ga0070709_10035830 3300005434 Bacteria 3018
25 Ga0070709_10241168 3300005434 Bacteria 1298
26 Ga0070714_100000887 3300005435 Bacteria 21223
27 Ga0070714_100030751 3300005435 Bacteria 4473
28 Ga0070714_100215794 3300005435 Bacteria 1761
29 Ga0070713_100068263 3300005436 Bacteria 2995
30 Ga0070710_10013882 3300005437 Bacteria 4044
31 Ga0070710_10158131 3300005437 Bacteria 1403
32 Ga0070711_100551973 3300005439 Bacteria 956
33 Ga0070678_100118972 3300005456 Bacteria 2080
34 Ga0070681_10079651 3300005458 Bacteria 3232
35 Ga0068867_100110763 3300005459 Bacteria 2109
36 Ga0068867_100519769 3300005459 Bacteria 1026
37 Ga0070706_100503280 3300005467 Bacteria 1127
38 Ga0070672_100315775 3300005543 Bacteria 1327
39 Ga0070665_100000949 3300005548 Bacteria 36967
40 Ga0070665_100005880 3300005548 Bacteria 12574
41 Ga0070665_100014232 3300005548 Bacteria 7991
42 Ga0070665_100029921 3300005548 Bacteria 5481
43 Ga0070665_100215600 3300005548 Bacteria 1920
44 Ga0070665_100365637 3300005548 Bacteria 1449
45 Ga0068855_100060491 3300005563 Bacteria 4429
46 Ga0068856_100446042 3300005614 Bacteria 1315
47 Ga0070702_100053730 3300005615 Bacteria 2315
48 Ga0068852_100082282 3300005616 Bacteria 2860
49 Ga0068852_100510218 3300005616 Bacteria 1198
50 Ga0068859_100058638 3300005617 Bacteria 3878
51 Ga0068864_100307300 3300005618 Bacteria 1486
52 Ga0068861_100003608 3300005719 Bacteria 10306
53 Ga0068863_100014040 3300005841 Bacteria 7717
54 Ga0068863_100221376 3300005841 Bacteria 1824
55 Ga0068858_100026651 3300005842 Bacteria 5369
56 Ga0068860_100000498 3300005843 Bacteria 48732
57 Ga0068860_100887706 3300005843 Bacteria 907
58 Ga0068862_100094272 3300005844 Bacteria 2611
59 Ga0068862_100103938 3300005844 Bacteria 2488
60 Ga0081455_10015010 3300005937 Bacteria 7545
61 Ga0081540_1040673 3300005983 Bacteria 2420
62 Ga0081539_10011961 3300005985 Bacteria 6768
63 Ga0070717_10049133 3300006028 Bacteria 3463
64 Ga0070717_10229637 3300006028 Bacteria 1633
65 Ga0075365_10008616 3300006038 Bacteria 5807
66 Ga0075365_10027464 3300006038 Bacteria 3622
67 Ga0075365_10074189 3300006038 Bacteria 2294
68 Ga0075365_10160025 3300006038 Bacteria 1569
69 Ga0075368_10011576 3300006042 Bacteria 3211
70 Ga0075368_10092230 3300006042 Bacteria 1239
71 Ga0075363_100300867 3300006048 Bacteria 931
72 Ga0075364_10068997 3300006051 Bacteria 2326
73 Ga0075364_10181486 3300006051 Bacteria 1424
74 Ga0075364_10195701 3300006051 Bacteria 1369
75 Ga0070712_100002004 3300006175 Bacteria 12476
76 Ga0070712_100006459 3300006175 Bacteria 7270
77 Ga0075362_10023530 3300006177 Bacteria 2606
78 Ga0075362_10035302 3300006177 Bacteria 2182
79 Ga0075362_10084977 3300006177 Bacteria 1462
80 Ga0075362_10169821 3300006177 Bacteria 1053
81 Ga0075367_10031561 3300006178 Bacteria 3043
82 Ga0075367_10128726 3300006178 Bacteria 1564
83 Ga0075369_10000191 3300006186 Bacteria 17605
84 Ga0075369_10025034 3300006186 Bacteria 2479
85 Ga0075369_10055635 3300006186 Bacteria 1719
86 Ga0075370_10024076 3300006353 Bacteria 3359
87 Ga0075428_100354102 3300006844 Bacteria 1575
88 Ga0075428_100371366 3300006844 Bacteria 1534
89 Ga0075431_100055397 3300006847 Bacteria 4090
90 Ga0075429_100322665 3300006880 Bacteria 1352
91 Ga0068865_100077156 3300006881 Bacteria 2380
92 Ga0097620_100058638 3300006931 Bacteria 3878
93 Ga0099824_1005450 3300006942 Bacteria 17919
94 Ga0105240_10028349 3300009093 Bacteria 7316
95 Ga0105240_10032124 3300009093 Bacteria 6798
96 Ga0105240_10040314 3300009093 Bacteria 5974
97 Ga0105245_10244357 3300009098 Bacteria 1741
98 Ga0105247_10006940 3300009101 Bacteria 6972
99 Ga0114129_10168319 3300009147 Bacteria 2989
100 Ga0105242_10142337 3300009176 Bacteria 2082
101 Ga0105248_10037714 3300009177 Bacteria 5408
102 Ga0105237_10062589 3300009545 Bacteria 3720
103 Ga0105238_10002503 3300009551 Bacteria 18383
104 Ga0105238_10017647 3300009551 Bacteria 7255
105 Ga0105238_10055519 3300009551 Bacteria 3975
106 Ga0105249_10169368 3300009553 Bacteria 2117
107 Ga0105249_10712514 3300009553 Bacteria 1064
108 Ga0099796_10115115 3300010159 Bacteria 1028
109 Ga0105239_10310738 3300010375 Bacteria 1777
110 Ga0157371_10075255 3300013102 Bacteria 2391
111 Ga0157370_10082385 3300013104 Bacteria 3026
112 Ga0157370_10120794 3300013104 Bacteria 2446
113 Ga0157374_10369851 3300013296 Bacteria 1427
114 Ga0163162_10032837 3300013306 Bacteria 5154
115 Ga0163162_10214597 3300013306 Bacteria 2054
116 Ga0157372_10056501 3300013307 Bacteria 4385
117 Ga0157372_11074117 3300013307 Bacteria 931
118 Ga0157375_10008448 3300013308 Bacteria 9020
119 Ga0157375_10584869 3300013308 Bacteria 1276
120 Ga0163163_10009024 3300014325 Bacteria 8885
121 Ga0163163_10074549 3300014325 Bacteria 3386
122 Ga0157380_10102442 3300014326 Bacteria 2387
123 Ga0157377_10130682 3300014745 Bacteria 1533
124 Ga0157379_10005706 3300014968 Bacteria 10703
125 Ga0157379_10193567 3300014968 Bacteria 1838
126 Ga0157379_10288672 3300014968 Bacteria 1494
127 Ga0157376_10006310 3300014969 Bacteria 8369
128 Ga0157376_10135454 3300014969 Bacteria 2203
129 Ga0213872_10031469 3300021361 Bacteria 2432
130 Ga0213876_10160076 3300021384 Bacteria 1198
131 Ga0228598_1000865 3300024227 Bacteria 6547
132 Ga0209455_1017760 3300025272 Bacteria 1480
133 Ga0209130_1000270 3300025284 Bacteria 65057
134 Ga0209025_1000705 3300025294 Bacteria 56926
135 Ga0209758_1004689 3300025297 Bacteria 11165
136 Ga0207426_1000443 3300025302 Bacteria 66593
137 Ga0207692_10219764 3300025898 Bacteria 1126
138 Ga0207710_10008591 3300025900 Bacteria 4307
139 Ga0207688_10083867 3300025901 Bacteria 1823
140 Ga0207699_10010696 3300025906 Bacteria 4614
141 Ga0207699_10028993 3300025906 Bacteria 3082
142 Ga0207699_10078197 3300025906 Bacteria 2043
143 Ga0207699_10234391 3300025906 Bacteria 1258
144 Ga0207695_10109316 3300025913 Bacteria 2747
145 Ga0207693_10001484 3300025915 Bacteria 20734
146 Ga0207693_10013542 3300025915 Bacteria 6573
147 Ga0207693_10067985 3300025915 Bacteria 2789
148 Ga0207693_10073706 3300025915 Bacteria 2673
149 Ga0207693_10212348 3300025915 Bacteria 1521
150 Ga0207660_10285434 3300025917 Bacteria 1311
151 Ga0207649_10169935 3300025920 Bacteria 1518
152 Ga0207649_10481192 3300025920 Bacteria 942
153 Ga0207650_10010860 3300025925 Bacteria 6256
154 Ga0207687_10653890 3300025927 Bacteria 889
155 Ga0207700_10093217 3300025928 Bacteria 2383
156 Ga0207700_10285224 3300025928 Bacteria 1422
157 Ga0207700_10699050 3300025928 Bacteria 905
158 Ga0207664_10013831 3300025929 Bacteria 5810
159 Ga0207664_10025814 3300025929 Bacteria 4432
160 Ga0207664_10067260 3300025929 Bacteria 2875
161 Ga0207664_10110811 3300025929 Bacteria 2283
162 Ga0207664_10190069 3300025929 Bacteria 1767
163 Ga0207644_10051258 3300025931 Bacteria 2962
164 Ga0207644_10073175 3300025931 Bacteria 2512
165 Ga0207686_10030430 3300025934 Bacteria 3196
166 Ga0207670_10000845 3300025936 Bacteria 16075
167 Ga0207670_10272605 3300025936 Bacteria 1316
168 Ga0207669_10019454 3300025937 Bacteria 3536
169 Ga0207669_10166084 3300025937 Bacteria 1565
170 Ga0207704_10017693 3300025938 Bacteria 3702
171 Ga0207704_10179930 3300025938 Bacteria 1527
172 Ga0207711_10606527 3300025941 Bacteria 1021
173 Ga0207667_10477650 3300025949 Bacteria 1265
174 Ga0207651_10114126 3300025960 Bacteria 2034
175 Ga0207712_10167394 3300025961 Bacteria 1714
176 Ga0207712_10559351 3300025961 Unclassified 985
177 Ga0207640_10058839 3300025981 Bacteria 2533
178 Ga0207658_10056344 3300025986 Bacteria 2917
179 Ga0207658_10098502 3300025986 Bacteria 2285
180 Ga0207677_10260262 3300026023 Bacteria 1414
181 Ga0207703_10060503 3300026035 Bacteria 3097
182 Ga0207639_10119287 3300026041 Bacteria 2164
183 Ga0207639_10207290 3300026041 Bacteria 1685
184 Ga0207678_10037928 3300026067 Bacteria 4190
185 Ga0207678_10173428 3300026067 Bacteria 1841
186 Ga0207702_10000187 3300026078 Bacteria 74357
187 Ga0207702_10498273 3300026078 Bacteria 1187
188 Ga0207641_10000337 3300026088 Bacteria 57031
189 Ga0207641_10330646 3300026088 Bacteria 1447
190 Ga0207641_10344067 3300026088 Bacteria 1420
191 Ga0207648_10093405 3300026089 Bacteria 2631
192 Ga0207648_10137854 3300026089 Bacteria 2149
193 Ga0207648_10316959 3300026089 Bacteria 1401
194 Ga0207676_10183518 3300026095 Bacteria 1834
195 Ga0207675_100005954 3300026118 Bacteria 11620
196 Ga0207675_100569833 3300026118 Bacteria 1133
197 Ga0207683_10122866 3300026121 Bacteria 2332
198 Ga0207683_10273666 3300026121 Bacteria 1543
199 Ga0207683_10307227 3300026121 Bacteria 1452
200 Ga0207698_10804038 3300026142 Bacteria 943
201 Ga0209389_1000010 3300027296 Bacteria 223892
202 Ga0209589_1000016 3300027357 Bacteria 223788
203 Ga0209489_100016 3300027361 Bacteria 223873
204 Ga0209813_10015125 3300027866 Bacteria 2086
205 Ga0268266_10000275 3300028379 Bacteria 85106
206 Ga0268266_10006726 3300028379 Bacteria 10483
207 Ga0268266_10069465 3300028379 Bacteria 3052
208 Ga0268266_10071950 3300028379 Bacteria 2997
209 Ga0268266_10093541 3300028379 Bacteria 2638
210 Ga0268266_10140588 3300028379 Bacteria 2166
211 Ga0268265_10027467 3300028380 Bacteria 4063
212 Ga0268265_10066567 3300028380 Bacteria 2785
213 Ga0268265_10422465 3300028380 Bacteria 1238
214 Ga0268264_10000375 3300028381 Bacteria 65683
215 Ga0268264_10074141 3300028381 Bacteria 2890
216 Ga0268264_10691979 3300028381 Bacteria 1012
217 Ga0265336_10076373 3300028666 Bacteria 1001
218 Ga0265338_10090470 3300028800 Bacteria 2532
219 Ga0265330_10029751 3300031235 Bacteria 2454
220 Ga0265332_10000592 3300031238 Bacteria 23812
221 Ga0265328_10000010 3300031239 Bacteria 163171
222 Ga0265328_10000012 3300031239 Bacteria 157661
223 Ga0265328_10002376 3300031239 Bacteria 8451
224 Ga0265328_10024271 3300031239 Bacteria 2292
225 Ga0265328_10066901 3300031239 Bacteria 1320
226 Ga0265325_10007695 3300031241 Bacteria 6428
227 Ga0265325_10038017 3300031241 Bacteria 2542
228 Ga0265325_10095578 3300031241 Bacteria 1460
229 Ga0265329_10004856 3300031242 Bacteria 5512
230 Ga0265329_10023545 3300031242 Bacteria 2050
231 Ga0265340_10000506 3300031247 Bacteria 21431
232 Ga0265340_10181153 3300031247 Bacteria 952
233 Ga0265339_10000107 3300031249 Bacteria 68261
234 Ga0265339_10001426 3300031249 Bacteria 17728
235 Ga0265331_10001315 3300031250 Bacteria 18423
236 Ga0265331_10013348 3300031250 Bacteria 4421
237 Ga0265327_10004701 3300031251 Bacteria 11931
238 Ga0265316_10003717 3300031344 Bacteria 15360
239 Ga0265316_10031965 3300031344 Bacteria 4300
240 Ga0307513_10067952 3300031456 Bacteria 3736
241 Ga0307513_10140621 3300031456 Bacteria 2341
242 Ga0307513_10158415 3300031456 Bacteria 2160
243 Ga0265313_10000131 3300031595 Bacteria 75926
244 Ga0265313_10103190 3300031595 Bacteria 1263
245 Ga0265314_10004714 3300031711 Bacteria 12518
246 Ga0265314_10013526 3300031711 Bacteria 6588
247 Ga0265342_10000116 3300031712 Bacteria 87805
248 Ga0265342_10102095 3300031712 Bacteria 1632
249 Ga0265342_10137037 3300031712 Bacteria 1368
250 Ga0307413_10155310 3300031824 Bacteria 1600
251 Ga0307413_10302389 3300031824 Bacteria 1214
252 Ga0307409_100149774 3300031995 Bacteria 2024
253 Ga0307409_100198578 3300031995 Bacteria 1792
254 Ga0307409_100631356 3300031995 Bacteria 1063
255 Ga0307416_100282083 3300032002 Bacteria 1638
256 Ga0307414_10402960 3300032004 Bacteria 1189
257 Ga0307411_10157700 3300032005 Bacteria 1695
258 Ga0307415_100061565 3300032126 Bacteria 2599
259 Ga0307510_10088607 3300033180 Bacteria 2953
260 Ga0373930_0009738 3300034816 Bacteria 1706
261 Ga0373959_0036018 3300034820 Bacteria 1020
262 Ga0373926_0175535 3300035083 Bacteria 821
263 Ga0373934_0010894 3300035086 Bacteria 3418
264 Ga0373932_0077584 3300035112 Bacteria 1043
265 Ga0373936_0010438 3300035113 Bacteria 3504
266 Ga0373936_0013323 3300035113 Bacteria 3138
267 Ga0373936_0050949 3300035113 Bacteria 1675
268 Ga0373945_0006568 3300035116 Bacteria 3759
269 Ga0373953_0000673 3300035117 Bacteria 9469
270 Ga0373953_0025074 3300035117 Bacteria 2274
271 Ga0373954_0005265 3300035118 Bacteria 5589
272 Ga0373954_0162269 3300035118 Bacteria 1094
273 Ga0373956_0006410 3300035119 Bacteria 4714
274 Ga0373956_0155210 3300035119 Bacteria 1077
275 Ga0373956_0260717 3300035119 Bacteria 824
276 Ga0373960_0012973 3300035121 Bacteria 2081
277 Ga0373943_0004964 3300035170 Bacteria 6007
278 Ga0373943_0034310 3300035170 Bacteria 2420
279 Ga0373943_0135388 3300035170 Bacteria 1322
280 Ga0373943_0360124 3300035170 Bacteria 835
281 Ga0373946_0037156 3300035171 Bacteria 1978
282 Ga0373946_0149219 3300035171 Bacteria 1089
283 Ga0373955_0001256 3300035172 Bacteria 10785
284 Ga0373955_0027969 3300035172 Bacteria 2920
285 Ga0373955_0147343 3300035172 Bacteria 1384
286 Ga0373942_0006658 3300035207 Bacteria 2668
287 Ga0373924_0011970 3300035410 Bacteria 3232
288 Ga0373924_0014390 3300035410 Bacteria 2989
289 Ga0373931_0002668 3300035691 Bacteria 7930
290 Ga0373931_0044501 3300035691 Bacteria 2341
291 Ga0373935_0002077 3300035692 Bacteria 11354
292 Ga0373935_0034179 3300035692 Bacteria 3168
293 Ga0373927_0002764 3300035695 Bacteria 12811
294 Ga0373927_0013625 3300035695 Bacteria 5398
295 Ga0373927_0019891 3300035695 Bacteria 4402
296 Ga0373927_0026383 3300035695 Bacteria 3796
297 Ga0373927_0200292 3300035695 Bacteria 1311
298 Ga0373927_0254815 3300035695 Bacteria 1154
299 Ga0373933_0001029 3300035724 Bacteria 16948
300 Ga0373933_0042164 3300035724 Bacteria 2697
301 Ga0373933_0080826 3300035724 Bacteria 1993
302 Ga0373933_0082302 3300035724 Bacteria 1975
303 Ga0373947_0002111 3300035725 Bacteria 12118
304 Ga0373947_0003550 3300035725 Bacteria 9204
305 Ga0373947_0329595 3300035725 Bacteria 1022
306 Ga0373947_0372649 3300035725 Bacteria 960
307 Ga0373937_0001173 3300036401 Bacteria 22009
308 Ga0373937_0031691 3300036401 Bacteria 4792
309 Ga0373937_0286831 3300036401 Bacteria 1555
310 Ga0373937_0743069 3300036401 Bacteria 928
311 Ga0373937_0838515 3300036401 Bacteria 868
312 Ga0373925_0000793 3300037068 Bacteria 29112
313 Ga0373925_0032544 3300037068 Bacteria 3839
314 Ga0373925_0557774 3300037068 Bacteria 942
315 Ga0395899_0012445 3300037312 Bacteria 6518
316 Ga0395899_0114629 3300037312 Bacteria 1935
317 Ga0395899_0151361 3300037312 Bacteria 1644
318 Ga0395900_0009060 3300037418 Bacteria 10200
319 Ga0395900_0271765 3300037418 Bacteria 1689
320 Ga0395900_0625099 3300037418 Bacteria 1015
321 Ga0395898_0023199 3300037466 Bacteria 6271
322 Ga0436364_0178653 3300037853 Bacteria 915
323 Ga0436364_0509594 3300037853 Bacteria 2909
324 Ga0436364_0926771 3300037853 Bacteria 2414
325 Ga0436364_1215520 3300037853 Bacteria 1071
326 Ga0436364_1529500 3300037853 Bacteria 1433
327 Ga0395901_0001645 3300038443 Bacteria 23122
328 Ga0395901_0025404 3300038443 Bacteria 6080
329 Ga0395901_0026006 3300038443 Bacteria 6009
330 Ga0395901_0390194 3300038443 Bacteria 1431
331 Ga0395901_0713624 3300038443 Bacteria 999
332 Ga0436365_0430782 3300039437 Bacteria 4716
333 Ga0436365_0830368 3300039437 Bacteria 3181
334 Ga0436360_1352777 3300039438 Bacteria 870
335 Ga0436361_0238565 3300039447 Bacteria 2728
336 Ga0436361_0420967 3300039447 Bacteria 1350
337 Ga0436361_0668079 3300039447 Bacteria 3936
338 Ga0436361_0724097 3300039447 Bacteria 3718
339 Ga0436361_1046016 3300039447 Bacteria 3391
340 Ga0436361_1119238 3300039447 Bacteria 1319
341 Ga0436363_0350608 3300039450 Bacteria 1575
342 Ga0439432_087298 3300042006 Bacteria 941
343 Ga0439462_0091481 3300042015 Bacteria 835
344 Ga0466972_0025874 3300044658 Bacteria 2907
345 Ga0466967_0822135 3300045976 Bacteria 923
346 Ga0495617_004324 3300046452 Bacteria 5179
347 Ga0495592_0002595 3300046454 Bacteria 12764
348 Ga0495592_0008363 3300046454 Bacteria 7763
349 Ga0495592_0084559 3300046454 Bacteria 2289
350 Ga0495603_0000945 3300046455 Bacteria 16710
351 Ga0495629_0002712 3300046459 Bacteria 13554
352 Ga0495629_0021588 3300046459 Bacteria 4594
353 Ga0495629_0213165 3300046459 Bacteria 1333
354 Ga0495638_0024385 3300046460 Bacteria 3944
355 Ga0495641_0003285 3300046461 Bacteria 12210
356 Ga0495651_0000267 3300046462 Bacteria 40466
357 Ga0495651_0028181 3300046462 Bacteria 4377
358 Ga0495651_0328189 3300046462 Bacteria 1018
359 Ga0495653_0000993 3300046463 Bacteria 21848
360 Ga0495653_0009531 3300046463 Bacteria 7944
361 Ga0495580_0002080 3300046472 Bacteria 17567
362 Ga0495582_0000292 3300046473 Bacteria 27639
363 Ga0495605_0068614 3300046474 Bacteria 1680
364 Ga0495639_0001550 3300046475 Bacteria 10259
365 Ga0495662_0000849 3300046476 Bacteria 14884
366 Ga0495662_0034549 3300046476 Bacteria 2440
367 Ga0495662_0156496 3300046476 Bacteria 1122
368 Ga0495664_0000008 3300046477 Bacteria 307158
369 Ga0495664_0001948 3300046477 Bacteria 10995
370 Ga0495664_0083945 3300046477 Bacteria 1911
371 Ga0495584_0013470 3300046491 Bacteria 4175
372 Ga0495594_0001470 3300046499 Bacteria 12230
373 Ga0495594_0186359 3300046499 Bacteria 1182
374 Ga0495608_0000226 3300046511 Bacteria 40663
375 Ga0495608_0000752 3300046511 Bacteria 22646
376 Ga0495610_0029435 3300046512 Bacteria 2892
377 Ga0495618_0000826 3300046514 Bacteria 21563
378 Ga0495618_0002717 3300046514 Bacteria 11271
379 Ga0495618_0005562 3300046514 Bacteria 7668
380 Ga0495618_0190742 3300046514 Bacteria 1300
381 Ga0495618_0215611 3300046514 Bacteria 1212
382 Ga0495628_0000802 3300046516 Bacteria 29022
383 Ga0495628_0182750 3300046516 Bacteria 1585
384 Ga0495628_0210369 3300046516 Bacteria 1463
385 Ga0495628_0273683 3300046516 Bacteria 1255
386 Ga0495630_0005531 3300046517 Bacteria 8918
387 Ga0495630_0007451 3300046517 Bacteria 7821
388 Ga0495630_0098543 3300046517 Bacteria 2211
389 Ga0495630_0162145 3300046517 Bacteria 1702
390 Ga0495630_0304170 3300046517 Bacteria 1219
391 Ga0495643_0030357 3300046522 Bacteria 3018
392 Ga0495648_0004029 3300046524 Bacteria 12688
393 Ga0495652_0000005 3300046529 Bacteria 524368
394 Ga0495652_0031701 3300046529 Bacteria 4626
395 Ga0495652_0098290 3300046529 Bacteria 2380
396 Ga0495652_0216764 3300046529 Bacteria 1441
397 Ga0495665_0007476 3300046531 Bacteria 5911
398 Ga0495640_0000020 3300046533 Bacteria 116618
399 Ga0495640_0001646 3300046533 Bacteria 17676
400 Ga0495640_0019558 3300046533 Bacteria 4995
401 Ga0495640_0042775 3300046533 Bacteria 3158
402 Ga0495640_0053872 3300046533 Bacteria 2757
403 Ga0495586_0008127 3300046535 Bacteria 5595
404 Ga0495586_0098135 3300046535 Bacteria 1624
405 Ga0495587_0000005 3300046536 Bacteria 358412
406 Ga0495587_0001299 3300046536 Bacteria 16601
407 Ga0495587_0033618 3300046536 Bacteria 3095
408 Ga0495645_0000007 3300046543 Bacteria 376299
409 Ga0495645_0001446 3300046543 Bacteria 16039
410 Ga0495645_0167364 3300046543 Bacteria 1515
411 Ga0495622_0000730 3300046557 Bacteria 18608
412 Ga0495667_0000417 3300046559 Bacteria 27353
413 Ga0495667_0000618 3300046559 Bacteria 22683
414 Ga0495667_0024401 3300046559 Bacteria 4072
415 Ga0495634_0001197 3300046642 Bacteria 23919
416 Ga0495634_0004645 3300046642 Bacteria 10700
417 Ga0495634_0014340 3300046642 Bacteria 5718
418 Ga0495634_0017125 3300046642 Bacteria 5175
419 Ga0495634_0056664 3300046642 Bacteria 2617
420 Ga0495635_0000010 3300046663 Bacteria 246385
421 Ga0495635_0007245 3300046663 Bacteria 7749
422 Ga0495635_0012783 3300046663 Bacteria 5879
423 Ga0495635_0084233 3300046663 Bacteria 2176
424 Ga0495635_0139281 3300046663 Bacteria 1653
425 Ga0495588_0001338 3300046674 Bacteria 10527
426 Ga0495657_0006151 3300046675 Bacteria 9408
427 Ga0495599_0000240 3300046678 Bacteria 34600
428 Ga0495599_0008292 3300046678 Bacteria 6319
429 Ga0495599_0219060 3300046678 Bacteria 1165
430 Ga0495623_0001009 3300046679 Bacteria 19010
431 Ga0495623_0044694 3300046679 Bacteria 2814
432 Ga0495623_0176924 3300046679 Bacteria 1242
433 Ga0495646_0000663 3300046680 Bacteria 18904
434 Ga0495646_0250332 3300046680 Bacteria 949
435 Ga0495647_0000586 3300046681 Bacteria 10782
436 Ga0495658_0001493 3300046683 Bacteria 12266
437 Ga0495658_0217937 3300046683 Bacteria 1194
438 Ga0495613_0000652 3300046689 Bacteria 27491
439 Ga0495613_0442760 3300046689 Bacteria 881
440 Ga0495600_0000016 3300046809 Bacteria 111762
441 Ga0495600_0029967 3300046809 Bacteria 3524
442 Ga0495600_0254262 3300046809 Bacteria 1117
443 Ga0495581_0045927 3300047315 Bacteria 2524
444 Ga0495581_0097307 3300047315 Bacteria 1709
445 Ga0495581_0206094 3300047315 Bacteria 1150
446 Ga0495581_0214093 3300047315 Bacteria 1126
447 Ga0495581_0224576 3300047315 Bacteria 1098
448 Ga0495604_0000634 3300047317 Bacteria 30185
449 Ga0495604_0001065 3300047317 Bacteria 22769
450 Ga0495604_0331336 3300047317 Bacteria 1015
451 Ga0495674_0000012 3300047319 Bacteria 270651
452 Ga0495674_0001892 3300047319 Bacteria 20641
453 Ga0495674_0002470 3300047319 Bacteria 18051
454 Ga0495674_0109121 3300047319 Bacteria 2348
455 Ga0495674_0312067 3300047319 Bacteria 1283
456 Ga0495672_0006187 3300047320 Bacteria 9336
457 Ga0495676_0221730 3300047321 Bacteria 1303
458 Ga0495676_0233955 3300047321 Bacteria 1261
459 Ga0495680_0001504 3300047322 Bacteria 25007
460 Ga0495680_0034751 3300047322 Bacteria 4067
461 Ga0495680_0155228 3300047322 Bacteria 1666
462 Ga0495675_0271982 3300047444 Bacteria 1012
463 Ga0495684_0001027 3300047471 Bacteria 22679
464 Ga0495684_0069917 3300047471 Bacteria 2669
465 Ga0495684_0081519 3300047471 Bacteria 2455
466 Ga0495686_0038670 3300047472 Bacteria 3050
467 Ga0495593_0003844 3300047673 Bacteria 8966
468 Ga0495593_0096876 3300047673 Bacteria 1515
469 Ga0495602_0001567 3300048088 Bacteria 22767
470 Ga0495602_0015059 3300048088 Bacteria 7821
471 Ga0495602_0043419 3300048088 Bacteria 4088
472 Ga0495602_0260754 3300048088 Bacteria 1286
473 Ga0495614_0000798 3300048089 Bacteria 13353
474 Ga0496100_0000386 3300048903 Bacteria 21408
475 Ga0496100_0068230 3300048903 Bacteria 2364
476 Ga0496100_0145217 3300048903 Bacteria 1686
477 Ga0496101_0001608 3300048904 Bacteria 13584
478 Ga0496101_0033440 3300048904 Bacteria 3626
479 Ga0496101_0169041 3300048904 Bacteria 1680
480 Ga0496102_0021728 3300048905 Bacteria 5678
481 Ga0496102_0337578 3300048905 Bacteria 1419
482 Ga0496104_0028292 3300048907 Bacteria 5195
483 Ga0496104_0030395 3300048907 Bacteria 5019
484 Ga0496104_0144635 3300048907 Bacteria 2283
485 Ga0496104_0156567 3300048907 Bacteria 2186
486 Ga0496104_0203282 3300048907 Bacteria 1893
487 Ga0496104_0272943 3300048907 Bacteria 1604
488 Ga0496104_0382034 3300048907 Bacteria 1321
489 Ga0496104_0407281 3300048907 Bacteria 1272
490 Ga0496105_0000577 3300048908 Bacteria 24302
491 Ga0496105_0001440 3300048908 Bacteria 16748
492 Ga0496105_0044270 3300048908 Bacteria 3671
493 Ga0496105_0089217 3300048908 Bacteria 2547
494 Ga0496106_0000936 3300048909 Bacteria 21268
495 Ga0496106_0048536 3300048909 Bacteria 3197
496 Ga0496106_0267626 3300048909 Bacteria 1368
497 Ga0496106_0454247 3300048909 Bacteria 1029
498 Ga0496107_0003679 3300048910 Bacteria 10307
499 Ga0496107_0075383 3300048910 Bacteria 2455
500 Ga0496108_0001099 3300048911 Bacteria 21118
501 Ga0496109_0005653 3300048912 Bacteria 10459
502 Ga0496109_0034719 3300048912 Bacteria 4545
503 Ga0496109_0063118 3300048912 Bacteria 3388
504 Ga0496109_0132048 3300048912 Bacteria 2331
505 Ga0496109_0472977 3300048912 Bacteria 1183
506 Ga0496110_0006526 3300048913 Bacteria 9255
507 Ga0496110_0010410 3300048913 Bacteria 7562
508 Ga0496110_0135880 3300048913 Bacteria 2222
509 Ga0496110_0146982 3300048913 Bacteria 2133
510 Ga0496110_0472103 3300048913 Bacteria 1143
511 Ga0496111_0001036 3300048914 Bacteria 15280
512 Ga0496111_0101113 3300048914 Bacteria 2118
513 Ga0496111_0225681 3300048914 Bacteria 1391
514 Ga0496112_0007251 3300048915 Bacteria 9827
515 Ga0496112_0010555 3300048915 Bacteria 8388
516 Ga0496112_0028281 3300048915 Bacteria 5410
517 Ga0496112_0283366 3300048915 Bacteria 1604
518 Ga0496112_0335972 3300048915 Bacteria 1454
519 Ga0496113_0010202 3300048916 Bacteria 6201
520 Ga0496113_0035630 3300048916 Bacteria 3640
521 Ga0496113_0245133 3300048916 Bacteria 1430
522 Ga0496114_0001665 3300048917 Bacteria 16855
523 Ga0496114_0059122 3300048917 Bacteria 3202
524 Ga0496115_0004212 3300048918 Bacteria 10395
525 Ga0496115_0022781 3300048918 Bacteria 4856
526 Ga0496115_0060641 3300048918 Bacteria 3048
527 Ga0496115_0246226 3300048918 Bacteria 1473
528 Ga0496115_0289532 3300048918 Bacteria 1344
529 Ga0496118_0289312 3300048921 Bacteria 907
530 Ga0496119_0002304 3300048922 Bacteria 21104
531 Ga0496122_0029679 3300048925 Bacteria 4604
532 Ga0496123_0001703 3300048926 Bacteria 29387
533 Ga0496124_0178236 3300048927 Bacteria 1638
534 Ga0496125_0055217 3300048928 Bacteria 3238
535 Ga0501031_0147951 3300049568 Bacteria 1534
536 Ga0501034_0005569 3300049571 Bacteria 13720
537 Ga0501034_0037874 3300049571 Bacteria 4884
538 Ga0501038_0297549 3300049574 Bacteria 1267
539 Ga0501039_0063551 3300049575 Bacteria 2860
540 Ga0501039_0123595 3300049575 Bacteria 2029
541 Ga0501040_0034656 3300049576 Bacteria 3419
542 Ga0501040_0040377 3300049576 Bacteria 3175
543 Ga0501040_0204774 3300049576 Bacteria 1401
544 Ga0501041_0066717 3300049577 Bacteria 2205
545 Ga0501041_0107712 3300049577 Bacteria 1728
546 Ga0501042_0055536 3300049578 Bacteria 2827
547 Ga0501042_0271866 3300049578 Bacteria 1224
548 Ga0501043_0190887 3300049579 Bacteria 1593
549 Ga0501046_0181075 3300049580 Bacteria 1576
550 Ga0501048_0000736 3300049582 Bacteria 23987
551 Ga0501068_0006174 3300049584 Bacteria 6592
552 Ga0501071_0233973 3300049587 Bacteria 1385
553 Ga0501074_0433417 3300049590 Bacteria 932
554 Ga0501075_0104615 3300049591 Bacteria 2151
555 Ga0501075_0135814 3300049591 Bacteria 1874
556 Ga0501075_0185018 3300049591 Bacteria 1589
557 Ga0501077_0037456 3300049593 Bacteria 3088
558 Ga0501077_0038511 3300049593 Bacteria 3044
559 Ga0501079_0140869 3300049741 Bacteria 1879
560 Ga0501079_0556996 3300049741 Bacteria 902
561 Ga0501081_0006724 3300049743 Bacteria 7477
562 Ga0501081_0044717 3300049743 Bacteria 3040
563 Ga0501081_0163142 3300049743 Bacteria 1606
564 Ga0501083_0110068 3300049744 Bacteria 1811
565 Ga0501083_0119140 3300049744 Bacteria 1732
566 Ga0501045_0047311 3300049824 Bacteria 3133
567 Ga0501045_0155339 3300049824 Bacteria 1702
568 nmdc:mga03683_139443_c1 3300050489 Bacteria 1089
569 nmdc:mga03683_608_c1 3300050489 Bacteria 6593
570 nmdc:mga03n38_137420_c1 3300050490 Bacteria 1217
571 nmdc:mga00v17_49851_c1 3300050491 Bacteria 2541
572 nmdc:mga0yw44_198467_c1 3300050492 Bacteria 1325
573 nmdc:mga0yw44_210721_c1 3300050492 Bacteria 1285
574 nmdc:mga0yw44_2155_c1 3300050492 Bacteria 8263
575 nmdc:mga0yw44_34864_c2 3300050492 Bacteria 1521
576 nmdc:mga0yw44_48183_c1 3300050492 Bacteria 2569
577 nmdc:mga0yw44_85727_c1 3300050492 Bacteria 1982
578 nmdc:mga0yw44_87507_c2 3300050492 Bacteria 1001
579 nmdc:mga06z11_305669_c1 3300050494 Bacteria 946
580 nmdc:mga04h51_153981_c1 3300050495 Bacteria 880
581 nmdc:mga04h51_24987_c1 3300050495 Bacteria 1835
582 nmdc:mga07m45_243067_c1 3300050496 Bacteria 1047
583 nmdc:mga07m45_33114_c1 3300050496 Bacteria 2869
584 nmdc:mga07m45_69532_c1 3300050496 Bacteria 2001
585 nmdc:mga05p37_267208_c1 3300050507 Bacteria 2045
586 nmdc:mga09592_304303_c1 3300050508 Bacteria 1382
587 nmdc:mga06r32_24791_c1 3300050510 Bacteria 5574
588 nmdc:mga06r32_50085_c1 3300050510 Bacteria 3995
589 nmdc:mga08y16_387316_c1 3300050511 Bacteria 1432
590 nmdc:mga0sz30_100888_c1 3300050516 Bacteria 1261
591 nmdc:mga0sz30_17589_c1 3300050516 Bacteria 2191
592 nmdc:mga0sz30_2513_c1 3300050516 Bacteria 6540
593 Ga0495601_0000011 3300053077 Bacteria 264937
594 Ga0495601_0000880 3300053077 Bacteria 16384
595 Ga0495601_0006281 3300053077 Bacteria 6941
596 Ga0495601_0017335 3300053077 Bacteria 4369
597 Ga0495601_0041000 3300053077 Bacteria 2901
598 Ga0495601_0049794 3300053077 Bacteria 2642
599 Ga0495612_0002032 3300053078 Bacteria 8338
600 Ga0495612_0002357 3300053078 Bacteria 7780
601 Ga0495612_0006886 3300053078 Bacteria 4651
602 Ga0495595_0000308 3300053084 Bacteria 19036
603 Ga0495595_0000906 3300053084 Bacteria 11427
604 Ga0495595_0024263 3300053084 Bacteria 2678
605 Ga0495595_0070098 3300053084 Bacteria 1656
606 Ga0495619_0000013 3300053085 Bacteria 264865
607 Ga0495619_0001242 3300053085 Bacteria 16698
608 Ga0495619_0003116 3300053085 Bacteria 10755
609 Ga0495619_0005937 3300053085 Bacteria 7731
610 Ga0495619_0010198 3300053085 Bacteria 5918
611 Ga0495619_0070547 3300053085 Bacteria 2336
612 Ga0500644_0196970 3300053088 Bacteria 832
613 Ga0500641_0003638 3300053096 Bacteria 5445
614 Ga0500556_0000148 3300053104 Bacteria 58772
615 Ga0500556_0000229 3300053104 Bacteria 45380
616 Ga0500595_007088 3300053119 Bacteria 4687
617 Ga0500642_0105162 3300053130 Bacteria 1316
618 Ga0500559_0000528 3300053136 Bacteria 26610
619 Ga0500568_0041547 3300053139 Bacteria 1847
620 Ga0500577_0074434 3300053142 Bacteria 1340
621 Ga0500616_0113986 3300053153 Bacteria 1301
622 Ga0500636_0032012 3300053177 Bacteria 3112
623 Ga0500576_031015 3300053725 Bacteria 2429
624 Ga0501084_0004692 3300054114 Bacteria 11162
625 Ga0501084_0016658 3300054114 Bacteria 6105
626 Ga0501084_0325150 3300054114 Bacteria 1299
627 Ga0501082_0034656 3300060353 Bacteria 4351
628 Ga0501082_0068633 3300060353 Bacteria 3052
629 Ga0530510_0025629 3300061734 Bacteria 4217

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_1352777 Ga0436360_1352777_33_701 195
2 3300035725 Ga0373947_0372649 Ga0373947_0372649_230_910 221
3 3300005467 Ga0070706_100503280 Ga0070706_1005032801 224
4 3300005548 Ga0070665_100005880 Ga0070665_1000058805 228
5 3300031995 Ga0307409_100149774 Ga0307409_1001497742 228
6 3300035695 Ga0373927_0254815 Ga0373927_0254815_108_872 228
7 3300037068 Ga0373925_0032544 Ga0373925_0032544_1282_2046 228
8 3300035695 Ga0373927_0013625 Ga0373927_0013625_804_1568 231
9 3300047472 Ga0495686_0038670 Ga0495686_0038670_1353_2111 231
10 3300037853 Ga0436364_0178653 Ga0436364_0178653_192_902 232
11 3300048927 Ga0496124_0178236 Ga0496124_0178236_774_1562 232
12 3300048928 Ga0496125_0055217 Ga0496125_0055217_37_825 232
13 3300050492 nmdc:mga0yw44_210721_c1 nmdc:mga0yw44_210721_c1_131_898 232
14 3300042006 Ga0439432_087298 Ga0439432_087298_21_728 233
15 3300042015 Ga0439462_0091481 Ga0439462_0091481_94_801 233
16 3300046474 Ga0495605_0068614 Ga0495605_0068614_31_738 233
17 3300046522 Ga0495643_0030357 Ga0495643_0030357_32_739 233
18 3300048907 Ga0496104_0144635 Ga0496104_0144635_1254_2015 233
19 3300038443 Ga0395901_0713624 Ga0395901_0713624_144_905 234
20 3300047317 Ga0495604_0331336 Ga0495604_0331336_36_746 234
21 3300049578 Ga0501042_0055536 Ga0501042_0055536_136_933 235
22 3300049591 Ga0501075_0185018 Ga0501075_0185018_763_1560 235
23 3300054114 Ga0501084_0325150 Ga0501084_0325150_361_1125 235
24 3300037312 Ga0395899_0151361 Ga0395899_0151361_364_1182 237
25 3300014326 Ga0157380_10102442 Ga0157380_101024422 238
26 3300006038 Ga0075365_10160025 Ga0075365_101600252 242
27 3300009553 Ga0105249_10712514 Ga0105249_107125141 242
28 3300025901 Ga0207688_10083867 Ga0207688_100838671 242
29 3300050492 nmdc:mga0yw44_85727_c1 nmdc:mga0yw44_85727_c1_833_1654 242
30 3300026118 Ga0207675_100569833 Ga0207675_1005698332 243
31 3300035118 Ga0373954_0162269 Ga0373954_0162269_41_838 243
32 3300036401 Ga0373937_0286831 Ga0373937_0286831_308_1105 243
33 3300046514 Ga0495618_0215611 Ga0495618_0215611_238_1035 243
34 3300046529 Ga0495652_0216764 Ga0495652_0216764_205_1002 243
35 3300046663 Ga0495635_0139281 Ga0495635_0139281_268_1065 243
36 3300046809 Ga0495600_0254262 Ga0495600_0254262_28_792 243
37 3300048915 Ga0496112_0283366 Ga0496112_0283366_475_1239 243
38 3300048915 Ga0496112_0335972 Ga0496112_0335972_429_1190 243
39 3300053077 Ga0495601_0017335 Ga0495601_0017335_1513_2310 243
40 3300053084 Ga0495595_0024263 Ga0495595_0024263_1046_1843 243
41 3300053085 Ga0495619_0070547 Ga0495619_0070547_96_893 243
42 3300006042 Ga0075368_10092230 Ga0075368_100922302 244
43 3300050495 nmdc:mga04h51_153981_c1 nmdc:mga04h51_153981_c1_17_781 244
44 3300031995 Ga0307409_100198578 Ga0307409_1001985781 245
45 3300046452 Ga0495617_004324 Ga0495617_004324_2142_2903 245
46 iso_pu_bacteria 2883577096 2883579824 245
47 3300050494 nmdc:mga06z11_305669_c1 nmdc:mga06z11_305669_c1_56_844 246
48 iso_pu_bacteria 2842694124 2842698133 246
49 iso_pu_bacteria 3003665799 3003667977 246
50 3300039447 Ga0436361_0238565 Ga0436361_0238565_1355_2098 247
51 iso_pu_bacteria 2508501050 2508735921 247
52 iso_pu_bacteria 2508501114 2509078361 247
53 iso_pu_bacteria 2513237087 2513594010 247
54 iso_pu_bacteria 2545555834 2545677801 247
55 iso_pu_bacteria 2597490356 2599105875 247
56 iso_pu_bacteria 2643221558 2643813866 247
57 iso_pu_bacteria 2773857925 2774871283 247
58 iso_pu_bacteria 2775506901 2776259565 247
59 iso_pu_bacteria 2818991467 2819720438 247
60 iso_pu_bacteria 2821443989 2821447924 247
61 iso_pu_bacteria 2835312727 2835315376 247
62 iso_pu_bacteria 2841911363 2841915658 247
63 iso_pu_bacteria 2841917233 2841920860 247
64 iso_pu_bacteria 2842333319 2842337323 247
65 iso_pu_bacteria 2842698319 2842703264 247
66 iso_pu_bacteria 2844533157 2844533572 247
67 iso_pu_bacteria 2846952575 2846955659 247
68 iso_pu_bacteria 2848858292 2848862356 247
69 iso_pu_bacteria 2882456835 2882462444 247
70 iso_pu_bacteria 2894232714 2894238819 247
71 iso_pu_bacteria 2909042592 2909042693 247
72 iso_pu_bacteria 641522639 641642668 247
73 iso_pu_bacteria 643348564 643599895 247
74 iso_pu_bacteria 8002060224 8002063720 247
75 iso_pu_bacteria 8054002106 8054006785 247
76 3300005434 Ga0070709_10035830 Ga0070709_100358302 248
77 3300005435 Ga0070714_100000887 Ga0070714_10000088711 248
78 3300005436 Ga0070713_100068263 Ga0070713_1000682632 248
79 3300005437 Ga0070710_10013882 Ga0070710_100138822 248
80 3300025906 Ga0207699_10028993 Ga0207699_100289932 248
81 3300025915 Ga0207693_10067985 Ga0207693_100679852 248
82 3300025928 Ga0207700_10699050 Ga0207700_106990501 248
83 3300025929 Ga0207664_10013831 Ga0207664_100138317 248
84 iso_pu_bacteria 2524023250 2524612688 248
85 3300035172 Ga0373955_0147343 Ga0373955_0147343_159_914 249
86 3300006942 Ga0099824_1005450 Ga0099824_100545011 250
87 3300027296 Ga0209389_1000010 Ga0209389_1000010111 250
88 3300027357 Ga0209589_1000016 Ga0209589_1000016103 250
89 3300027361 Ga0209489_100016 Ga0209489_100016111 250
90 3300037853 Ga0436364_0509594 Ga0436364_0509594_2025_2801 250
91 3300037853 Ga0436364_0926771 Ga0436364_0926771_308_1060 250
92 3300047320 Ga0495672_0006187 Ga0495672_0006187_1395_2153 250
93 3300049578 Ga0501042_0271866 Ga0501042_0271866_43_813 250
94 3300003316 rootH1_10051438 rootH1_100514382 251
95 3300003320 rootH2_10064931 rootH2_100649314 251
96 3300003322 rootL2_10285924 rootL2_102859243 251
97 3300003354 JGI25160J50197_1008385 JGI25160J50197_10083853 251
98 3300005327 Ga0070658_10068440 Ga0070658_100684403 251
99 3300005328 Ga0070676_10187874 Ga0070676_101878741 251
100 3300005335 Ga0070666_10110658 Ga0070666_101106583 251
101 3300005337 Ga0070682_100022805 Ga0070682_1000228053 251
102 3300005338 Ga0068868_100404277 Ga0068868_1004042772 251
103 3300005340 Ga0070689_100000836 Ga0070689_1000008367 251
104 3300005340 Ga0070689_100301370 Ga0070689_1003013702 251
105 3300005341 Ga0070691_10010035 Ga0070691_100100354 251
106 3300005344 Ga0070661_100322926 Ga0070661_1003229262 251
107 3300005353 Ga0070669_100331954 Ga0070669_1003319541 251
108 3300005354 Ga0070675_100059625 Ga0070675_1000596254 251
109 3300005355 Ga0070671_100000729 Ga0070671_1000007294 251
110 3300005355 Ga0070671_100018992 Ga0070671_1000189925 251
111 3300005356 Ga0070674_100222139 Ga0070674_1002221392 251
112 3300005356 Ga0070674_100439331 Ga0070674_1004393312 251
113 3300005364 Ga0070673_100001534 Ga0070673_10000153411 251
114 3300005364 Ga0070673_100108649 Ga0070673_1001086493 251
115 3300005365 Ga0070688_100055045 Ga0070688_1000550452 251
116 3300005366 Ga0070659_100136961 Ga0070659_1001369612 251
117 3300005434 Ga0070709_10241168 Ga0070709_102411682 251
118 3300005435 Ga0070714_100030751 Ga0070714_1000307513 251
119 3300005435 Ga0070714_100215794 Ga0070714_1002157942 251
120 3300005437 Ga0070710_10158131 Ga0070710_101581312 251
121 3300005439 Ga0070711_100551973 Ga0070711_1005519732 251
122 3300005456 Ga0070678_100118972 Ga0070678_1001189722 251
123 3300005458 Ga0070681_10079651 Ga0070681_100796513 251
124 3300005459 Ga0068867_100110763 Ga0068867_1001107633 251
125 3300005459 Ga0068867_100519769 Ga0068867_1005197691 251
126 3300005543 Ga0070672_100315775 Ga0070672_1003157752 251
127 3300005548 Ga0070665_100000949 Ga0070665_10000094919 251
128 3300005548 Ga0070665_100014232 Ga0070665_1000142326 251
129 3300005548 Ga0070665_100029921 Ga0070665_1000299212 251
130 3300005548 Ga0070665_100215600 Ga0070665_1002156002 251
131 3300005548 Ga0070665_100365637 Ga0070665_1003656372 251
132 3300005563 Ga0068855_100060491 Ga0068855_1000604913 251
133 3300005614 Ga0068856_100446042 Ga0068856_1004460422 251
134 3300005615 Ga0070702_100053730 Ga0070702_1000537302 251
135 3300005616 Ga0068852_100082282 Ga0068852_1000822822 251
136 3300005616 Ga0068852_100510218 Ga0068852_1005102182 251
137 3300005617 Ga0068859_100058638 Ga0068859_1000586383 251
138 3300005618 Ga0068864_100307300 Ga0068864_1003073003 251
139 3300005719 Ga0068861_100003608 Ga0068861_1000036088 251
140 3300005841 Ga0068863_100014040 Ga0068863_1000140404 251
141 3300005841 Ga0068863_100221376 Ga0068863_1002213762 251
142 3300005842 Ga0068858_100026651 Ga0068858_1000266515 251
143 3300005843 Ga0068860_100000498 Ga0068860_10000049815 251
144 3300005843 Ga0068860_100887706 Ga0068860_1008877061 251
145 3300005844 Ga0068862_100094272 Ga0068862_1000942722 251
146 3300005844 Ga0068862_100103938 Ga0068862_1001039384 251
147 3300005937 Ga0081455_10015010 Ga0081455_100150105 251
148 3300005983 Ga0081540_1040673 Ga0081540_10406732 251
149 3300005985 Ga0081539_10011961 Ga0081539_100119613 251
150 3300006028 Ga0070717_10049133 Ga0070717_100491333 251
151 3300006028 Ga0070717_10229637 Ga0070717_102296372 251
152 3300006038 Ga0075365_10008616 Ga0075365_100086163 251
153 3300006038 Ga0075365_10027464 Ga0075365_100274643 251
154 3300006038 Ga0075365_10074189 Ga0075365_100741893 251
155 3300006042 Ga0075368_10011576 Ga0075368_100115764 251
156 3300006048 Ga0075363_100300867 Ga0075363_1003008671 251
157 3300006051 Ga0075364_10068997 Ga0075364_100689973 251
158 3300006051 Ga0075364_10181486 Ga0075364_101814862 251
159 3300006051 Ga0075364_10195701 Ga0075364_101957012 251
160 3300006175 Ga0070712_100002004 Ga0070712_10000200410 251
161 3300006175 Ga0070712_100006459 Ga0070712_1000064597 251
162 3300006177 Ga0075362_10023530 Ga0075362_100235302 251
163 3300006177 Ga0075362_10035302 Ga0075362_100353023 251
164 3300006177 Ga0075362_10084977 Ga0075362_100849772 251
165 3300006177 Ga0075362_10169821 Ga0075362_101698212 251
166 3300006178 Ga0075367_10031561 Ga0075367_100315613 251
167 3300006178 Ga0075367_10128726 Ga0075367_101287262 251
168 3300006186 Ga0075369_10000191 Ga0075369_1000019112 251
169 3300006186 Ga0075369_10025034 Ga0075369_100250342 251
170 3300006186 Ga0075369_10055635 Ga0075369_100556352 251
171 3300006353 Ga0075370_10024076 Ga0075370_100240762 251
172 3300006844 Ga0075428_100354102 Ga0075428_1003541022 251
173 3300006844 Ga0075428_100371366 Ga0075428_1003713662 251
174 3300006847 Ga0075431_100055397 Ga0075431_1000553974 251
175 3300006880 Ga0075429_100322665 Ga0075429_1003226652 251
176 3300006881 Ga0068865_100077156 Ga0068865_1000771562 251
177 3300006931 Ga0097620_100058638 Ga0097620_1000586383 251
178 3300009093 Ga0105240_10028349 Ga0105240_100283498 251
179 3300009093 Ga0105240_10032124 Ga0105240_100321243 251
180 3300009093 Ga0105240_10040314 Ga0105240_100403147 251
181 3300009098 Ga0105245_10244357 Ga0105245_102443572 251
182 3300009101 Ga0105247_10006940 Ga0105247_100069405 251
183 3300009147 Ga0114129_10168319 Ga0114129_101683193 251
184 3300009176 Ga0105242_10142337 Ga0105242_101423372 251
185 3300009177 Ga0105248_10037714 Ga0105248_100377145 251
186 3300009545 Ga0105237_10062589 Ga0105237_100625895 251
187 3300009551 Ga0105238_10002503 Ga0105238_100025035 251
188 3300009551 Ga0105238_10017647 Ga0105238_100176478 251
189 3300009551 Ga0105238_10055519 Ga0105238_100555194 251
190 3300009553 Ga0105249_10169368 Ga0105249_101693683 251
191 3300010159 Ga0099796_10115115 Ga0099796_101151151 251
192 3300010375 Ga0105239_10310738 Ga0105239_103107383 251
193 3300013102 Ga0157371_10075255 Ga0157371_100752552 251
194 3300013104 Ga0157370_10082385 Ga0157370_100823852 251
195 3300013104 Ga0157370_10120794 Ga0157370_101207942 251
196 3300013296 Ga0157374_10369851 Ga0157374_103698511 251
197 3300013306 Ga0163162_10032837 Ga0163162_100328377 251
198 3300013306 Ga0163162_10214597 Ga0163162_102145972 251
199 3300013307 Ga0157372_10056501 Ga0157372_100565014 251
200 3300013307 Ga0157372_11074117 Ga0157372_110741171 251
201 3300013308 Ga0157375_10008448 Ga0157375_100084489 251
202 3300013308 Ga0157375_10584869 Ga0157375_105848692 251
203 3300014325 Ga0163163_10009024 Ga0163163_100090244 251
204 3300014325 Ga0163163_10074549 Ga0163163_100745494 251
205 3300014745 Ga0157377_10130682 Ga0157377_101306822 251
206 3300014968 Ga0157379_10005706 Ga0157379_100057064 251
207 3300014968 Ga0157379_10193567 Ga0157379_101935672 251
208 3300014968 Ga0157379_10288672 Ga0157379_102886722 251
209 3300014969 Ga0157376_10006310 Ga0157376_100063109 251
210 3300014969 Ga0157376_10135454 Ga0157376_101354543 251
211 3300021361 Ga0213872_10031469 Ga0213872_100314692 251
212 3300021384 Ga0213876_10160076 Ga0213876_101600762 251
213 3300024227 Ga0228598_1000865 Ga0228598_10008654 251
214 3300025272 Ga0209455_1017760 Ga0209455_10177603 251
215 3300025284 Ga0209130_1000270 Ga0209130_100027021 251
216 3300025294 Ga0209025_1000705 Ga0209025_100070519 251
217 3300025297 Ga0209758_1004689 Ga0209758_10046893 251
218 3300025302 Ga0207426_1000443 Ga0207426_100044353 251
219 3300025898 Ga0207692_10219764 Ga0207692_102197642 251
220 3300025900 Ga0207710_10008591 Ga0207710_100085912 251
221 3300025906 Ga0207699_10010696 Ga0207699_100106962 251
222 3300025906 Ga0207699_10078197 Ga0207699_100781972 251
223 3300025906 Ga0207699_10234391 Ga0207699_102343911 251
224 3300025913 Ga0207695_10109316 Ga0207695_101093163 251
225 3300025915 Ga0207693_10001484 Ga0207693_100014842 251
226 3300025915 Ga0207693_10013542 Ga0207693_100135426 251
227 3300025915 Ga0207693_10073706 Ga0207693_100737063 251
228 3300025915 Ga0207693_10212348 Ga0207693_102123482 251
229 3300025917 Ga0207660_10285434 Ga0207660_102854342 251
230 3300025920 Ga0207649_10169935 Ga0207649_101699351 251
231 3300025920 Ga0207649_10481192 Ga0207649_104811921 251
232 3300025925 Ga0207650_10010860 Ga0207650_100108606 251
233 3300025927 Ga0207687_10653890 Ga0207687_106538902 251
234 3300025928 Ga0207700_10093217 Ga0207700_100932173 251
235 3300025928 Ga0207700_10285224 Ga0207700_102852242 251
236 3300025929 Ga0207664_10025814 Ga0207664_100258144 251
237 3300025929 Ga0207664_10067260 Ga0207664_100672602 251
238 3300025929 Ga0207664_10110811 Ga0207664_101108113 251
239 3300025929 Ga0207664_10190069 Ga0207664_101900692 251
240 3300025931 Ga0207644_10051258 Ga0207644_100512584 251
241 3300025931 Ga0207644_10073175 Ga0207644_100731752 251
242 3300025934 Ga0207686_10030430 Ga0207686_100304303 251
243 3300025936 Ga0207670_10000845 Ga0207670_100008457 251
244 3300025936 Ga0207670_10272605 Ga0207670_102726052 251
245 3300025937 Ga0207669_10019454 Ga0207669_100194543 251
246 3300025937 Ga0207669_10166084 Ga0207669_101660842 251
247 3300025938 Ga0207704_10017693 Ga0207704_100176932 251
248 3300025938 Ga0207704_10179930 Ga0207704_101799302 251
249 3300025941 Ga0207711_10606527 Ga0207711_106065272 251
250 3300025949 Ga0207667_10477650 Ga0207667_104776502 251
251 3300025960 Ga0207651_10114126 Ga0207651_101141263 251
252 3300025961 Ga0207712_10167394 Ga0207712_101673943 251
253 3300025961 Ga0207712_10559351 Ga0207712_105593512 251
254 3300025981 Ga0207640_10058839 Ga0207640_100588393 251
255 3300025986 Ga0207658_10056344 Ga0207658_100563443 251
256 3300025986 Ga0207658_10098502 Ga0207658_100985022 251
257 3300026023 Ga0207677_10260262 Ga0207677_102602622 251
258 3300026035 Ga0207703_10060503 Ga0207703_100605033 251
259 3300026041 Ga0207639_10119287 Ga0207639_101192872 251
260 3300026041 Ga0207639_10207290 Ga0207639_102072902 251
261 3300026067 Ga0207678_10037928 Ga0207678_100379283 251
262 3300026067 Ga0207678_10173428 Ga0207678_101734283 251
263 3300026078 Ga0207702_10000187 Ga0207702_1000018714 251
264 3300026078 Ga0207702_10498273 Ga0207702_104982732 251
265 3300026088 Ga0207641_10000337 Ga0207641_1000033719 251
266 3300026088 Ga0207641_10330646 Ga0207641_103306461 251
267 3300026088 Ga0207641_10344067 Ga0207641_103440672 251
268 3300026089 Ga0207648_10093405 Ga0207648_100934053 251
269 3300026089 Ga0207648_10137854 Ga0207648_101378542 251
270 3300026089 Ga0207648_10316959 Ga0207648_103169592 251
271 3300026095 Ga0207676_10183518 Ga0207676_101835183 251
272 3300026118 Ga0207675_100005954 Ga0207675_1000059545 251
273 3300026121 Ga0207683_10122866 Ga0207683_101228663 251
274 3300026121 Ga0207683_10273666 Ga0207683_102736662 251
275 3300026121 Ga0207683_10307227 Ga0207683_103072272 251
276 3300026142 Ga0207698_10804038 Ga0207698_108040381 251
277 3300027866 Ga0209813_10015125 Ga0209813_100151252 251
278 3300028379 Ga0268266_10000275 Ga0268266_1000027556 251
279 3300028379 Ga0268266_10006726 Ga0268266_100067266 251
280 3300028379 Ga0268266_10069465 Ga0268266_100694653 251
281 3300028379 Ga0268266_10071950 Ga0268266_100719502 251
282 3300028379 Ga0268266_10093541 Ga0268266_100935412 251
283 3300028379 Ga0268266_10140588 Ga0268266_101405883 251
284 3300028380 Ga0268265_10027467 Ga0268265_100274675 251
285 3300028380 Ga0268265_10066567 Ga0268265_100665673 251
286 3300028380 Ga0268265_10422465 Ga0268265_104224652 251
287 3300028381 Ga0268264_10000375 Ga0268264_100003758 251
288 3300028381 Ga0268264_10074141 Ga0268264_100741412 251
289 3300028381 Ga0268264_10691979 Ga0268264_106919791 251
290 3300028666 Ga0265336_10076373 Ga0265336_100763732 251
291 3300028800 Ga0265338_10090470 Ga0265338_100904702 251
292 3300031235 Ga0265330_10029751 Ga0265330_100297513 251
293 3300031238 Ga0265332_10000592 Ga0265332_1000059218 251
294 3300031239 Ga0265328_10000010 Ga0265328_1000001069 251
295 3300031239 Ga0265328_10000012 Ga0265328_10000012122 251
296 3300031239 Ga0265328_10002376 Ga0265328_100023768 251
297 3300031239 Ga0265328_10024271 Ga0265328_100242712 251
298 3300031239 Ga0265328_10066901 Ga0265328_100669012 251
299 3300031241 Ga0265325_10007695 Ga0265325_100076956 251
300 3300031241 Ga0265325_10038017 Ga0265325_100380172 251
301 3300031241 Ga0265325_10095578 Ga0265325_100955781 251
302 3300031242 Ga0265329_10004856 Ga0265329_100048563 251
303 3300031242 Ga0265329_10023545 Ga0265329_100235453 251
304 3300031247 Ga0265340_10000506 Ga0265340_1000050613 251
305 3300031247 Ga0265340_10181153 Ga0265340_101811531 251
306 3300031249 Ga0265339_10000107 Ga0265339_1000010728 251
307 3300031249 Ga0265339_10001426 Ga0265339_100014265 251
308 3300031250 Ga0265331_10001315 Ga0265331_1000131518 251
309 3300031250 Ga0265331_10013348 Ga0265331_100133483 251
310 3300031251 Ga0265327_10004701 Ga0265327_100047012 251
311 3300031344 Ga0265316_10003717 Ga0265316_1000371714 251
312 3300031344 Ga0265316_10031965 Ga0265316_100319655 251
313 3300031456 Ga0307513_10067952 Ga0307513_100679522 251
314 3300031456 Ga0307513_10140621 Ga0307513_101406213 251
315 3300031456 Ga0307513_10158415 Ga0307513_101584152 251
316 3300031595 Ga0265313_10000131 Ga0265313_1000013134 251
317 3300031595 Ga0265313_10103190 Ga0265313_101031901 251
318 3300031711 Ga0265314_10004714 Ga0265314_100047149 251
319 3300031711 Ga0265314_10013526 Ga0265314_100135264 251
320 3300031712 Ga0265342_10000116 Ga0265342_1000011635 251
321 3300031712 Ga0265342_10102095 Ga0265342_101020952 251
322 3300031712 Ga0265342_10137037 Ga0265342_101370372 251
323 3300031824 Ga0307413_10155310 Ga0307413_101553103 251
324 3300031824 Ga0307413_10302389 Ga0307413_103023892 251
325 3300031995 Ga0307409_100631356 Ga0307409_1006313561 251
326 3300032002 Ga0307416_100282083 Ga0307416_1002820833 251
327 3300032004 Ga0307414_10402960 Ga0307414_104029602 251
328 3300032005 Ga0307411_10157700 Ga0307411_101577003 251
329 3300032126 Ga0307415_100061565 Ga0307415_1000615652 251
330 3300033180 Ga0307510_10088607 Ga0307510_100886073 251
331 3300034816 Ga0373930_0009738 Ga0373930_0009738_527_1288 251
332 3300034820 Ga0373959_0036018 Ga0373959_0036018_114_875 251
333 3300035083 Ga0373926_0175535 Ga0373926_0175535_16_777 251
334 3300035086 Ga0373934_0010894 Ga0373934_0010894_559_1320 251
335 3300035112 Ga0373932_0077584 Ga0373932_0077584_249_1010 251
336 3300035113 Ga0373936_0010438 Ga0373936_0010438_2529_3284 251
337 3300035113 Ga0373936_0013323 Ga0373936_0013323_2115_2876 251
338 3300035113 Ga0373936_0050949 Ga0373936_0050949_92_853 251
339 3300035116 Ga0373945_0006568 Ga0373945_0006568_1730_2491 251
340 3300035117 Ga0373953_0000673 Ga0373953_0000673_6231_7022 251
341 3300035117 Ga0373953_0025074 Ga0373953_0025074_37_798 251
342 3300035118 Ga0373954_0005265 Ga0373954_0005265_911_1672 251
343 3300035119 Ga0373956_0006410 Ga0373956_0006410_69_830 251
344 3300035119 Ga0373956_0155210 Ga0373956_0155210_155_946 251
345 3300035119 Ga0373956_0260717 Ga0373956_0260717_44_805 251
346 3300035121 Ga0373960_0012973 Ga0373960_0012973_1159_1920 251
347 3300035170 Ga0373943_0004964 Ga0373943_0004964_4169_4960 251
348 3300035170 Ga0373943_0034310 Ga0373943_0034310_1113_1874 251
349 3300035170 Ga0373943_0135388 Ga0373943_0135388_181_942 251
350 3300035170 Ga0373943_0360124 Ga0373943_0360124_32_793 251
351 3300035171 Ga0373946_0037156 Ga0373946_0037156_215_1006 251
352 3300035171 Ga0373946_0149219 Ga0373946_0149219_44_805 251
353 3300035172 Ga0373955_0001256 Ga0373955_0001256_6759_7550 251
354 3300035172 Ga0373955_0027969 Ga0373955_0027969_633_1394 251
355 3300035207 Ga0373942_0006658 Ga0373942_0006658_1087_1848 251
356 3300035410 Ga0373924_0011970 Ga0373924_0011970_1335_2096 251
357 3300035410 Ga0373924_0014390 Ga0373924_0014390_1952_2743 251
358 3300035691 Ga0373931_0002668 Ga0373931_0002668_5099_5860 251
359 3300035691 Ga0373931_0044501 Ga0373931_0044501_1182_1943 251
360 3300035692 Ga0373935_0002077 Ga0373935_0002077_3405_4196 251
361 3300035692 Ga0373935_0034179 Ga0373935_0034179_903_1664 251
362 3300035695 Ga0373927_0002764 Ga0373927_0002764_7215_7976 251
363 3300035695 Ga0373927_0019891 Ga0373927_0019891_153_944 251
364 3300035695 Ga0373927_0026383 Ga0373927_0026383_163_924 251
365 3300035695 Ga0373927_0200292 Ga0373927_0200292_474_1235 251
366 3300035724 Ga0373933_0001029 Ga0373933_0001029_9136_9897 251
367 3300035724 Ga0373933_0042164 Ga0373933_0042164_537_1295 251
368 3300035724 Ga0373933_0080826 Ga0373933_0080826_645_1409 251
369 3300035724 Ga0373933_0082302 Ga0373933_0082302_236_1027 251
370 3300035725 Ga0373947_0002111 Ga0373947_0002111_6846_7607 251
371 3300035725 Ga0373947_0003550 Ga0373947_0003550_7943_8704 251
372 3300035725 Ga0373947_0329595 Ga0373947_0329595_44_814 251
373 3300036401 Ga0373937_0001173 Ga0373937_0001173_5792_6553 251
374 3300036401 Ga0373937_0031691 Ga0373937_0031691_505_1263 251
375 3300036401 Ga0373937_0743069 Ga0373937_0743069_88_849 251
376 3300036401 Ga0373937_0838515 Ga0373937_0838515_13_774 251
377 3300037068 Ga0373925_0000793 Ga0373925_0000793_10235_11026 251
378 3300037068 Ga0373925_0557774 Ga0373925_0557774_76_837 251
379 3300037312 Ga0395899_0012445 Ga0395899_0012445_3959_4717 251
380 3300037312 Ga0395899_0114629 Ga0395899_0114629_385_1143 251
381 3300037418 Ga0395900_0009060 Ga0395900_0009060_2029_2787 251
382 3300037418 Ga0395900_0271765 Ga0395900_0271765_772_1530 251
383 3300037418 Ga0395900_0625099 Ga0395900_0625099_132_890 251
384 3300037466 Ga0395898_0023199 Ga0395898_0023199_1472_2230 251
385 3300037853 Ga0436364_1215520 Ga0436364_1215520_186_962 251
386 3300037853 Ga0436364_1529500 Ga0436364_1529500_417_1178 251
387 3300038443 Ga0395901_0001645 Ga0395901_0001645_20237_20995 251
388 3300038443 Ga0395901_0025404 Ga0395901_0025404_2470_3228 251
389 3300038443 Ga0395901_0026006 Ga0395901_0026006_1794_2552 251
390 3300038443 Ga0395901_0390194 Ga0395901_0390194_369_1148 251
391 3300039437 Ga0436365_0430782 Ga0436365_0430782_1239_2000 251
392 3300039437 Ga0436365_0830368 Ga0436365_0830368_1824_2585 251
393 3300039447 Ga0436361_0420967 Ga0436361_0420967_240_1001 251
394 3300039447 Ga0436361_0668079 Ga0436361_0668079_2684_3445 251
395 3300039447 Ga0436361_0724097 Ga0436361_0724097_1046_1822 251
396 3300039447 Ga0436361_1046016 Ga0436361_1046016_2439_3200 251
397 3300039447 Ga0436361_1119238 Ga0436361_1119238_106_867 251
398 3300039450 Ga0436363_0350608 Ga0436363_0350608_105_863 251
399 3300044658 Ga0466972_0025874 Ga0466972_0025874_394_1167 251
400 3300045976 Ga0466967_0822135 Ga0466967_0822135_10_786 251
401 3300046454 Ga0495592_0002595 Ga0495592_0002595_8386_9147 251
402 3300046454 Ga0495592_0008363 Ga0495592_0008363_6772_7563 251
403 3300046454 Ga0495592_0084559 Ga0495592_0084559_607_1368 251
404 3300046455 Ga0495603_0000945 Ga0495603_0000945_4596_5357 251
405 3300046459 Ga0495629_0002712 Ga0495629_0002712_4515_5276 251
406 3300046459 Ga0495629_0021588 Ga0495629_0021588_3534_4295 251
407 3300046459 Ga0495629_0213165 Ga0495629_0213165_520_1311 251
408 3300046460 Ga0495638_0024385 Ga0495638_0024385_1144_1905 251
409 3300046461 Ga0495641_0003285 Ga0495641_0003285_6060_6821 251
410 3300046462 Ga0495651_0000267 Ga0495651_0000267_12576_13337 251
411 3300046462 Ga0495651_0028181 Ga0495651_0028181_675_1466 251
412 3300046462 Ga0495651_0328189 Ga0495651_0328189_182_943 251
413 3300046463 Ga0495653_0000993 Ga0495653_0000993_3003_3794 251
414 3300046463 Ga0495653_0009531 Ga0495653_0009531_743_1504 251
415 3300046472 Ga0495580_0002080 Ga0495580_0002080_7929_8690 251
416 3300046473 Ga0495582_0000292 Ga0495582_0000292_10365_11126 251
417 3300046475 Ga0495639_0001550 Ga0495639_0001550_2620_3381 251
418 3300046476 Ga0495662_0000849 Ga0495662_0000849_8154_8915 251
419 3300046476 Ga0495662_0034549 Ga0495662_0034549_1637_2401 251
420 3300046476 Ga0495662_0156496 Ga0495662_0156496_186_977 251
421 3300046477 Ga0495664_0000008 Ga0495664_0000008_302262_303053 251
422 3300046477 Ga0495664_0001948 Ga0495664_0001948_328_1089 251
423 3300046477 Ga0495664_0083945 Ga0495664_0083945_874_1635 251
424 3300046491 Ga0495584_0013470 Ga0495584_0013470_2787_3551 251
425 3300046499 Ga0495594_0001470 Ga0495594_0001470_2374_3135 251
426 3300046499 Ga0495594_0186359 Ga0495594_0186359_367_1128 251
427 3300046511 Ga0495608_0000226 Ga0495608_0000226_21071_21832 251
428 3300046511 Ga0495608_0000752 Ga0495608_0000752_17992_18783 251
429 3300046512 Ga0495610_0029435 Ga0495610_0029435_722_1486 251
430 3300046514 Ga0495618_0000826 Ga0495618_0000826_2816_3607 251
431 3300046514 Ga0495618_0002717 Ga0495618_0002717_2891_3652 251
432 3300046514 Ga0495618_0005562 Ga0495618_0005562_1503_2264 251
433 3300046514 Ga0495618_0190742 Ga0495618_0190742_318_1079 251
434 3300046516 Ga0495628_0000802 Ga0495628_0000802_18083_18874 251
435 3300046516 Ga0495628_0182750 Ga0495628_0182750_276_1037 251
436 3300046516 Ga0495628_0210369 Ga0495628_0210369_329_1090 251
437 3300046516 Ga0495628_0273683 Ga0495628_0273683_118_879 251
438 3300046517 Ga0495630_0005531 Ga0495630_0005531_3764_4555 251
439 3300046517 Ga0495630_0007451 Ga0495630_0007451_123_884 251
440 3300046517 Ga0495630_0098543 Ga0495630_0098543_15_776 251
441 3300046517 Ga0495630_0162145 Ga0495630_0162145_608_1369 251
442 3300046517 Ga0495630_0304170 Ga0495630_0304170_179_940 251
443 3300046524 Ga0495648_0004029 Ga0495648_0004029_8550_9329 251
444 3300046529 Ga0495652_0000005 Ga0495652_0000005_302348_303139 251
445 3300046529 Ga0495652_0031701 Ga0495652_0031701_3277_4038 251
446 3300046529 Ga0495652_0098290 Ga0495652_0098290_915_1676 251
447 3300046531 Ga0495665_0007476 Ga0495665_0007476_2699_3460 251
448 3300046533 Ga0495640_0000020 Ga0495640_0000020_181_972 251
449 3300046533 Ga0495640_0001646 Ga0495640_0001646_3046_3807 251
450 3300046533 Ga0495640_0019558 Ga0495640_0019558_2910_3674 251
451 3300046533 Ga0495640_0042775 Ga0495640_0042775_2320_3081 251
452 3300046533 Ga0495640_0053872 Ga0495640_0053872_129_890 251
453 3300046535 Ga0495586_0008127 Ga0495586_0008127_91_852 251
454 3300046535 Ga0495586_0098135 Ga0495586_0098135_189_950 251
455 3300046536 Ga0495587_0000005 Ga0495587_0000005_55346_56137 251
456 3300046536 Ga0495587_0001299 Ga0495587_0001299_283_1044 251
457 3300046536 Ga0495587_0033618 Ga0495587_0033618_2131_2892 251
458 3300046543 Ga0495645_0000007 Ga0495645_0000007_33523_34314 251
459 3300046543 Ga0495645_0001446 Ga0495645_0001446_3504_4265 251
460 3300046543 Ga0495645_0167364 Ga0495645_0167364_377_1138 251
461 3300046557 Ga0495622_0000730 Ga0495622_0000730_15590_16351 251
462 3300046559 Ga0495667_0000417 Ga0495667_0000417_10010_10771 251
463 3300046559 Ga0495667_0000618 Ga0495667_0000618_3860_4651 251
464 3300046559 Ga0495667_0024401 Ga0495667_0024401_1847_2608 251
465 3300046642 Ga0495634_0001197 Ga0495634_0001197_12649_13410 251
466 3300046642 Ga0495634_0004645 Ga0495634_0004645_5367_6128 251
467 3300046642 Ga0495634_0014340 Ga0495634_0014340_1255_2046 251
468 3300046642 Ga0495634_0017125 Ga0495634_0017125_4266_5027 251
469 3300046642 Ga0495634_0056664 Ga0495634_0056664_1264_2025 251
470 3300046663 Ga0495635_0000010 Ga0495635_0000010_239113_239904 251
471 3300046663 Ga0495635_0007245 Ga0495635_0007245_1959_2720 251
472 3300046663 Ga0495635_0012783 Ga0495635_0012783_483_1244 251
473 3300046663 Ga0495635_0084233 Ga0495635_0084233_1316_2077 251
474 3300046674 Ga0495588_0001338 Ga0495588_0001338_423_1184 251
475 3300046675 Ga0495657_0006151 Ga0495657_0006151_5820_6611 251
476 3300046678 Ga0495599_0000240 Ga0495599_0000240_18033_18824 251
477 3300046678 Ga0495599_0008292 Ga0495599_0008292_166_927 251
478 3300046678 Ga0495599_0219060 Ga0495599_0219060_347_1108 251
479 3300046679 Ga0495623_0001009 Ga0495623_0001009_18047_18838 251
480 3300046679 Ga0495623_0044694 Ga0495623_0044694_1216_1977 251
481 3300046679 Ga0495623_0176924 Ga0495623_0176924_21_782 251
482 3300046680 Ga0495646_0000663 Ga0495646_0000663_17876_18667 251
483 3300046680 Ga0495646_0250332 Ga0495646_0250332_50_811 251
484 3300046681 Ga0495647_0000586 Ga0495647_0000586_3104_3865 251
485 3300046683 Ga0495658_0001493 Ga0495658_0001493_9246_10007 251
486 3300046683 Ga0495658_0217937 Ga0495658_0217937_157_921 251
487 3300046689 Ga0495613_0000652 Ga0495613_0000652_13456_14217 251
488 3300046689 Ga0495613_0442760 Ga0495613_0442760_61_822 251
489 3300046809 Ga0495600_0000016 Ga0495600_0000016_3840_4631 251
490 3300046809 Ga0495600_0029967 Ga0495600_0029967_1297_2058 251
491 3300047315 Ga0495581_0045927 Ga0495581_0045927_336_1127 251
492 3300047315 Ga0495581_0097307 Ga0495581_0097307_495_1256 251
493 3300047315 Ga0495581_0206094 Ga0495581_0206094_311_1081 251
494 3300047315 Ga0495581_0214093 Ga0495581_0214093_74_835 251
495 3300047315 Ga0495581_0224576 Ga0495581_0224576_239_1000 251
496 3300047317 Ga0495604_0000634 Ga0495604_0000634_18905_19666 251
497 3300047317 Ga0495604_0001065 Ga0495604_0001065_3902_4693 251
498 3300047319 Ga0495674_0000012 Ga0495674_0000012_15861_16652 251
499 3300047319 Ga0495674_0001892 Ga0495674_0001892_18243_19004 251
500 3300047319 Ga0495674_0002470 Ga0495674_0002470_4887_5648 251
501 3300047319 Ga0495674_0109121 Ga0495674_0109121_1470_2234 251
502 3300047319 Ga0495674_0312067 Ga0495674_0312067_81_845 251
503 3300047321 Ga0495676_0221730 Ga0495676_0221730_395_1165 251
504 3300047321 Ga0495676_0233955 Ga0495676_0233955_361_1122 251
505 3300047322 Ga0495680_0001504 Ga0495680_0001504_18367_19128 251
506 3300047322 Ga0495680_0034751 Ga0495680_0034751_236_1027 251
507 3300047322 Ga0495680_0155228 Ga0495680_0155228_19_780 251
508 3300047444 Ga0495675_0271982 Ga0495675_0271982_180_941 251
509 3300047471 Ga0495684_0001027 Ga0495684_0001027_18037_18828 251
510 3300047471 Ga0495684_0069917 Ga0495684_0069917_170_931 251
511 3300047471 Ga0495684_0081519 Ga0495684_0081519_78_839 251
512 3300047673 Ga0495593_0003844 Ga0495593_0003844_4670_5431 251
513 3300047673 Ga0495593_0096876 Ga0495593_0096876_605_1396 251
514 3300048088 Ga0495602_0001567 Ga0495602_0001567_18097_18888 251
515 3300048088 Ga0495602_0015059 Ga0495602_0015059_3442_4203 251
516 3300048088 Ga0495602_0043419 Ga0495602_0043419_18_779 251
517 3300048088 Ga0495602_0260754 Ga0495602_0260754_141_902 251
518 3300048089 Ga0495614_0000798 Ga0495614_0000798_4509_5270 251
519 3300048903 Ga0496100_0000386 Ga0496100_0000386_8669_9430 251
520 3300048903 Ga0496100_0068230 Ga0496100_0068230_748_1509 251
521 3300048903 Ga0496100_0145217 Ga0496100_0145217_891_1652 251
522 3300048904 Ga0496101_0001608 Ga0496101_0001608_11321_12082 251
523 3300048904 Ga0496101_0033440 Ga0496101_0033440_1820_2581 251
524 3300048904 Ga0496101_0169041 Ga0496101_0169041_843_1604 251
525 3300048905 Ga0496102_0021728 Ga0496102_0021728_4129_4890 251
526 3300048905 Ga0496102_0337578 Ga0496102_0337578_450_1211 251
527 3300048907 Ga0496104_0028292 Ga0496104_0028292_51_812 251
528 3300048907 Ga0496104_0030395 Ga0496104_0030395_3348_4118 251
529 3300048907 Ga0496104_0156567 Ga0496104_0156567_547_1308 251
530 3300048907 Ga0496104_0203282 Ga0496104_0203282_678_1448 251
531 3300048907 Ga0496104_0272943 Ga0496104_0272943_275_1036 251
532 3300048907 Ga0496104_0382034 Ga0496104_0382034_378_1139 251
533 3300048907 Ga0496104_0407281 Ga0496104_0407281_159_920 251
534 3300048908 Ga0496105_0000577 Ga0496105_0000577_18329_19090 251
535 3300048908 Ga0496105_0001440 Ga0496105_0001440_12573_13343 251
536 3300048908 Ga0496105_0044270 Ga0496105_0044270_1478_2239 251
537 3300048908 Ga0496105_0089217 Ga0496105_0089217_856_1617 251
538 3300048909 Ga0496106_0000936 Ga0496106_0000936_5132_5893 251
539 3300048909 Ga0496106_0048536 Ga0496106_0048536_1184_1945 251
540 3300048909 Ga0496106_0267626 Ga0496106_0267626_60_821 251
541 3300048909 Ga0496106_0454247 Ga0496106_0454247_164_925 251
542 3300048910 Ga0496107_0003679 Ga0496107_0003679_3821_4582 251
543 3300048910 Ga0496107_0075383 Ga0496107_0075383_510_1271 251
544 3300048911 Ga0496108_0001099 Ga0496108_0001099_11985_12755 251
545 3300048912 Ga0496109_0005653 Ga0496109_0005653_1995_2765 251
546 3300048912 Ga0496109_0034719 Ga0496109_0034719_2359_3120 251
547 3300048912 Ga0496109_0063118 Ga0496109_0063118_2419_3180 251
548 3300048912 Ga0496109_0132048 Ga0496109_0132048_181_942 251
549 3300048912 Ga0496109_0472977 Ga0496109_0472977_391_1152 251
550 3300048913 Ga0496110_0006526 Ga0496110_0006526_4028_4798 251
551 3300048913 Ga0496110_0010410 Ga0496110_0010410_4551_5312 251
552 3300048913 Ga0496110_0135880 Ga0496110_0135880_871_1632 251
553 3300048913 Ga0496110_0146982 Ga0496110_0146982_1049_1810 251
554 3300048913 Ga0496110_0472103 Ga0496110_0472103_132_893 251
555 3300048914 Ga0496111_0001036 Ga0496111_0001036_13637_14407 251
556 3300048914 Ga0496111_0101113 Ga0496111_0101113_373_1134 251
557 3300048914 Ga0496111_0225681 Ga0496111_0225681_340_1110 251
558 3300048915 Ga0496112_0007251 Ga0496112_0007251_846_1607 251
559 3300048915 Ga0496112_0010555 Ga0496112_0010555_4653_5423 251
560 3300048915 Ga0496112_0028281 Ga0496112_0028281_3979_4740 251
561 3300048916 Ga0496113_0010202 Ga0496113_0010202_1091_1861 251
562 3300048916 Ga0496113_0035630 Ga0496113_0035630_1106_1867 251
563 3300048916 Ga0496113_0245133 Ga0496113_0245133_292_1053 251
564 3300048917 Ga0496114_0001665 Ga0496114_0001665_10941_11702 251
565 3300048917 Ga0496114_0059122 Ga0496114_0059122_842_1603 251
566 3300048918 Ga0496115_0004212 Ga0496115_0004212_7459_8229 251
567 3300048918 Ga0496115_0022781 Ga0496115_0022781_1383_2144 251
568 3300048918 Ga0496115_0060641 Ga0496115_0060641_1424_2185 251
569 3300048918 Ga0496115_0246226 Ga0496115_0246226_92_853 251
570 3300048918 Ga0496115_0289532 Ga0496115_0289532_410_1171 251
571 3300048921 Ga0496118_0289312 Ga0496118_0289312_14_775 251
572 3300048922 Ga0496119_0002304 Ga0496119_0002304_8727_9485 251
573 3300048925 Ga0496122_0029679 Ga0496122_0029679_3258_4013 251
574 3300048926 Ga0496123_0001703 Ga0496123_0001703_13608_14363 251
575 3300049568 Ga0501031_0147951 Ga0501031_0147951_291_1085 251
576 3300049571 Ga0501034_0005569 Ga0501034_0005569_8733_9491 251
577 3300049571 Ga0501034_0037874 Ga0501034_0037874_1780_2541 251
578 3300049574 Ga0501038_0297549 Ga0501038_0297549_354_1148 251
579 3300049575 Ga0501039_0063551 Ga0501039_0063551_872_1666 251
580 3300049575 Ga0501039_0123595 Ga0501039_0123595_133_915 251
581 3300049576 Ga0501040_0034656 Ga0501040_0034656_583_1377 251
582 3300049576 Ga0501040_0040377 Ga0501040_0040377_292_1086 251
583 3300049576 Ga0501040_0204774 Ga0501040_0204774_37_819 251
584 3300049577 Ga0501041_0066717 Ga0501041_0066717_1143_1937 251
585 3300049577 Ga0501041_0107712 Ga0501041_0107712_464_1246 251
586 3300049579 Ga0501043_0190887 Ga0501043_0190887_396_1190 251
587 3300049580 Ga0501046_0181075 Ga0501046_0181075_507_1268 251
588 3300049582 Ga0501048_0000736 Ga0501048_0000736_19298_20059 251
589 3300049584 Ga0501068_0006174 Ga0501068_0006174_622_1380 251
590 3300049587 Ga0501071_0233973 Ga0501071_0233973_417_1211 251
591 3300049590 Ga0501074_0433417 Ga0501074_0433417_91_852 251
592 3300049591 Ga0501075_0104615 Ga0501075_0104615_719_1513 251
593 3300049591 Ga0501075_0135814 Ga0501075_0135814_788_1582 251
594 3300049593 Ga0501077_0037456 Ga0501077_0037456_2037_2831 251
595 3300049593 Ga0501077_0038511 Ga0501077_0038511_271_1065 251
596 3300049741 Ga0501079_0140869 Ga0501079_0140869_961_1743 251
597 3300049741 Ga0501079_0556996 Ga0501079_0556996_37_813 251
598 3300049743 Ga0501081_0006724 Ga0501081_0006724_2060_2854 251
599 3300049743 Ga0501081_0044717 Ga0501081_0044717_285_1079 251
600 3300049743 Ga0501081_0163142 Ga0501081_0163142_749_1531 251
601 3300049744 Ga0501083_0110068 Ga0501083_0110068_786_1553 251
602 3300049744 Ga0501083_0119140 Ga0501083_0119140_817_1611 251
603 3300049824 Ga0501045_0047311 Ga0501045_0047311_2042_2836 251
604 3300049824 Ga0501045_0155339 Ga0501045_0155339_397_1191 251
605 3300050489 nmdc:mga03683_139443_c1 nmdc:mga03683_139443_c1_261_1022 251
606 3300050489 nmdc:mga03683_608_c1 nmdc:mga03683_608_c1_4948_5709 251
607 3300050490 nmdc:mga03n38_137420_c1 nmdc:mga03n38_137420_c1_245_1006 251
608 3300050491 nmdc:mga00v17_49851_c1 nmdc:mga00v17_49851_c1_593_1354 251
609 3300050492 nmdc:mga0yw44_198467_c1 nmdc:mga0yw44_198467_c1_479_1240 251
610 3300050492 nmdc:mga0yw44_2155_c1 nmdc:mga0yw44_2155_c1_5075_5836 251
611 3300050492 nmdc:mga0yw44_34864_c2 nmdc:mga0yw44_34864_c2_355_1116 251
612 3300050492 nmdc:mga0yw44_48183_c1 nmdc:mga0yw44_48183_c1_1393_2154 251
613 3300050492 nmdc:mga0yw44_87507_c2 nmdc:mga0yw44_87507_c2_182_943 251
614 3300050495 nmdc:mga04h51_24987_c1 nmdc:mga04h51_24987_c1_79_840 251
615 3300050496 nmdc:mga07m45_243067_c1 nmdc:mga07m45_243067_c1_13_774 251
616 3300050496 nmdc:mga07m45_33114_c1 nmdc:mga07m45_33114_c1_837_1598 251
617 3300050496 nmdc:mga07m45_69532_c1 nmdc:mga07m45_69532_c1_466_1227 251
618 3300050507 nmdc:mga05p37_267208_c1 nmdc:mga05p37_267208_c1_1071_1832 251
619 3300050508 nmdc:mga09592_304303_c1 nmdc:mga09592_304303_c1_59_820 251
620 3300050510 nmdc:mga06r32_24791_c1 nmdc:mga06r32_24791_c1_4482_5243 251
621 3300050510 nmdc:mga06r32_50085_c1 nmdc:mga06r32_50085_c1_2775_3557 251
622 3300050511 nmdc:mga08y16_387316_c1 nmdc:mga08y16_387316_c1_35_808 251
623 3300050516 nmdc:mga0sz30_100888_c1 nmdc:mga0sz30_100888_c1_328_1089 251
624 3300050516 nmdc:mga0sz30_17589_c1 nmdc:mga0sz30_17589_c1_570_1331 251
625 3300050516 nmdc:mga0sz30_2513_c1 nmdc:mga0sz30_2513_c1_2059_2820 251
626 3300053077 Ga0495601_0000011 Ga0495601_0000011_10197_10988 251
627 3300053077 Ga0495601_0000880 Ga0495601_0000880_8814_9575 251
628 3300053077 Ga0495601_0006281 Ga0495601_0006281_4946_5707 251
629 3300053077 Ga0495601_0041000 Ga0495601_0041000_1775_2539 251
630 3300053077 Ga0495601_0049794 Ga0495601_0049794_50_811 251
631 3300053078 Ga0495612_0002032 Ga0495612_0002032_2918_3679 251
632 3300053078 Ga0495612_0002357 Ga0495612_0002357_201_992 251
633 3300053078 Ga0495612_0006886 Ga0495612_0006886_3767_4528 251
634 3300053084 Ga0495595_0000308 Ga0495595_0000308_1268_2029 251
635 3300053084 Ga0495595_0000906 Ga0495595_0000906_7991_8782 251
636 3300053084 Ga0495595_0070098 Ga0495595_0070098_749_1510 251
637 3300053085 Ga0495619_0000013 Ga0495619_0000013_10118_10909 251
638 3300053085 Ga0495619_0001242 Ga0495619_0001242_10787_11548 251
639 3300053085 Ga0495619_0003116 Ga0495619_0003116_6531_7292 251
640 3300053085 Ga0495619_0005937 Ga0495619_0005937_4149_4910 251
641 3300053085 Ga0495619_0010198 Ga0495619_0010198_4967_5728 251
642 3300053088 Ga0500644_0196970 Ga0500644_0196970_12_782 251
643 3300053096 Ga0500641_0003638 Ga0500641_0003638_1452_2213 251
644 3300053104 Ga0500556_0000148 Ga0500556_0000148_8645_9400 251
645 3300053104 Ga0500556_0000229 Ga0500556_0000229_37594_38358 251
646 3300053119 Ga0500595_007088 Ga0500595_007088_3585_4358 251
647 3300053130 Ga0500642_0105162 Ga0500642_0105162_41_802 251
648 3300053136 Ga0500559_0000528 Ga0500559_0000528_18753_19514 251
649 3300053139 Ga0500568_0041547 Ga0500568_0041547_874_1641 251
650 3300053142 Ga0500577_0074434 Ga0500577_0074434_320_1081 251
651 3300053153 Ga0500616_0113986 Ga0500616_0113986_510_1274 251
652 3300053177 Ga0500636_0032012 Ga0500636_0032012_1359_2123 251
653 3300053725 Ga0500576_031015 Ga0500576_031015_250_1011 251
654 3300054114 Ga0501084_0004692 Ga0501084_0004692_3723_4490 251
655 3300054114 Ga0501084_0016658 Ga0501084_0016658_3516_4310 251
656 3300060353 Ga0501082_0034656 Ga0501082_0034656_599_1366 251
657 3300060353 Ga0501082_0068633 Ga0501082_0068633_1980_2774 251
658 3300061734 Ga0530510_0025629 Ga0530510_0025629_1960_2754 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

1

205

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ndc-assembly1.cif.gz_B crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus 0.9762 1 237
3ndc-assembly1.cif.gz_B crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus 0.9721 1 237
3nei-assembly1.cif.gz_B crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus (no sah bound) 0.9719 1 231
3nei-assembly1.cif.gz_A crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus (no sah bound) 0.9706 1 231
3ndc-assembly1.cif.gz_A crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus 0.9677 1 234
ID Description Score Start End Superfamily
3neiB01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9857 1 110 3.40.1010.10
3neiB01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9769 1 110 3.40.1010.10
4e16A01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9664 2 110 3.40.1010.10
2cbfA01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9536 2 110 3.40.1010.10
3neiB02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9502 111 231 3.30.950.10
ID Description Score Start End GO Terms
AF-A0A530BU87-F1-model_v4 Precorrin-4 C(11)-methyltransferase 0.9966 1 77 GO:0008168
GO:0032259
AF-A0A530BU87-F1-model_v4 Precorrin-4 C(11)-methyltransferase 0.9838 1 77 GO:0008168
GO:0032259
AF-A0A7V2RUB0-F1-model_v4 Precorrin-4 C(11)-methyltransferase 0.9836 1 177 GO:0009236
GO:0032259
GO:0046026
AF-A0A5M3XA37-F1-model_v4 Precorrin-4 C(11)-methyltransferase 0.9807 1 246 GO:0009236
GO:0032259
GO:0046026
AF-A0A4V2SPA7-F1-model_v4 Precorrin-4 C11-methyltransferase 0.9799 1 249 GO:0009236
GO:0032259
GO:0046026

Feature Viewer

pLDDT pTM Quality
90.25 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map