F473221
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 658 | 343 | 629 | 254 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|643348564|643599895 |
| Length | 276 |
| Sequence | FIGAGPGAADLITLRGRDLIARCPVCLYAGSIVAPEILAWCPPGVRLVDTAPLDLDAILAEMRAAHARGEDVARLHSGDLSVYSAVAEQTRRLEALGIPYTLTPGVPAFATAAAALGRELTVPEVAQSVVLTRTSGRASAMPAPERLALFAQTQATLAIHLSIHVIAEVAAELIPHYGPDCPVGVVYRASWPDERVLRGTLADIAEQVAAARFERTALILVGRALAAGDFRESALYSAGYDRRFRPGGGTRVLGDEVQLSPVRRGNPSPEWERGRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 4 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 5 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 6 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 7 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 8 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 9 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 10 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 11 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 12 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 13 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 14 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 15 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 16 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 17 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 18 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 19 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 20 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 21 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 22 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 23 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 24 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 25 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 26 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 27 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 28 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 29 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 111 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 152 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 163 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 165 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 170 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 174 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 180 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 181 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 183 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 210 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 211 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 212 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 213 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 214 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 286 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 287 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 288 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 289 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 290 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 291 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 312 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 322 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 328 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 329 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 330 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 331 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 332 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 333 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 334 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 335 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 340 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 341 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 342 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 343 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.59 |
| Metatranscriptomes | 0 |
| Isolates | 4.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.97 |
| Nodule | 2.43 |
| Rhizoplane | 8.36 |
| Rhizosphere | 74.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10051438 | 3300003316 | Bacteria | 4835 |
| 2 | rootH2_10064931 | 3300003320 | Bacteria | 3425 |
| 3 | rootL2_10285924 | 3300003322 | Bacteria | 2896 |
| 4 | JGI25160J50197_1008385 | 3300003354 | Bacteria | 3943 |
| 5 | Ga0070658_10068440 | 3300005327 | Bacteria | 2902 |
| 6 | Ga0070676_10187874 | 3300005328 | Bacteria | 1347 |
| 7 | Ga0070666_10110658 | 3300005335 | Bacteria | 1899 |
| 8 | Ga0070682_100022805 | 3300005337 | Bacteria | 3712 |
| 9 | Ga0068868_100404277 | 3300005338 | Bacteria | 1179 |
| 10 | Ga0070689_100000836 | 3300005340 | Bacteria | 19082 |
| 11 | Ga0070689_100301370 | 3300005340 | Bacteria | 1334 |
| 12 | Ga0070691_10010035 | 3300005341 | Bacteria | 4316 |
| 13 | Ga0070661_100322926 | 3300005344 | Bacteria | 1206 |
| 14 | Ga0070669_100331954 | 3300005353 | Bacteria | 1230 |
| 15 | Ga0070675_100059625 | 3300005354 | Bacteria | 3149 |
| 16 | Ga0070671_100000729 | 3300005355 | Bacteria | 23534 |
| 17 | Ga0070671_100018992 | 3300005355 | Bacteria | 5591 |
| 18 | Ga0070674_100222139 | 3300005356 | Bacteria | 1470 |
| 19 | Ga0070674_100439331 | 3300005356 | Bacteria | 1075 |
| 20 | Ga0070673_100001534 | 3300005364 | Bacteria | 13599 |
| 21 | Ga0070673_100108649 | 3300005364 | Bacteria | 2297 |
| 22 | Ga0070688_100055045 | 3300005365 | Bacteria | 2494 |
| 23 | Ga0070659_100136961 | 3300005366 | Bacteria | 1991 |
| 24 | Ga0070709_10035830 | 3300005434 | Bacteria | 3018 |
| 25 | Ga0070709_10241168 | 3300005434 | Bacteria | 1298 |
| 26 | Ga0070714_100000887 | 3300005435 | Bacteria | 21223 |
| 27 | Ga0070714_100030751 | 3300005435 | Bacteria | 4473 |
| 28 | Ga0070714_100215794 | 3300005435 | Bacteria | 1761 |
| 29 | Ga0070713_100068263 | 3300005436 | Bacteria | 2995 |
| 30 | Ga0070710_10013882 | 3300005437 | Bacteria | 4044 |
| 31 | Ga0070710_10158131 | 3300005437 | Bacteria | 1403 |
| 32 | Ga0070711_100551973 | 3300005439 | Bacteria | 956 |
| 33 | Ga0070678_100118972 | 3300005456 | Bacteria | 2080 |
| 34 | Ga0070681_10079651 | 3300005458 | Bacteria | 3232 |
| 35 | Ga0068867_100110763 | 3300005459 | Bacteria | 2109 |
| 36 | Ga0068867_100519769 | 3300005459 | Bacteria | 1026 |
| 37 | Ga0070706_100503280 | 3300005467 | Bacteria | 1127 |
| 38 | Ga0070672_100315775 | 3300005543 | Bacteria | 1327 |
| 39 | Ga0070665_100000949 | 3300005548 | Bacteria | 36967 |
| 40 | Ga0070665_100005880 | 3300005548 | Bacteria | 12574 |
| 41 | Ga0070665_100014232 | 3300005548 | Bacteria | 7991 |
| 42 | Ga0070665_100029921 | 3300005548 | Bacteria | 5481 |
| 43 | Ga0070665_100215600 | 3300005548 | Bacteria | 1920 |
| 44 | Ga0070665_100365637 | 3300005548 | Bacteria | 1449 |
| 45 | Ga0068855_100060491 | 3300005563 | Bacteria | 4429 |
| 46 | Ga0068856_100446042 | 3300005614 | Bacteria | 1315 |
| 47 | Ga0070702_100053730 | 3300005615 | Bacteria | 2315 |
| 48 | Ga0068852_100082282 | 3300005616 | Bacteria | 2860 |
| 49 | Ga0068852_100510218 | 3300005616 | Bacteria | 1198 |
| 50 | Ga0068859_100058638 | 3300005617 | Bacteria | 3878 |
| 51 | Ga0068864_100307300 | 3300005618 | Bacteria | 1486 |
| 52 | Ga0068861_100003608 | 3300005719 | Bacteria | 10306 |
| 53 | Ga0068863_100014040 | 3300005841 | Bacteria | 7717 |
| 54 | Ga0068863_100221376 | 3300005841 | Bacteria | 1824 |
| 55 | Ga0068858_100026651 | 3300005842 | Bacteria | 5369 |
| 56 | Ga0068860_100000498 | 3300005843 | Bacteria | 48732 |
| 57 | Ga0068860_100887706 | 3300005843 | Bacteria | 907 |
| 58 | Ga0068862_100094272 | 3300005844 | Bacteria | 2611 |
| 59 | Ga0068862_100103938 | 3300005844 | Bacteria | 2488 |
| 60 | Ga0081455_10015010 | 3300005937 | Bacteria | 7545 |
| 61 | Ga0081540_1040673 | 3300005983 | Bacteria | 2420 |
| 62 | Ga0081539_10011961 | 3300005985 | Bacteria | 6768 |
| 63 | Ga0070717_10049133 | 3300006028 | Bacteria | 3463 |
| 64 | Ga0070717_10229637 | 3300006028 | Bacteria | 1633 |
| 65 | Ga0075365_10008616 | 3300006038 | Bacteria | 5807 |
| 66 | Ga0075365_10027464 | 3300006038 | Bacteria | 3622 |
| 67 | Ga0075365_10074189 | 3300006038 | Bacteria | 2294 |
| 68 | Ga0075365_10160025 | 3300006038 | Bacteria | 1569 |
| 69 | Ga0075368_10011576 | 3300006042 | Bacteria | 3211 |
| 70 | Ga0075368_10092230 | 3300006042 | Bacteria | 1239 |
| 71 | Ga0075363_100300867 | 3300006048 | Bacteria | 931 |
| 72 | Ga0075364_10068997 | 3300006051 | Bacteria | 2326 |
| 73 | Ga0075364_10181486 | 3300006051 | Bacteria | 1424 |
| 74 | Ga0075364_10195701 | 3300006051 | Bacteria | 1369 |
| 75 | Ga0070712_100002004 | 3300006175 | Bacteria | 12476 |
| 76 | Ga0070712_100006459 | 3300006175 | Bacteria | 7270 |
| 77 | Ga0075362_10023530 | 3300006177 | Bacteria | 2606 |
| 78 | Ga0075362_10035302 | 3300006177 | Bacteria | 2182 |
| 79 | Ga0075362_10084977 | 3300006177 | Bacteria | 1462 |
| 80 | Ga0075362_10169821 | 3300006177 | Bacteria | 1053 |
| 81 | Ga0075367_10031561 | 3300006178 | Bacteria | 3043 |
| 82 | Ga0075367_10128726 | 3300006178 | Bacteria | 1564 |
| 83 | Ga0075369_10000191 | 3300006186 | Bacteria | 17605 |
| 84 | Ga0075369_10025034 | 3300006186 | Bacteria | 2479 |
| 85 | Ga0075369_10055635 | 3300006186 | Bacteria | 1719 |
| 86 | Ga0075370_10024076 | 3300006353 | Bacteria | 3359 |
| 87 | Ga0075428_100354102 | 3300006844 | Bacteria | 1575 |
| 88 | Ga0075428_100371366 | 3300006844 | Bacteria | 1534 |
| 89 | Ga0075431_100055397 | 3300006847 | Bacteria | 4090 |
| 90 | Ga0075429_100322665 | 3300006880 | Bacteria | 1352 |
| 91 | Ga0068865_100077156 | 3300006881 | Bacteria | 2380 |
| 92 | Ga0097620_100058638 | 3300006931 | Bacteria | 3878 |
| 93 | Ga0099824_1005450 | 3300006942 | Bacteria | 17919 |
| 94 | Ga0105240_10028349 | 3300009093 | Bacteria | 7316 |
| 95 | Ga0105240_10032124 | 3300009093 | Bacteria | 6798 |
| 96 | Ga0105240_10040314 | 3300009093 | Bacteria | 5974 |
| 97 | Ga0105245_10244357 | 3300009098 | Bacteria | 1741 |
| 98 | Ga0105247_10006940 | 3300009101 | Bacteria | 6972 |
| 99 | Ga0114129_10168319 | 3300009147 | Bacteria | 2989 |
| 100 | Ga0105242_10142337 | 3300009176 | Bacteria | 2082 |
| 101 | Ga0105248_10037714 | 3300009177 | Bacteria | 5408 |
| 102 | Ga0105237_10062589 | 3300009545 | Bacteria | 3720 |
| 103 | Ga0105238_10002503 | 3300009551 | Bacteria | 18383 |
| 104 | Ga0105238_10017647 | 3300009551 | Bacteria | 7255 |
| 105 | Ga0105238_10055519 | 3300009551 | Bacteria | 3975 |
| 106 | Ga0105249_10169368 | 3300009553 | Bacteria | 2117 |
| 107 | Ga0105249_10712514 | 3300009553 | Bacteria | 1064 |
| 108 | Ga0099796_10115115 | 3300010159 | Bacteria | 1028 |
| 109 | Ga0105239_10310738 | 3300010375 | Bacteria | 1777 |
| 110 | Ga0157371_10075255 | 3300013102 | Bacteria | 2391 |
| 111 | Ga0157370_10082385 | 3300013104 | Bacteria | 3026 |
| 112 | Ga0157370_10120794 | 3300013104 | Bacteria | 2446 |
| 113 | Ga0157374_10369851 | 3300013296 | Bacteria | 1427 |
| 114 | Ga0163162_10032837 | 3300013306 | Bacteria | 5154 |
| 115 | Ga0163162_10214597 | 3300013306 | Bacteria | 2054 |
| 116 | Ga0157372_10056501 | 3300013307 | Bacteria | 4385 |
| 117 | Ga0157372_11074117 | 3300013307 | Bacteria | 931 |
| 118 | Ga0157375_10008448 | 3300013308 | Bacteria | 9020 |
| 119 | Ga0157375_10584869 | 3300013308 | Bacteria | 1276 |
| 120 | Ga0163163_10009024 | 3300014325 | Bacteria | 8885 |
| 121 | Ga0163163_10074549 | 3300014325 | Bacteria | 3386 |
| 122 | Ga0157380_10102442 | 3300014326 | Bacteria | 2387 |
| 123 | Ga0157377_10130682 | 3300014745 | Bacteria | 1533 |
| 124 | Ga0157379_10005706 | 3300014968 | Bacteria | 10703 |
| 125 | Ga0157379_10193567 | 3300014968 | Bacteria | 1838 |
| 126 | Ga0157379_10288672 | 3300014968 | Bacteria | 1494 |
| 127 | Ga0157376_10006310 | 3300014969 | Bacteria | 8369 |
| 128 | Ga0157376_10135454 | 3300014969 | Bacteria | 2203 |
| 129 | Ga0213872_10031469 | 3300021361 | Bacteria | 2432 |
| 130 | Ga0213876_10160076 | 3300021384 | Bacteria | 1198 |
| 131 | Ga0228598_1000865 | 3300024227 | Bacteria | 6547 |
| 132 | Ga0209455_1017760 | 3300025272 | Bacteria | 1480 |
| 133 | Ga0209130_1000270 | 3300025284 | Bacteria | 65057 |
| 134 | Ga0209025_1000705 | 3300025294 | Bacteria | 56926 |
| 135 | Ga0209758_1004689 | 3300025297 | Bacteria | 11165 |
| 136 | Ga0207426_1000443 | 3300025302 | Bacteria | 66593 |
| 137 | Ga0207692_10219764 | 3300025898 | Bacteria | 1126 |
| 138 | Ga0207710_10008591 | 3300025900 | Bacteria | 4307 |
| 139 | Ga0207688_10083867 | 3300025901 | Bacteria | 1823 |
| 140 | Ga0207699_10010696 | 3300025906 | Bacteria | 4614 |
| 141 | Ga0207699_10028993 | 3300025906 | Bacteria | 3082 |
| 142 | Ga0207699_10078197 | 3300025906 | Bacteria | 2043 |
| 143 | Ga0207699_10234391 | 3300025906 | Bacteria | 1258 |
| 144 | Ga0207695_10109316 | 3300025913 | Bacteria | 2747 |
| 145 | Ga0207693_10001484 | 3300025915 | Bacteria | 20734 |
| 146 | Ga0207693_10013542 | 3300025915 | Bacteria | 6573 |
| 147 | Ga0207693_10067985 | 3300025915 | Bacteria | 2789 |
| 148 | Ga0207693_10073706 | 3300025915 | Bacteria | 2673 |
| 149 | Ga0207693_10212348 | 3300025915 | Bacteria | 1521 |
| 150 | Ga0207660_10285434 | 3300025917 | Bacteria | 1311 |
| 151 | Ga0207649_10169935 | 3300025920 | Bacteria | 1518 |
| 152 | Ga0207649_10481192 | 3300025920 | Bacteria | 942 |
| 153 | Ga0207650_10010860 | 3300025925 | Bacteria | 6256 |
| 154 | Ga0207687_10653890 | 3300025927 | Bacteria | 889 |
| 155 | Ga0207700_10093217 | 3300025928 | Bacteria | 2383 |
| 156 | Ga0207700_10285224 | 3300025928 | Bacteria | 1422 |
| 157 | Ga0207700_10699050 | 3300025928 | Bacteria | 905 |
| 158 | Ga0207664_10013831 | 3300025929 | Bacteria | 5810 |
| 159 | Ga0207664_10025814 | 3300025929 | Bacteria | 4432 |
| 160 | Ga0207664_10067260 | 3300025929 | Bacteria | 2875 |
| 161 | Ga0207664_10110811 | 3300025929 | Bacteria | 2283 |
| 162 | Ga0207664_10190069 | 3300025929 | Bacteria | 1767 |
| 163 | Ga0207644_10051258 | 3300025931 | Bacteria | 2962 |
| 164 | Ga0207644_10073175 | 3300025931 | Bacteria | 2512 |
| 165 | Ga0207686_10030430 | 3300025934 | Bacteria | 3196 |
| 166 | Ga0207670_10000845 | 3300025936 | Bacteria | 16075 |
| 167 | Ga0207670_10272605 | 3300025936 | Bacteria | 1316 |
| 168 | Ga0207669_10019454 | 3300025937 | Bacteria | 3536 |
| 169 | Ga0207669_10166084 | 3300025937 | Bacteria | 1565 |
| 170 | Ga0207704_10017693 | 3300025938 | Bacteria | 3702 |
| 171 | Ga0207704_10179930 | 3300025938 | Bacteria | 1527 |
| 172 | Ga0207711_10606527 | 3300025941 | Bacteria | 1021 |
| 173 | Ga0207667_10477650 | 3300025949 | Bacteria | 1265 |
| 174 | Ga0207651_10114126 | 3300025960 | Bacteria | 2034 |
| 175 | Ga0207712_10167394 | 3300025961 | Bacteria | 1714 |
| 176 | Ga0207712_10559351 | 3300025961 | Unclassified | 985 |
| 177 | Ga0207640_10058839 | 3300025981 | Bacteria | 2533 |
| 178 | Ga0207658_10056344 | 3300025986 | Bacteria | 2917 |
| 179 | Ga0207658_10098502 | 3300025986 | Bacteria | 2285 |
| 180 | Ga0207677_10260262 | 3300026023 | Bacteria | 1414 |
| 181 | Ga0207703_10060503 | 3300026035 | Bacteria | 3097 |
| 182 | Ga0207639_10119287 | 3300026041 | Bacteria | 2164 |
| 183 | Ga0207639_10207290 | 3300026041 | Bacteria | 1685 |
| 184 | Ga0207678_10037928 | 3300026067 | Bacteria | 4190 |
| 185 | Ga0207678_10173428 | 3300026067 | Bacteria | 1841 |
| 186 | Ga0207702_10000187 | 3300026078 | Bacteria | 74357 |
| 187 | Ga0207702_10498273 | 3300026078 | Bacteria | 1187 |
| 188 | Ga0207641_10000337 | 3300026088 | Bacteria | 57031 |
| 189 | Ga0207641_10330646 | 3300026088 | Bacteria | 1447 |
| 190 | Ga0207641_10344067 | 3300026088 | Bacteria | 1420 |
| 191 | Ga0207648_10093405 | 3300026089 | Bacteria | 2631 |
| 192 | Ga0207648_10137854 | 3300026089 | Bacteria | 2149 |
| 193 | Ga0207648_10316959 | 3300026089 | Bacteria | 1401 |
| 194 | Ga0207676_10183518 | 3300026095 | Bacteria | 1834 |
| 195 | Ga0207675_100005954 | 3300026118 | Bacteria | 11620 |
| 196 | Ga0207675_100569833 | 3300026118 | Bacteria | 1133 |
| 197 | Ga0207683_10122866 | 3300026121 | Bacteria | 2332 |
| 198 | Ga0207683_10273666 | 3300026121 | Bacteria | 1543 |
| 199 | Ga0207683_10307227 | 3300026121 | Bacteria | 1452 |
| 200 | Ga0207698_10804038 | 3300026142 | Bacteria | 943 |
| 201 | Ga0209389_1000010 | 3300027296 | Bacteria | 223892 |
| 202 | Ga0209589_1000016 | 3300027357 | Bacteria | 223788 |
| 203 | Ga0209489_100016 | 3300027361 | Bacteria | 223873 |
| 204 | Ga0209813_10015125 | 3300027866 | Bacteria | 2086 |
| 205 | Ga0268266_10000275 | 3300028379 | Bacteria | 85106 |
| 206 | Ga0268266_10006726 | 3300028379 | Bacteria | 10483 |
| 207 | Ga0268266_10069465 | 3300028379 | Bacteria | 3052 |
| 208 | Ga0268266_10071950 | 3300028379 | Bacteria | 2997 |
| 209 | Ga0268266_10093541 | 3300028379 | Bacteria | 2638 |
| 210 | Ga0268266_10140588 | 3300028379 | Bacteria | 2166 |
| 211 | Ga0268265_10027467 | 3300028380 | Bacteria | 4063 |
| 212 | Ga0268265_10066567 | 3300028380 | Bacteria | 2785 |
| 213 | Ga0268265_10422465 | 3300028380 | Bacteria | 1238 |
| 214 | Ga0268264_10000375 | 3300028381 | Bacteria | 65683 |
| 215 | Ga0268264_10074141 | 3300028381 | Bacteria | 2890 |
| 216 | Ga0268264_10691979 | 3300028381 | Bacteria | 1012 |
| 217 | Ga0265336_10076373 | 3300028666 | Bacteria | 1001 |
| 218 | Ga0265338_10090470 | 3300028800 | Bacteria | 2532 |
| 219 | Ga0265330_10029751 | 3300031235 | Bacteria | 2454 |
| 220 | Ga0265332_10000592 | 3300031238 | Bacteria | 23812 |
| 221 | Ga0265328_10000010 | 3300031239 | Bacteria | 163171 |
| 222 | Ga0265328_10000012 | 3300031239 | Bacteria | 157661 |
| 223 | Ga0265328_10002376 | 3300031239 | Bacteria | 8451 |
| 224 | Ga0265328_10024271 | 3300031239 | Bacteria | 2292 |
| 225 | Ga0265328_10066901 | 3300031239 | Bacteria | 1320 |
| 226 | Ga0265325_10007695 | 3300031241 | Bacteria | 6428 |
| 227 | Ga0265325_10038017 | 3300031241 | Bacteria | 2542 |
| 228 | Ga0265325_10095578 | 3300031241 | Bacteria | 1460 |
| 229 | Ga0265329_10004856 | 3300031242 | Bacteria | 5512 |
| 230 | Ga0265329_10023545 | 3300031242 | Bacteria | 2050 |
| 231 | Ga0265340_10000506 | 3300031247 | Bacteria | 21431 |
| 232 | Ga0265340_10181153 | 3300031247 | Bacteria | 952 |
| 233 | Ga0265339_10000107 | 3300031249 | Bacteria | 68261 |
| 234 | Ga0265339_10001426 | 3300031249 | Bacteria | 17728 |
| 235 | Ga0265331_10001315 | 3300031250 | Bacteria | 18423 |
| 236 | Ga0265331_10013348 | 3300031250 | Bacteria | 4421 |
| 237 | Ga0265327_10004701 | 3300031251 | Bacteria | 11931 |
| 238 | Ga0265316_10003717 | 3300031344 | Bacteria | 15360 |
| 239 | Ga0265316_10031965 | 3300031344 | Bacteria | 4300 |
| 240 | Ga0307513_10067952 | 3300031456 | Bacteria | 3736 |
| 241 | Ga0307513_10140621 | 3300031456 | Bacteria | 2341 |
| 242 | Ga0307513_10158415 | 3300031456 | Bacteria | 2160 |
| 243 | Ga0265313_10000131 | 3300031595 | Bacteria | 75926 |
| 244 | Ga0265313_10103190 | 3300031595 | Bacteria | 1263 |
| 245 | Ga0265314_10004714 | 3300031711 | Bacteria | 12518 |
| 246 | Ga0265314_10013526 | 3300031711 | Bacteria | 6588 |
| 247 | Ga0265342_10000116 | 3300031712 | Bacteria | 87805 |
| 248 | Ga0265342_10102095 | 3300031712 | Bacteria | 1632 |
| 249 | Ga0265342_10137037 | 3300031712 | Bacteria | 1368 |
| 250 | Ga0307413_10155310 | 3300031824 | Bacteria | 1600 |
| 251 | Ga0307413_10302389 | 3300031824 | Bacteria | 1214 |
| 252 | Ga0307409_100149774 | 3300031995 | Bacteria | 2024 |
| 253 | Ga0307409_100198578 | 3300031995 | Bacteria | 1792 |
| 254 | Ga0307409_100631356 | 3300031995 | Bacteria | 1063 |
| 255 | Ga0307416_100282083 | 3300032002 | Bacteria | 1638 |
| 256 | Ga0307414_10402960 | 3300032004 | Bacteria | 1189 |
| 257 | Ga0307411_10157700 | 3300032005 | Bacteria | 1695 |
| 258 | Ga0307415_100061565 | 3300032126 | Bacteria | 2599 |
| 259 | Ga0307510_10088607 | 3300033180 | Bacteria | 2953 |
| 260 | Ga0373930_0009738 | 3300034816 | Bacteria | 1706 |
| 261 | Ga0373959_0036018 | 3300034820 | Bacteria | 1020 |
| 262 | Ga0373926_0175535 | 3300035083 | Bacteria | 821 |
| 263 | Ga0373934_0010894 | 3300035086 | Bacteria | 3418 |
| 264 | Ga0373932_0077584 | 3300035112 | Bacteria | 1043 |
| 265 | Ga0373936_0010438 | 3300035113 | Bacteria | 3504 |
| 266 | Ga0373936_0013323 | 3300035113 | Bacteria | 3138 |
| 267 | Ga0373936_0050949 | 3300035113 | Bacteria | 1675 |
| 268 | Ga0373945_0006568 | 3300035116 | Bacteria | 3759 |
| 269 | Ga0373953_0000673 | 3300035117 | Bacteria | 9469 |
| 270 | Ga0373953_0025074 | 3300035117 | Bacteria | 2274 |
| 271 | Ga0373954_0005265 | 3300035118 | Bacteria | 5589 |
| 272 | Ga0373954_0162269 | 3300035118 | Bacteria | 1094 |
| 273 | Ga0373956_0006410 | 3300035119 | Bacteria | 4714 |
| 274 | Ga0373956_0155210 | 3300035119 | Bacteria | 1077 |
| 275 | Ga0373956_0260717 | 3300035119 | Bacteria | 824 |
| 276 | Ga0373960_0012973 | 3300035121 | Bacteria | 2081 |
| 277 | Ga0373943_0004964 | 3300035170 | Bacteria | 6007 |
| 278 | Ga0373943_0034310 | 3300035170 | Bacteria | 2420 |
| 279 | Ga0373943_0135388 | 3300035170 | Bacteria | 1322 |
| 280 | Ga0373943_0360124 | 3300035170 | Bacteria | 835 |
| 281 | Ga0373946_0037156 | 3300035171 | Bacteria | 1978 |
| 282 | Ga0373946_0149219 | 3300035171 | Bacteria | 1089 |
| 283 | Ga0373955_0001256 | 3300035172 | Bacteria | 10785 |
| 284 | Ga0373955_0027969 | 3300035172 | Bacteria | 2920 |
| 285 | Ga0373955_0147343 | 3300035172 | Bacteria | 1384 |
| 286 | Ga0373942_0006658 | 3300035207 | Bacteria | 2668 |
| 287 | Ga0373924_0011970 | 3300035410 | Bacteria | 3232 |
| 288 | Ga0373924_0014390 | 3300035410 | Bacteria | 2989 |
| 289 | Ga0373931_0002668 | 3300035691 | Bacteria | 7930 |
| 290 | Ga0373931_0044501 | 3300035691 | Bacteria | 2341 |
| 291 | Ga0373935_0002077 | 3300035692 | Bacteria | 11354 |
| 292 | Ga0373935_0034179 | 3300035692 | Bacteria | 3168 |
| 293 | Ga0373927_0002764 | 3300035695 | Bacteria | 12811 |
| 294 | Ga0373927_0013625 | 3300035695 | Bacteria | 5398 |
| 295 | Ga0373927_0019891 | 3300035695 | Bacteria | 4402 |
| 296 | Ga0373927_0026383 | 3300035695 | Bacteria | 3796 |
| 297 | Ga0373927_0200292 | 3300035695 | Bacteria | 1311 |
| 298 | Ga0373927_0254815 | 3300035695 | Bacteria | 1154 |
| 299 | Ga0373933_0001029 | 3300035724 | Bacteria | 16948 |
| 300 | Ga0373933_0042164 | 3300035724 | Bacteria | 2697 |
| 301 | Ga0373933_0080826 | 3300035724 | Bacteria | 1993 |
| 302 | Ga0373933_0082302 | 3300035724 | Bacteria | 1975 |
| 303 | Ga0373947_0002111 | 3300035725 | Bacteria | 12118 |
| 304 | Ga0373947_0003550 | 3300035725 | Bacteria | 9204 |
| 305 | Ga0373947_0329595 | 3300035725 | Bacteria | 1022 |
| 306 | Ga0373947_0372649 | 3300035725 | Bacteria | 960 |
| 307 | Ga0373937_0001173 | 3300036401 | Bacteria | 22009 |
| 308 | Ga0373937_0031691 | 3300036401 | Bacteria | 4792 |
| 309 | Ga0373937_0286831 | 3300036401 | Bacteria | 1555 |
| 310 | Ga0373937_0743069 | 3300036401 | Bacteria | 928 |
| 311 | Ga0373937_0838515 | 3300036401 | Bacteria | 868 |
| 312 | Ga0373925_0000793 | 3300037068 | Bacteria | 29112 |
| 313 | Ga0373925_0032544 | 3300037068 | Bacteria | 3839 |
| 314 | Ga0373925_0557774 | 3300037068 | Bacteria | 942 |
| 315 | Ga0395899_0012445 | 3300037312 | Bacteria | 6518 |
| 316 | Ga0395899_0114629 | 3300037312 | Bacteria | 1935 |
| 317 | Ga0395899_0151361 | 3300037312 | Bacteria | 1644 |
| 318 | Ga0395900_0009060 | 3300037418 | Bacteria | 10200 |
| 319 | Ga0395900_0271765 | 3300037418 | Bacteria | 1689 |
| 320 | Ga0395900_0625099 | 3300037418 | Bacteria | 1015 |
| 321 | Ga0395898_0023199 | 3300037466 | Bacteria | 6271 |
| 322 | Ga0436364_0178653 | 3300037853 | Bacteria | 915 |
| 323 | Ga0436364_0509594 | 3300037853 | Bacteria | 2909 |
| 324 | Ga0436364_0926771 | 3300037853 | Bacteria | 2414 |
| 325 | Ga0436364_1215520 | 3300037853 | Bacteria | 1071 |
| 326 | Ga0436364_1529500 | 3300037853 | Bacteria | 1433 |
| 327 | Ga0395901_0001645 | 3300038443 | Bacteria | 23122 |
| 328 | Ga0395901_0025404 | 3300038443 | Bacteria | 6080 |
| 329 | Ga0395901_0026006 | 3300038443 | Bacteria | 6009 |
| 330 | Ga0395901_0390194 | 3300038443 | Bacteria | 1431 |
| 331 | Ga0395901_0713624 | 3300038443 | Bacteria | 999 |
| 332 | Ga0436365_0430782 | 3300039437 | Bacteria | 4716 |
| 333 | Ga0436365_0830368 | 3300039437 | Bacteria | 3181 |
| 334 | Ga0436360_1352777 | 3300039438 | Bacteria | 870 |
| 335 | Ga0436361_0238565 | 3300039447 | Bacteria | 2728 |
| 336 | Ga0436361_0420967 | 3300039447 | Bacteria | 1350 |
| 337 | Ga0436361_0668079 | 3300039447 | Bacteria | 3936 |
| 338 | Ga0436361_0724097 | 3300039447 | Bacteria | 3718 |
| 339 | Ga0436361_1046016 | 3300039447 | Bacteria | 3391 |
| 340 | Ga0436361_1119238 | 3300039447 | Bacteria | 1319 |
| 341 | Ga0436363_0350608 | 3300039450 | Bacteria | 1575 |
| 342 | Ga0439432_087298 | 3300042006 | Bacteria | 941 |
| 343 | Ga0439462_0091481 | 3300042015 | Bacteria | 835 |
| 344 | Ga0466972_0025874 | 3300044658 | Bacteria | 2907 |
| 345 | Ga0466967_0822135 | 3300045976 | Bacteria | 923 |
| 346 | Ga0495617_004324 | 3300046452 | Bacteria | 5179 |
| 347 | Ga0495592_0002595 | 3300046454 | Bacteria | 12764 |
| 348 | Ga0495592_0008363 | 3300046454 | Bacteria | 7763 |
| 349 | Ga0495592_0084559 | 3300046454 | Bacteria | 2289 |
| 350 | Ga0495603_0000945 | 3300046455 | Bacteria | 16710 |
| 351 | Ga0495629_0002712 | 3300046459 | Bacteria | 13554 |
| 352 | Ga0495629_0021588 | 3300046459 | Bacteria | 4594 |
| 353 | Ga0495629_0213165 | 3300046459 | Bacteria | 1333 |
| 354 | Ga0495638_0024385 | 3300046460 | Bacteria | 3944 |
| 355 | Ga0495641_0003285 | 3300046461 | Bacteria | 12210 |
| 356 | Ga0495651_0000267 | 3300046462 | Bacteria | 40466 |
| 357 | Ga0495651_0028181 | 3300046462 | Bacteria | 4377 |
| 358 | Ga0495651_0328189 | 3300046462 | Bacteria | 1018 |
| 359 | Ga0495653_0000993 | 3300046463 | Bacteria | 21848 |
| 360 | Ga0495653_0009531 | 3300046463 | Bacteria | 7944 |
| 361 | Ga0495580_0002080 | 3300046472 | Bacteria | 17567 |
| 362 | Ga0495582_0000292 | 3300046473 | Bacteria | 27639 |
| 363 | Ga0495605_0068614 | 3300046474 | Bacteria | 1680 |
| 364 | Ga0495639_0001550 | 3300046475 | Bacteria | 10259 |
| 365 | Ga0495662_0000849 | 3300046476 | Bacteria | 14884 |
| 366 | Ga0495662_0034549 | 3300046476 | Bacteria | 2440 |
| 367 | Ga0495662_0156496 | 3300046476 | Bacteria | 1122 |
| 368 | Ga0495664_0000008 | 3300046477 | Bacteria | 307158 |
| 369 | Ga0495664_0001948 | 3300046477 | Bacteria | 10995 |
| 370 | Ga0495664_0083945 | 3300046477 | Bacteria | 1911 |
| 371 | Ga0495584_0013470 | 3300046491 | Bacteria | 4175 |
| 372 | Ga0495594_0001470 | 3300046499 | Bacteria | 12230 |
| 373 | Ga0495594_0186359 | 3300046499 | Bacteria | 1182 |
| 374 | Ga0495608_0000226 | 3300046511 | Bacteria | 40663 |
| 375 | Ga0495608_0000752 | 3300046511 | Bacteria | 22646 |
| 376 | Ga0495610_0029435 | 3300046512 | Bacteria | 2892 |
| 377 | Ga0495618_0000826 | 3300046514 | Bacteria | 21563 |
| 378 | Ga0495618_0002717 | 3300046514 | Bacteria | 11271 |
| 379 | Ga0495618_0005562 | 3300046514 | Bacteria | 7668 |
| 380 | Ga0495618_0190742 | 3300046514 | Bacteria | 1300 |
| 381 | Ga0495618_0215611 | 3300046514 | Bacteria | 1212 |
| 382 | Ga0495628_0000802 | 3300046516 | Bacteria | 29022 |
| 383 | Ga0495628_0182750 | 3300046516 | Bacteria | 1585 |
| 384 | Ga0495628_0210369 | 3300046516 | Bacteria | 1463 |
| 385 | Ga0495628_0273683 | 3300046516 | Bacteria | 1255 |
| 386 | Ga0495630_0005531 | 3300046517 | Bacteria | 8918 |
| 387 | Ga0495630_0007451 | 3300046517 | Bacteria | 7821 |
| 388 | Ga0495630_0098543 | 3300046517 | Bacteria | 2211 |
| 389 | Ga0495630_0162145 | 3300046517 | Bacteria | 1702 |
| 390 | Ga0495630_0304170 | 3300046517 | Bacteria | 1219 |
| 391 | Ga0495643_0030357 | 3300046522 | Bacteria | 3018 |
| 392 | Ga0495648_0004029 | 3300046524 | Bacteria | 12688 |
| 393 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 394 | Ga0495652_0031701 | 3300046529 | Bacteria | 4626 |
| 395 | Ga0495652_0098290 | 3300046529 | Bacteria | 2380 |
| 396 | Ga0495652_0216764 | 3300046529 | Bacteria | 1441 |
| 397 | Ga0495665_0007476 | 3300046531 | Bacteria | 5911 |
| 398 | Ga0495640_0000020 | 3300046533 | Bacteria | 116618 |
| 399 | Ga0495640_0001646 | 3300046533 | Bacteria | 17676 |
| 400 | Ga0495640_0019558 | 3300046533 | Bacteria | 4995 |
| 401 | Ga0495640_0042775 | 3300046533 | Bacteria | 3158 |
| 402 | Ga0495640_0053872 | 3300046533 | Bacteria | 2757 |
| 403 | Ga0495586_0008127 | 3300046535 | Bacteria | 5595 |
| 404 | Ga0495586_0098135 | 3300046535 | Bacteria | 1624 |
| 405 | Ga0495587_0000005 | 3300046536 | Bacteria | 358412 |
| 406 | Ga0495587_0001299 | 3300046536 | Bacteria | 16601 |
| 407 | Ga0495587_0033618 | 3300046536 | Bacteria | 3095 |
| 408 | Ga0495645_0000007 | 3300046543 | Bacteria | 376299 |
| 409 | Ga0495645_0001446 | 3300046543 | Bacteria | 16039 |
| 410 | Ga0495645_0167364 | 3300046543 | Bacteria | 1515 |
| 411 | Ga0495622_0000730 | 3300046557 | Bacteria | 18608 |
| 412 | Ga0495667_0000417 | 3300046559 | Bacteria | 27353 |
| 413 | Ga0495667_0000618 | 3300046559 | Bacteria | 22683 |
| 414 | Ga0495667_0024401 | 3300046559 | Bacteria | 4072 |
| 415 | Ga0495634_0001197 | 3300046642 | Bacteria | 23919 |
| 416 | Ga0495634_0004645 | 3300046642 | Bacteria | 10700 |
| 417 | Ga0495634_0014340 | 3300046642 | Bacteria | 5718 |
| 418 | Ga0495634_0017125 | 3300046642 | Bacteria | 5175 |
| 419 | Ga0495634_0056664 | 3300046642 | Bacteria | 2617 |
| 420 | Ga0495635_0000010 | 3300046663 | Bacteria | 246385 |
| 421 | Ga0495635_0007245 | 3300046663 | Bacteria | 7749 |
| 422 | Ga0495635_0012783 | 3300046663 | Bacteria | 5879 |
| 423 | Ga0495635_0084233 | 3300046663 | Bacteria | 2176 |
| 424 | Ga0495635_0139281 | 3300046663 | Bacteria | 1653 |
| 425 | Ga0495588_0001338 | 3300046674 | Bacteria | 10527 |
| 426 | Ga0495657_0006151 | 3300046675 | Bacteria | 9408 |
| 427 | Ga0495599_0000240 | 3300046678 | Bacteria | 34600 |
| 428 | Ga0495599_0008292 | 3300046678 | Bacteria | 6319 |
| 429 | Ga0495599_0219060 | 3300046678 | Bacteria | 1165 |
| 430 | Ga0495623_0001009 | 3300046679 | Bacteria | 19010 |
| 431 | Ga0495623_0044694 | 3300046679 | Bacteria | 2814 |
| 432 | Ga0495623_0176924 | 3300046679 | Bacteria | 1242 |
| 433 | Ga0495646_0000663 | 3300046680 | Bacteria | 18904 |
| 434 | Ga0495646_0250332 | 3300046680 | Bacteria | 949 |
| 435 | Ga0495647_0000586 | 3300046681 | Bacteria | 10782 |
| 436 | Ga0495658_0001493 | 3300046683 | Bacteria | 12266 |
| 437 | Ga0495658_0217937 | 3300046683 | Bacteria | 1194 |
| 438 | Ga0495613_0000652 | 3300046689 | Bacteria | 27491 |
| 439 | Ga0495613_0442760 | 3300046689 | Bacteria | 881 |
| 440 | Ga0495600_0000016 | 3300046809 | Bacteria | 111762 |
| 441 | Ga0495600_0029967 | 3300046809 | Bacteria | 3524 |
| 442 | Ga0495600_0254262 | 3300046809 | Bacteria | 1117 |
| 443 | Ga0495581_0045927 | 3300047315 | Bacteria | 2524 |
| 444 | Ga0495581_0097307 | 3300047315 | Bacteria | 1709 |
| 445 | Ga0495581_0206094 | 3300047315 | Bacteria | 1150 |
| 446 | Ga0495581_0214093 | 3300047315 | Bacteria | 1126 |
| 447 | Ga0495581_0224576 | 3300047315 | Bacteria | 1098 |
| 448 | Ga0495604_0000634 | 3300047317 | Bacteria | 30185 |
| 449 | Ga0495604_0001065 | 3300047317 | Bacteria | 22769 |
| 450 | Ga0495604_0331336 | 3300047317 | Bacteria | 1015 |
| 451 | Ga0495674_0000012 | 3300047319 | Bacteria | 270651 |
| 452 | Ga0495674_0001892 | 3300047319 | Bacteria | 20641 |
| 453 | Ga0495674_0002470 | 3300047319 | Bacteria | 18051 |
| 454 | Ga0495674_0109121 | 3300047319 | Bacteria | 2348 |
| 455 | Ga0495674_0312067 | 3300047319 | Bacteria | 1283 |
| 456 | Ga0495672_0006187 | 3300047320 | Bacteria | 9336 |
| 457 | Ga0495676_0221730 | 3300047321 | Bacteria | 1303 |
| 458 | Ga0495676_0233955 | 3300047321 | Bacteria | 1261 |
| 459 | Ga0495680_0001504 | 3300047322 | Bacteria | 25007 |
| 460 | Ga0495680_0034751 | 3300047322 | Bacteria | 4067 |
| 461 | Ga0495680_0155228 | 3300047322 | Bacteria | 1666 |
| 462 | Ga0495675_0271982 | 3300047444 | Bacteria | 1012 |
| 463 | Ga0495684_0001027 | 3300047471 | Bacteria | 22679 |
| 464 | Ga0495684_0069917 | 3300047471 | Bacteria | 2669 |
| 465 | Ga0495684_0081519 | 3300047471 | Bacteria | 2455 |
| 466 | Ga0495686_0038670 | 3300047472 | Bacteria | 3050 |
| 467 | Ga0495593_0003844 | 3300047673 | Bacteria | 8966 |
| 468 | Ga0495593_0096876 | 3300047673 | Bacteria | 1515 |
| 469 | Ga0495602_0001567 | 3300048088 | Bacteria | 22767 |
| 470 | Ga0495602_0015059 | 3300048088 | Bacteria | 7821 |
| 471 | Ga0495602_0043419 | 3300048088 | Bacteria | 4088 |
| 472 | Ga0495602_0260754 | 3300048088 | Bacteria | 1286 |
| 473 | Ga0495614_0000798 | 3300048089 | Bacteria | 13353 |
| 474 | Ga0496100_0000386 | 3300048903 | Bacteria | 21408 |
| 475 | Ga0496100_0068230 | 3300048903 | Bacteria | 2364 |
| 476 | Ga0496100_0145217 | 3300048903 | Bacteria | 1686 |
| 477 | Ga0496101_0001608 | 3300048904 | Bacteria | 13584 |
| 478 | Ga0496101_0033440 | 3300048904 | Bacteria | 3626 |
| 479 | Ga0496101_0169041 | 3300048904 | Bacteria | 1680 |
| 480 | Ga0496102_0021728 | 3300048905 | Bacteria | 5678 |
| 481 | Ga0496102_0337578 | 3300048905 | Bacteria | 1419 |
| 482 | Ga0496104_0028292 | 3300048907 | Bacteria | 5195 |
| 483 | Ga0496104_0030395 | 3300048907 | Bacteria | 5019 |
| 484 | Ga0496104_0144635 | 3300048907 | Bacteria | 2283 |
| 485 | Ga0496104_0156567 | 3300048907 | Bacteria | 2186 |
| 486 | Ga0496104_0203282 | 3300048907 | Bacteria | 1893 |
| 487 | Ga0496104_0272943 | 3300048907 | Bacteria | 1604 |
| 488 | Ga0496104_0382034 | 3300048907 | Bacteria | 1321 |
| 489 | Ga0496104_0407281 | 3300048907 | Bacteria | 1272 |
| 490 | Ga0496105_0000577 | 3300048908 | Bacteria | 24302 |
| 491 | Ga0496105_0001440 | 3300048908 | Bacteria | 16748 |
| 492 | Ga0496105_0044270 | 3300048908 | Bacteria | 3671 |
| 493 | Ga0496105_0089217 | 3300048908 | Bacteria | 2547 |
| 494 | Ga0496106_0000936 | 3300048909 | Bacteria | 21268 |
| 495 | Ga0496106_0048536 | 3300048909 | Bacteria | 3197 |
| 496 | Ga0496106_0267626 | 3300048909 | Bacteria | 1368 |
| 497 | Ga0496106_0454247 | 3300048909 | Bacteria | 1029 |
| 498 | Ga0496107_0003679 | 3300048910 | Bacteria | 10307 |
| 499 | Ga0496107_0075383 | 3300048910 | Bacteria | 2455 |
| 500 | Ga0496108_0001099 | 3300048911 | Bacteria | 21118 |
| 501 | Ga0496109_0005653 | 3300048912 | Bacteria | 10459 |
| 502 | Ga0496109_0034719 | 3300048912 | Bacteria | 4545 |
| 503 | Ga0496109_0063118 | 3300048912 | Bacteria | 3388 |
| 504 | Ga0496109_0132048 | 3300048912 | Bacteria | 2331 |
| 505 | Ga0496109_0472977 | 3300048912 | Bacteria | 1183 |
| 506 | Ga0496110_0006526 | 3300048913 | Bacteria | 9255 |
| 507 | Ga0496110_0010410 | 3300048913 | Bacteria | 7562 |
| 508 | Ga0496110_0135880 | 3300048913 | Bacteria | 2222 |
| 509 | Ga0496110_0146982 | 3300048913 | Bacteria | 2133 |
| 510 | Ga0496110_0472103 | 3300048913 | Bacteria | 1143 |
| 511 | Ga0496111_0001036 | 3300048914 | Bacteria | 15280 |
| 512 | Ga0496111_0101113 | 3300048914 | Bacteria | 2118 |
| 513 | Ga0496111_0225681 | 3300048914 | Bacteria | 1391 |
| 514 | Ga0496112_0007251 | 3300048915 | Bacteria | 9827 |
| 515 | Ga0496112_0010555 | 3300048915 | Bacteria | 8388 |
| 516 | Ga0496112_0028281 | 3300048915 | Bacteria | 5410 |
| 517 | Ga0496112_0283366 | 3300048915 | Bacteria | 1604 |
| 518 | Ga0496112_0335972 | 3300048915 | Bacteria | 1454 |
| 519 | Ga0496113_0010202 | 3300048916 | Bacteria | 6201 |
| 520 | Ga0496113_0035630 | 3300048916 | Bacteria | 3640 |
| 521 | Ga0496113_0245133 | 3300048916 | Bacteria | 1430 |
| 522 | Ga0496114_0001665 | 3300048917 | Bacteria | 16855 |
| 523 | Ga0496114_0059122 | 3300048917 | Bacteria | 3202 |
| 524 | Ga0496115_0004212 | 3300048918 | Bacteria | 10395 |
| 525 | Ga0496115_0022781 | 3300048918 | Bacteria | 4856 |
| 526 | Ga0496115_0060641 | 3300048918 | Bacteria | 3048 |
| 527 | Ga0496115_0246226 | 3300048918 | Bacteria | 1473 |
| 528 | Ga0496115_0289532 | 3300048918 | Bacteria | 1344 |
| 529 | Ga0496118_0289312 | 3300048921 | Bacteria | 907 |
| 530 | Ga0496119_0002304 | 3300048922 | Bacteria | 21104 |
| 531 | Ga0496122_0029679 | 3300048925 | Bacteria | 4604 |
| 532 | Ga0496123_0001703 | 3300048926 | Bacteria | 29387 |
| 533 | Ga0496124_0178236 | 3300048927 | Bacteria | 1638 |
| 534 | Ga0496125_0055217 | 3300048928 | Bacteria | 3238 |
| 535 | Ga0501031_0147951 | 3300049568 | Bacteria | 1534 |
| 536 | Ga0501034_0005569 | 3300049571 | Bacteria | 13720 |
| 537 | Ga0501034_0037874 | 3300049571 | Bacteria | 4884 |
| 538 | Ga0501038_0297549 | 3300049574 | Bacteria | 1267 |
| 539 | Ga0501039_0063551 | 3300049575 | Bacteria | 2860 |
| 540 | Ga0501039_0123595 | 3300049575 | Bacteria | 2029 |
| 541 | Ga0501040_0034656 | 3300049576 | Bacteria | 3419 |
| 542 | Ga0501040_0040377 | 3300049576 | Bacteria | 3175 |
| 543 | Ga0501040_0204774 | 3300049576 | Bacteria | 1401 |
| 544 | Ga0501041_0066717 | 3300049577 | Bacteria | 2205 |
| 545 | Ga0501041_0107712 | 3300049577 | Bacteria | 1728 |
| 546 | Ga0501042_0055536 | 3300049578 | Bacteria | 2827 |
| 547 | Ga0501042_0271866 | 3300049578 | Bacteria | 1224 |
| 548 | Ga0501043_0190887 | 3300049579 | Bacteria | 1593 |
| 549 | Ga0501046_0181075 | 3300049580 | Bacteria | 1576 |
| 550 | Ga0501048_0000736 | 3300049582 | Bacteria | 23987 |
| 551 | Ga0501068_0006174 | 3300049584 | Bacteria | 6592 |
| 552 | Ga0501071_0233973 | 3300049587 | Bacteria | 1385 |
| 553 | Ga0501074_0433417 | 3300049590 | Bacteria | 932 |
| 554 | Ga0501075_0104615 | 3300049591 | Bacteria | 2151 |
| 555 | Ga0501075_0135814 | 3300049591 | Bacteria | 1874 |
| 556 | Ga0501075_0185018 | 3300049591 | Bacteria | 1589 |
| 557 | Ga0501077_0037456 | 3300049593 | Bacteria | 3088 |
| 558 | Ga0501077_0038511 | 3300049593 | Bacteria | 3044 |
| 559 | Ga0501079_0140869 | 3300049741 | Bacteria | 1879 |
| 560 | Ga0501079_0556996 | 3300049741 | Bacteria | 902 |
| 561 | Ga0501081_0006724 | 3300049743 | Bacteria | 7477 |
| 562 | Ga0501081_0044717 | 3300049743 | Bacteria | 3040 |
| 563 | Ga0501081_0163142 | 3300049743 | Bacteria | 1606 |
| 564 | Ga0501083_0110068 | 3300049744 | Bacteria | 1811 |
| 565 | Ga0501083_0119140 | 3300049744 | Bacteria | 1732 |
| 566 | Ga0501045_0047311 | 3300049824 | Bacteria | 3133 |
| 567 | Ga0501045_0155339 | 3300049824 | Bacteria | 1702 |
| 568 | nmdc:mga03683_139443_c1 | 3300050489 | Bacteria | 1089 |
| 569 | nmdc:mga03683_608_c1 | 3300050489 | Bacteria | 6593 |
| 570 | nmdc:mga03n38_137420_c1 | 3300050490 | Bacteria | 1217 |
| 571 | nmdc:mga00v17_49851_c1 | 3300050491 | Bacteria | 2541 |
| 572 | nmdc:mga0yw44_198467_c1 | 3300050492 | Bacteria | 1325 |
| 573 | nmdc:mga0yw44_210721_c1 | 3300050492 | Bacteria | 1285 |
| 574 | nmdc:mga0yw44_2155_c1 | 3300050492 | Bacteria | 8263 |
| 575 | nmdc:mga0yw44_34864_c2 | 3300050492 | Bacteria | 1521 |
| 576 | nmdc:mga0yw44_48183_c1 | 3300050492 | Bacteria | 2569 |
| 577 | nmdc:mga0yw44_85727_c1 | 3300050492 | Bacteria | 1982 |
| 578 | nmdc:mga0yw44_87507_c2 | 3300050492 | Bacteria | 1001 |
| 579 | nmdc:mga06z11_305669_c1 | 3300050494 | Bacteria | 946 |
| 580 | nmdc:mga04h51_153981_c1 | 3300050495 | Bacteria | 880 |
| 581 | nmdc:mga04h51_24987_c1 | 3300050495 | Bacteria | 1835 |
| 582 | nmdc:mga07m45_243067_c1 | 3300050496 | Bacteria | 1047 |
| 583 | nmdc:mga07m45_33114_c1 | 3300050496 | Bacteria | 2869 |
| 584 | nmdc:mga07m45_69532_c1 | 3300050496 | Bacteria | 2001 |
| 585 | nmdc:mga05p37_267208_c1 | 3300050507 | Bacteria | 2045 |
| 586 | nmdc:mga09592_304303_c1 | 3300050508 | Bacteria | 1382 |
| 587 | nmdc:mga06r32_24791_c1 | 3300050510 | Bacteria | 5574 |
| 588 | nmdc:mga06r32_50085_c1 | 3300050510 | Bacteria | 3995 |
| 589 | nmdc:mga08y16_387316_c1 | 3300050511 | Bacteria | 1432 |
| 590 | nmdc:mga0sz30_100888_c1 | 3300050516 | Bacteria | 1261 |
| 591 | nmdc:mga0sz30_17589_c1 | 3300050516 | Bacteria | 2191 |
| 592 | nmdc:mga0sz30_2513_c1 | 3300050516 | Bacteria | 6540 |
| 593 | Ga0495601_0000011 | 3300053077 | Bacteria | 264937 |
| 594 | Ga0495601_0000880 | 3300053077 | Bacteria | 16384 |
| 595 | Ga0495601_0006281 | 3300053077 | Bacteria | 6941 |
| 596 | Ga0495601_0017335 | 3300053077 | Bacteria | 4369 |
| 597 | Ga0495601_0041000 | 3300053077 | Bacteria | 2901 |
| 598 | Ga0495601_0049794 | 3300053077 | Bacteria | 2642 |
| 599 | Ga0495612_0002032 | 3300053078 | Bacteria | 8338 |
| 600 | Ga0495612_0002357 | 3300053078 | Bacteria | 7780 |
| 601 | Ga0495612_0006886 | 3300053078 | Bacteria | 4651 |
| 602 | Ga0495595_0000308 | 3300053084 | Bacteria | 19036 |
| 603 | Ga0495595_0000906 | 3300053084 | Bacteria | 11427 |
| 604 | Ga0495595_0024263 | 3300053084 | Bacteria | 2678 |
| 605 | Ga0495595_0070098 | 3300053084 | Bacteria | 1656 |
| 606 | Ga0495619_0000013 | 3300053085 | Bacteria | 264865 |
| 607 | Ga0495619_0001242 | 3300053085 | Bacteria | 16698 |
| 608 | Ga0495619_0003116 | 3300053085 | Bacteria | 10755 |
| 609 | Ga0495619_0005937 | 3300053085 | Bacteria | 7731 |
| 610 | Ga0495619_0010198 | 3300053085 | Bacteria | 5918 |
| 611 | Ga0495619_0070547 | 3300053085 | Bacteria | 2336 |
| 612 | Ga0500644_0196970 | 3300053088 | Bacteria | 832 |
| 613 | Ga0500641_0003638 | 3300053096 | Bacteria | 5445 |
| 614 | Ga0500556_0000148 | 3300053104 | Bacteria | 58772 |
| 615 | Ga0500556_0000229 | 3300053104 | Bacteria | 45380 |
| 616 | Ga0500595_007088 | 3300053119 | Bacteria | 4687 |
| 617 | Ga0500642_0105162 | 3300053130 | Bacteria | 1316 |
| 618 | Ga0500559_0000528 | 3300053136 | Bacteria | 26610 |
| 619 | Ga0500568_0041547 | 3300053139 | Bacteria | 1847 |
| 620 | Ga0500577_0074434 | 3300053142 | Bacteria | 1340 |
| 621 | Ga0500616_0113986 | 3300053153 | Bacteria | 1301 |
| 622 | Ga0500636_0032012 | 3300053177 | Bacteria | 3112 |
| 623 | Ga0500576_031015 | 3300053725 | Bacteria | 2429 |
| 624 | Ga0501084_0004692 | 3300054114 | Bacteria | 11162 |
| 625 | Ga0501084_0016658 | 3300054114 | Bacteria | 6105 |
| 626 | Ga0501084_0325150 | 3300054114 | Bacteria | 1299 |
| 627 | Ga0501082_0034656 | 3300060353 | Bacteria | 4351 |
| 628 | Ga0501082_0068633 | 3300060353 | Bacteria | 3052 |
| 629 | Ga0530510_0025629 | 3300061734 | Bacteria | 4217 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039438 | Ga0436360_1352777 | Ga0436360_1352777_33_701 | 195 |
| 2 | 3300035725 | Ga0373947_0372649 | Ga0373947_0372649_230_910 | 221 |
| 3 | 3300005467 | Ga0070706_100503280 | Ga0070706_1005032801 | 224 |
| 4 | 3300005548 | Ga0070665_100005880 | Ga0070665_1000058805 | 228 |
| 5 | 3300031995 | Ga0307409_100149774 | Ga0307409_1001497742 | 228 |
| 6 | 3300035695 | Ga0373927_0254815 | Ga0373927_0254815_108_872 | 228 |
| 7 | 3300037068 | Ga0373925_0032544 | Ga0373925_0032544_1282_2046 | 228 |
| 8 | 3300035695 | Ga0373927_0013625 | Ga0373927_0013625_804_1568 | 231 |
| 9 | 3300047472 | Ga0495686_0038670 | Ga0495686_0038670_1353_2111 | 231 |
| 10 | 3300037853 | Ga0436364_0178653 | Ga0436364_0178653_192_902 | 232 |
| 11 | 3300048927 | Ga0496124_0178236 | Ga0496124_0178236_774_1562 | 232 |
| 12 | 3300048928 | Ga0496125_0055217 | Ga0496125_0055217_37_825 | 232 |
| 13 | 3300050492 | nmdc:mga0yw44_210721_c1 | nmdc:mga0yw44_210721_c1_131_898 | 232 |
| 14 | 3300042006 | Ga0439432_087298 | Ga0439432_087298_21_728 | 233 |
| 15 | 3300042015 | Ga0439462_0091481 | Ga0439462_0091481_94_801 | 233 |
| 16 | 3300046474 | Ga0495605_0068614 | Ga0495605_0068614_31_738 | 233 |
| 17 | 3300046522 | Ga0495643_0030357 | Ga0495643_0030357_32_739 | 233 |
| 18 | 3300048907 | Ga0496104_0144635 | Ga0496104_0144635_1254_2015 | 233 |
| 19 | 3300038443 | Ga0395901_0713624 | Ga0395901_0713624_144_905 | 234 |
| 20 | 3300047317 | Ga0495604_0331336 | Ga0495604_0331336_36_746 | 234 |
| 21 | 3300049578 | Ga0501042_0055536 | Ga0501042_0055536_136_933 | 235 |
| 22 | 3300049591 | Ga0501075_0185018 | Ga0501075_0185018_763_1560 | 235 |
| 23 | 3300054114 | Ga0501084_0325150 | Ga0501084_0325150_361_1125 | 235 |
| 24 | 3300037312 | Ga0395899_0151361 | Ga0395899_0151361_364_1182 | 237 |
| 25 | 3300014326 | Ga0157380_10102442 | Ga0157380_101024422 | 238 |
| 26 | 3300006038 | Ga0075365_10160025 | Ga0075365_101600252 | 242 |
| 27 | 3300009553 | Ga0105249_10712514 | Ga0105249_107125141 | 242 |
| 28 | 3300025901 | Ga0207688_10083867 | Ga0207688_100838671 | 242 |
| 29 | 3300050492 | nmdc:mga0yw44_85727_c1 | nmdc:mga0yw44_85727_c1_833_1654 | 242 |
| 30 | 3300026118 | Ga0207675_100569833 | Ga0207675_1005698332 | 243 |
| 31 | 3300035118 | Ga0373954_0162269 | Ga0373954_0162269_41_838 | 243 |
| 32 | 3300036401 | Ga0373937_0286831 | Ga0373937_0286831_308_1105 | 243 |
| 33 | 3300046514 | Ga0495618_0215611 | Ga0495618_0215611_238_1035 | 243 |
| 34 | 3300046529 | Ga0495652_0216764 | Ga0495652_0216764_205_1002 | 243 |
| 35 | 3300046663 | Ga0495635_0139281 | Ga0495635_0139281_268_1065 | 243 |
| 36 | 3300046809 | Ga0495600_0254262 | Ga0495600_0254262_28_792 | 243 |
| 37 | 3300048915 | Ga0496112_0283366 | Ga0496112_0283366_475_1239 | 243 |
| 38 | 3300048915 | Ga0496112_0335972 | Ga0496112_0335972_429_1190 | 243 |
| 39 | 3300053077 | Ga0495601_0017335 | Ga0495601_0017335_1513_2310 | 243 |
| 40 | 3300053084 | Ga0495595_0024263 | Ga0495595_0024263_1046_1843 | 243 |
| 41 | 3300053085 | Ga0495619_0070547 | Ga0495619_0070547_96_893 | 243 |
| 42 | 3300006042 | Ga0075368_10092230 | Ga0075368_100922302 | 244 |
| 43 | 3300050495 | nmdc:mga04h51_153981_c1 | nmdc:mga04h51_153981_c1_17_781 | 244 |
| 44 | 3300031995 | Ga0307409_100198578 | Ga0307409_1001985781 | 245 |
| 45 | 3300046452 | Ga0495617_004324 | Ga0495617_004324_2142_2903 | 245 |
| 46 | iso_pu_bacteria | 2883577096 | 2883579824 | 245 |
| 47 | 3300050494 | nmdc:mga06z11_305669_c1 | nmdc:mga06z11_305669_c1_56_844 | 246 |
| 48 | iso_pu_bacteria | 2842694124 | 2842698133 | 246 |
| 49 | iso_pu_bacteria | 3003665799 | 3003667977 | 246 |
| 50 | 3300039447 | Ga0436361_0238565 | Ga0436361_0238565_1355_2098 | 247 |
| 51 | iso_pu_bacteria | 2508501050 | 2508735921 | 247 |
| 52 | iso_pu_bacteria | 2508501114 | 2509078361 | 247 |
| 53 | iso_pu_bacteria | 2513237087 | 2513594010 | 247 |
| 54 | iso_pu_bacteria | 2545555834 | 2545677801 | 247 |
| 55 | iso_pu_bacteria | 2597490356 | 2599105875 | 247 |
| 56 | iso_pu_bacteria | 2643221558 | 2643813866 | 247 |
| 57 | iso_pu_bacteria | 2773857925 | 2774871283 | 247 |
| 58 | iso_pu_bacteria | 2775506901 | 2776259565 | 247 |
| 59 | iso_pu_bacteria | 2818991467 | 2819720438 | 247 |
| 60 | iso_pu_bacteria | 2821443989 | 2821447924 | 247 |
| 61 | iso_pu_bacteria | 2835312727 | 2835315376 | 247 |
| 62 | iso_pu_bacteria | 2841911363 | 2841915658 | 247 |
| 63 | iso_pu_bacteria | 2841917233 | 2841920860 | 247 |
| 64 | iso_pu_bacteria | 2842333319 | 2842337323 | 247 |
| 65 | iso_pu_bacteria | 2842698319 | 2842703264 | 247 |
| 66 | iso_pu_bacteria | 2844533157 | 2844533572 | 247 |
| 67 | iso_pu_bacteria | 2846952575 | 2846955659 | 247 |
| 68 | iso_pu_bacteria | 2848858292 | 2848862356 | 247 |
| 69 | iso_pu_bacteria | 2882456835 | 2882462444 | 247 |
| 70 | iso_pu_bacteria | 2894232714 | 2894238819 | 247 |
| 71 | iso_pu_bacteria | 2909042592 | 2909042693 | 247 |
| 72 | iso_pu_bacteria | 641522639 | 641642668 | 247 |
| 73 | iso_pu_bacteria | 643348564 | 643599895 | 247 |
| 74 | iso_pu_bacteria | 8002060224 | 8002063720 | 247 |
| 75 | iso_pu_bacteria | 8054002106 | 8054006785 | 247 |
| 76 | 3300005434 | Ga0070709_10035830 | Ga0070709_100358302 | 248 |
| 77 | 3300005435 | Ga0070714_100000887 | Ga0070714_10000088711 | 248 |
| 78 | 3300005436 | Ga0070713_100068263 | Ga0070713_1000682632 | 248 |
| 79 | 3300005437 | Ga0070710_10013882 | Ga0070710_100138822 | 248 |
| 80 | 3300025906 | Ga0207699_10028993 | Ga0207699_100289932 | 248 |
| 81 | 3300025915 | Ga0207693_10067985 | Ga0207693_100679852 | 248 |
| 82 | 3300025928 | Ga0207700_10699050 | Ga0207700_106990501 | 248 |
| 83 | 3300025929 | Ga0207664_10013831 | Ga0207664_100138317 | 248 |
| 84 | iso_pu_bacteria | 2524023250 | 2524612688 | 248 |
| 85 | 3300035172 | Ga0373955_0147343 | Ga0373955_0147343_159_914 | 249 |
| 86 | 3300006942 | Ga0099824_1005450 | Ga0099824_100545011 | 250 |
| 87 | 3300027296 | Ga0209389_1000010 | Ga0209389_1000010111 | 250 |
| 88 | 3300027357 | Ga0209589_1000016 | Ga0209589_1000016103 | 250 |
| 89 | 3300027361 | Ga0209489_100016 | Ga0209489_100016111 | 250 |
| 90 | 3300037853 | Ga0436364_0509594 | Ga0436364_0509594_2025_2801 | 250 |
| 91 | 3300037853 | Ga0436364_0926771 | Ga0436364_0926771_308_1060 | 250 |
| 92 | 3300047320 | Ga0495672_0006187 | Ga0495672_0006187_1395_2153 | 250 |
| 93 | 3300049578 | Ga0501042_0271866 | Ga0501042_0271866_43_813 | 250 |
| 94 | 3300003316 | rootH1_10051438 | rootH1_100514382 | 251 |
| 95 | 3300003320 | rootH2_10064931 | rootH2_100649314 | 251 |
| 96 | 3300003322 | rootL2_10285924 | rootL2_102859243 | 251 |
| 97 | 3300003354 | JGI25160J50197_1008385 | JGI25160J50197_10083853 | 251 |
| 98 | 3300005327 | Ga0070658_10068440 | Ga0070658_100684403 | 251 |
| 99 | 3300005328 | Ga0070676_10187874 | Ga0070676_101878741 | 251 |
| 100 | 3300005335 | Ga0070666_10110658 | Ga0070666_101106583 | 251 |
| 101 | 3300005337 | Ga0070682_100022805 | Ga0070682_1000228053 | 251 |
| 102 | 3300005338 | Ga0068868_100404277 | Ga0068868_1004042772 | 251 |
| 103 | 3300005340 | Ga0070689_100000836 | Ga0070689_1000008367 | 251 |
| 104 | 3300005340 | Ga0070689_100301370 | Ga0070689_1003013702 | 251 |
| 105 | 3300005341 | Ga0070691_10010035 | Ga0070691_100100354 | 251 |
| 106 | 3300005344 | Ga0070661_100322926 | Ga0070661_1003229262 | 251 |
| 107 | 3300005353 | Ga0070669_100331954 | Ga0070669_1003319541 | 251 |
| 108 | 3300005354 | Ga0070675_100059625 | Ga0070675_1000596254 | 251 |
| 109 | 3300005355 | Ga0070671_100000729 | Ga0070671_1000007294 | 251 |
| 110 | 3300005355 | Ga0070671_100018992 | Ga0070671_1000189925 | 251 |
| 111 | 3300005356 | Ga0070674_100222139 | Ga0070674_1002221392 | 251 |
| 112 | 3300005356 | Ga0070674_100439331 | Ga0070674_1004393312 | 251 |
| 113 | 3300005364 | Ga0070673_100001534 | Ga0070673_10000153411 | 251 |
| 114 | 3300005364 | Ga0070673_100108649 | Ga0070673_1001086493 | 251 |
| 115 | 3300005365 | Ga0070688_100055045 | Ga0070688_1000550452 | 251 |
| 116 | 3300005366 | Ga0070659_100136961 | Ga0070659_1001369612 | 251 |
| 117 | 3300005434 | Ga0070709_10241168 | Ga0070709_102411682 | 251 |
| 118 | 3300005435 | Ga0070714_100030751 | Ga0070714_1000307513 | 251 |
| 119 | 3300005435 | Ga0070714_100215794 | Ga0070714_1002157942 | 251 |
| 120 | 3300005437 | Ga0070710_10158131 | Ga0070710_101581312 | 251 |
| 121 | 3300005439 | Ga0070711_100551973 | Ga0070711_1005519732 | 251 |
| 122 | 3300005456 | Ga0070678_100118972 | Ga0070678_1001189722 | 251 |
| 123 | 3300005458 | Ga0070681_10079651 | Ga0070681_100796513 | 251 |
| 124 | 3300005459 | Ga0068867_100110763 | Ga0068867_1001107633 | 251 |
| 125 | 3300005459 | Ga0068867_100519769 | Ga0068867_1005197691 | 251 |
| 126 | 3300005543 | Ga0070672_100315775 | Ga0070672_1003157752 | 251 |
| 127 | 3300005548 | Ga0070665_100000949 | Ga0070665_10000094919 | 251 |
| 128 | 3300005548 | Ga0070665_100014232 | Ga0070665_1000142326 | 251 |
| 129 | 3300005548 | Ga0070665_100029921 | Ga0070665_1000299212 | 251 |
| 130 | 3300005548 | Ga0070665_100215600 | Ga0070665_1002156002 | 251 |
| 131 | 3300005548 | Ga0070665_100365637 | Ga0070665_1003656372 | 251 |
| 132 | 3300005563 | Ga0068855_100060491 | Ga0068855_1000604913 | 251 |
| 133 | 3300005614 | Ga0068856_100446042 | Ga0068856_1004460422 | 251 |
| 134 | 3300005615 | Ga0070702_100053730 | Ga0070702_1000537302 | 251 |
| 135 | 3300005616 | Ga0068852_100082282 | Ga0068852_1000822822 | 251 |
| 136 | 3300005616 | Ga0068852_100510218 | Ga0068852_1005102182 | 251 |
| 137 | 3300005617 | Ga0068859_100058638 | Ga0068859_1000586383 | 251 |
| 138 | 3300005618 | Ga0068864_100307300 | Ga0068864_1003073003 | 251 |
| 139 | 3300005719 | Ga0068861_100003608 | Ga0068861_1000036088 | 251 |
| 140 | 3300005841 | Ga0068863_100014040 | Ga0068863_1000140404 | 251 |
| 141 | 3300005841 | Ga0068863_100221376 | Ga0068863_1002213762 | 251 |
| 142 | 3300005842 | Ga0068858_100026651 | Ga0068858_1000266515 | 251 |
| 143 | 3300005843 | Ga0068860_100000498 | Ga0068860_10000049815 | 251 |
| 144 | 3300005843 | Ga0068860_100887706 | Ga0068860_1008877061 | 251 |
| 145 | 3300005844 | Ga0068862_100094272 | Ga0068862_1000942722 | 251 |
| 146 | 3300005844 | Ga0068862_100103938 | Ga0068862_1001039384 | 251 |
| 147 | 3300005937 | Ga0081455_10015010 | Ga0081455_100150105 | 251 |
| 148 | 3300005983 | Ga0081540_1040673 | Ga0081540_10406732 | 251 |
| 149 | 3300005985 | Ga0081539_10011961 | Ga0081539_100119613 | 251 |
| 150 | 3300006028 | Ga0070717_10049133 | Ga0070717_100491333 | 251 |
| 151 | 3300006028 | Ga0070717_10229637 | Ga0070717_102296372 | 251 |
| 152 | 3300006038 | Ga0075365_10008616 | Ga0075365_100086163 | 251 |
| 153 | 3300006038 | Ga0075365_10027464 | Ga0075365_100274643 | 251 |
| 154 | 3300006038 | Ga0075365_10074189 | Ga0075365_100741893 | 251 |
| 155 | 3300006042 | Ga0075368_10011576 | Ga0075368_100115764 | 251 |
| 156 | 3300006048 | Ga0075363_100300867 | Ga0075363_1003008671 | 251 |
| 157 | 3300006051 | Ga0075364_10068997 | Ga0075364_100689973 | 251 |
| 158 | 3300006051 | Ga0075364_10181486 | Ga0075364_101814862 | 251 |
| 159 | 3300006051 | Ga0075364_10195701 | Ga0075364_101957012 | 251 |
| 160 | 3300006175 | Ga0070712_100002004 | Ga0070712_10000200410 | 251 |
| 161 | 3300006175 | Ga0070712_100006459 | Ga0070712_1000064597 | 251 |
| 162 | 3300006177 | Ga0075362_10023530 | Ga0075362_100235302 | 251 |
| 163 | 3300006177 | Ga0075362_10035302 | Ga0075362_100353023 | 251 |
| 164 | 3300006177 | Ga0075362_10084977 | Ga0075362_100849772 | 251 |
| 165 | 3300006177 | Ga0075362_10169821 | Ga0075362_101698212 | 251 |
| 166 | 3300006178 | Ga0075367_10031561 | Ga0075367_100315613 | 251 |
| 167 | 3300006178 | Ga0075367_10128726 | Ga0075367_101287262 | 251 |
| 168 | 3300006186 | Ga0075369_10000191 | Ga0075369_1000019112 | 251 |
| 169 | 3300006186 | Ga0075369_10025034 | Ga0075369_100250342 | 251 |
| 170 | 3300006186 | Ga0075369_10055635 | Ga0075369_100556352 | 251 |
| 171 | 3300006353 | Ga0075370_10024076 | Ga0075370_100240762 | 251 |
| 172 | 3300006844 | Ga0075428_100354102 | Ga0075428_1003541022 | 251 |
| 173 | 3300006844 | Ga0075428_100371366 | Ga0075428_1003713662 | 251 |
| 174 | 3300006847 | Ga0075431_100055397 | Ga0075431_1000553974 | 251 |
| 175 | 3300006880 | Ga0075429_100322665 | Ga0075429_1003226652 | 251 |
| 176 | 3300006881 | Ga0068865_100077156 | Ga0068865_1000771562 | 251 |
| 177 | 3300006931 | Ga0097620_100058638 | Ga0097620_1000586383 | 251 |
| 178 | 3300009093 | Ga0105240_10028349 | Ga0105240_100283498 | 251 |
| 179 | 3300009093 | Ga0105240_10032124 | Ga0105240_100321243 | 251 |
| 180 | 3300009093 | Ga0105240_10040314 | Ga0105240_100403147 | 251 |
| 181 | 3300009098 | Ga0105245_10244357 | Ga0105245_102443572 | 251 |
| 182 | 3300009101 | Ga0105247_10006940 | Ga0105247_100069405 | 251 |
| 183 | 3300009147 | Ga0114129_10168319 | Ga0114129_101683193 | 251 |
| 184 | 3300009176 | Ga0105242_10142337 | Ga0105242_101423372 | 251 |
| 185 | 3300009177 | Ga0105248_10037714 | Ga0105248_100377145 | 251 |
| 186 | 3300009545 | Ga0105237_10062589 | Ga0105237_100625895 | 251 |
| 187 | 3300009551 | Ga0105238_10002503 | Ga0105238_100025035 | 251 |
| 188 | 3300009551 | Ga0105238_10017647 | Ga0105238_100176478 | 251 |
| 189 | 3300009551 | Ga0105238_10055519 | Ga0105238_100555194 | 251 |
| 190 | 3300009553 | Ga0105249_10169368 | Ga0105249_101693683 | 251 |
| 191 | 3300010159 | Ga0099796_10115115 | Ga0099796_101151151 | 251 |
| 192 | 3300010375 | Ga0105239_10310738 | Ga0105239_103107383 | 251 |
| 193 | 3300013102 | Ga0157371_10075255 | Ga0157371_100752552 | 251 |
| 194 | 3300013104 | Ga0157370_10082385 | Ga0157370_100823852 | 251 |
| 195 | 3300013104 | Ga0157370_10120794 | Ga0157370_101207942 | 251 |
| 196 | 3300013296 | Ga0157374_10369851 | Ga0157374_103698511 | 251 |
| 197 | 3300013306 | Ga0163162_10032837 | Ga0163162_100328377 | 251 |
| 198 | 3300013306 | Ga0163162_10214597 | Ga0163162_102145972 | 251 |
| 199 | 3300013307 | Ga0157372_10056501 | Ga0157372_100565014 | 251 |
| 200 | 3300013307 | Ga0157372_11074117 | Ga0157372_110741171 | 251 |
| 201 | 3300013308 | Ga0157375_10008448 | Ga0157375_100084489 | 251 |
| 202 | 3300013308 | Ga0157375_10584869 | Ga0157375_105848692 | 251 |
| 203 | 3300014325 | Ga0163163_10009024 | Ga0163163_100090244 | 251 |
| 204 | 3300014325 | Ga0163163_10074549 | Ga0163163_100745494 | 251 |
| 205 | 3300014745 | Ga0157377_10130682 | Ga0157377_101306822 | 251 |
| 206 | 3300014968 | Ga0157379_10005706 | Ga0157379_100057064 | 251 |
| 207 | 3300014968 | Ga0157379_10193567 | Ga0157379_101935672 | 251 |
| 208 | 3300014968 | Ga0157379_10288672 | Ga0157379_102886722 | 251 |
| 209 | 3300014969 | Ga0157376_10006310 | Ga0157376_100063109 | 251 |
| 210 | 3300014969 | Ga0157376_10135454 | Ga0157376_101354543 | 251 |
| 211 | 3300021361 | Ga0213872_10031469 | Ga0213872_100314692 | 251 |
| 212 | 3300021384 | Ga0213876_10160076 | Ga0213876_101600762 | 251 |
| 213 | 3300024227 | Ga0228598_1000865 | Ga0228598_10008654 | 251 |
| 214 | 3300025272 | Ga0209455_1017760 | Ga0209455_10177603 | 251 |
| 215 | 3300025284 | Ga0209130_1000270 | Ga0209130_100027021 | 251 |
| 216 | 3300025294 | Ga0209025_1000705 | Ga0209025_100070519 | 251 |
| 217 | 3300025297 | Ga0209758_1004689 | Ga0209758_10046893 | 251 |
| 218 | 3300025302 | Ga0207426_1000443 | Ga0207426_100044353 | 251 |
| 219 | 3300025898 | Ga0207692_10219764 | Ga0207692_102197642 | 251 |
| 220 | 3300025900 | Ga0207710_10008591 | Ga0207710_100085912 | 251 |
| 221 | 3300025906 | Ga0207699_10010696 | Ga0207699_100106962 | 251 |
| 222 | 3300025906 | Ga0207699_10078197 | Ga0207699_100781972 | 251 |
| 223 | 3300025906 | Ga0207699_10234391 | Ga0207699_102343911 | 251 |
| 224 | 3300025913 | Ga0207695_10109316 | Ga0207695_101093163 | 251 |
| 225 | 3300025915 | Ga0207693_10001484 | Ga0207693_100014842 | 251 |
| 226 | 3300025915 | Ga0207693_10013542 | Ga0207693_100135426 | 251 |
| 227 | 3300025915 | Ga0207693_10073706 | Ga0207693_100737063 | 251 |
| 228 | 3300025915 | Ga0207693_10212348 | Ga0207693_102123482 | 251 |
| 229 | 3300025917 | Ga0207660_10285434 | Ga0207660_102854342 | 251 |
| 230 | 3300025920 | Ga0207649_10169935 | Ga0207649_101699351 | 251 |
| 231 | 3300025920 | Ga0207649_10481192 | Ga0207649_104811921 | 251 |
| 232 | 3300025925 | Ga0207650_10010860 | Ga0207650_100108606 | 251 |
| 233 | 3300025927 | Ga0207687_10653890 | Ga0207687_106538902 | 251 |
| 234 | 3300025928 | Ga0207700_10093217 | Ga0207700_100932173 | 251 |
| 235 | 3300025928 | Ga0207700_10285224 | Ga0207700_102852242 | 251 |
| 236 | 3300025929 | Ga0207664_10025814 | Ga0207664_100258144 | 251 |
| 237 | 3300025929 | Ga0207664_10067260 | Ga0207664_100672602 | 251 |
| 238 | 3300025929 | Ga0207664_10110811 | Ga0207664_101108113 | 251 |
| 239 | 3300025929 | Ga0207664_10190069 | Ga0207664_101900692 | 251 |
| 240 | 3300025931 | Ga0207644_10051258 | Ga0207644_100512584 | 251 |
| 241 | 3300025931 | Ga0207644_10073175 | Ga0207644_100731752 | 251 |
| 242 | 3300025934 | Ga0207686_10030430 | Ga0207686_100304303 | 251 |
| 243 | 3300025936 | Ga0207670_10000845 | Ga0207670_100008457 | 251 |
| 244 | 3300025936 | Ga0207670_10272605 | Ga0207670_102726052 | 251 |
| 245 | 3300025937 | Ga0207669_10019454 | Ga0207669_100194543 | 251 |
| 246 | 3300025937 | Ga0207669_10166084 | Ga0207669_101660842 | 251 |
| 247 | 3300025938 | Ga0207704_10017693 | Ga0207704_100176932 | 251 |
| 248 | 3300025938 | Ga0207704_10179930 | Ga0207704_101799302 | 251 |
| 249 | 3300025941 | Ga0207711_10606527 | Ga0207711_106065272 | 251 |
| 250 | 3300025949 | Ga0207667_10477650 | Ga0207667_104776502 | 251 |
| 251 | 3300025960 | Ga0207651_10114126 | Ga0207651_101141263 | 251 |
| 252 | 3300025961 | Ga0207712_10167394 | Ga0207712_101673943 | 251 |
| 253 | 3300025961 | Ga0207712_10559351 | Ga0207712_105593512 | 251 |
| 254 | 3300025981 | Ga0207640_10058839 | Ga0207640_100588393 | 251 |
| 255 | 3300025986 | Ga0207658_10056344 | Ga0207658_100563443 | 251 |
| 256 | 3300025986 | Ga0207658_10098502 | Ga0207658_100985022 | 251 |
| 257 | 3300026023 | Ga0207677_10260262 | Ga0207677_102602622 | 251 |
| 258 | 3300026035 | Ga0207703_10060503 | Ga0207703_100605033 | 251 |
| 259 | 3300026041 | Ga0207639_10119287 | Ga0207639_101192872 | 251 |
| 260 | 3300026041 | Ga0207639_10207290 | Ga0207639_102072902 | 251 |
| 261 | 3300026067 | Ga0207678_10037928 | Ga0207678_100379283 | 251 |
| 262 | 3300026067 | Ga0207678_10173428 | Ga0207678_101734283 | 251 |
| 263 | 3300026078 | Ga0207702_10000187 | Ga0207702_1000018714 | 251 |
| 264 | 3300026078 | Ga0207702_10498273 | Ga0207702_104982732 | 251 |
| 265 | 3300026088 | Ga0207641_10000337 | Ga0207641_1000033719 | 251 |
| 266 | 3300026088 | Ga0207641_10330646 | Ga0207641_103306461 | 251 |
| 267 | 3300026088 | Ga0207641_10344067 | Ga0207641_103440672 | 251 |
| 268 | 3300026089 | Ga0207648_10093405 | Ga0207648_100934053 | 251 |
| 269 | 3300026089 | Ga0207648_10137854 | Ga0207648_101378542 | 251 |
| 270 | 3300026089 | Ga0207648_10316959 | Ga0207648_103169592 | 251 |
| 271 | 3300026095 | Ga0207676_10183518 | Ga0207676_101835183 | 251 |
| 272 | 3300026118 | Ga0207675_100005954 | Ga0207675_1000059545 | 251 |
| 273 | 3300026121 | Ga0207683_10122866 | Ga0207683_101228663 | 251 |
| 274 | 3300026121 | Ga0207683_10273666 | Ga0207683_102736662 | 251 |
| 275 | 3300026121 | Ga0207683_10307227 | Ga0207683_103072272 | 251 |
| 276 | 3300026142 | Ga0207698_10804038 | Ga0207698_108040381 | 251 |
| 277 | 3300027866 | Ga0209813_10015125 | Ga0209813_100151252 | 251 |
| 278 | 3300028379 | Ga0268266_10000275 | Ga0268266_1000027556 | 251 |
| 279 | 3300028379 | Ga0268266_10006726 | Ga0268266_100067266 | 251 |
| 280 | 3300028379 | Ga0268266_10069465 | Ga0268266_100694653 | 251 |
| 281 | 3300028379 | Ga0268266_10071950 | Ga0268266_100719502 | 251 |
| 282 | 3300028379 | Ga0268266_10093541 | Ga0268266_100935412 | 251 |
| 283 | 3300028379 | Ga0268266_10140588 | Ga0268266_101405883 | 251 |
| 284 | 3300028380 | Ga0268265_10027467 | Ga0268265_100274675 | 251 |
| 285 | 3300028380 | Ga0268265_10066567 | Ga0268265_100665673 | 251 |
| 286 | 3300028380 | Ga0268265_10422465 | Ga0268265_104224652 | 251 |
| 287 | 3300028381 | Ga0268264_10000375 | Ga0268264_100003758 | 251 |
| 288 | 3300028381 | Ga0268264_10074141 | Ga0268264_100741412 | 251 |
| 289 | 3300028381 | Ga0268264_10691979 | Ga0268264_106919791 | 251 |
| 290 | 3300028666 | Ga0265336_10076373 | Ga0265336_100763732 | 251 |
| 291 | 3300028800 | Ga0265338_10090470 | Ga0265338_100904702 | 251 |
| 292 | 3300031235 | Ga0265330_10029751 | Ga0265330_100297513 | 251 |
| 293 | 3300031238 | Ga0265332_10000592 | Ga0265332_1000059218 | 251 |
| 294 | 3300031239 | Ga0265328_10000010 | Ga0265328_1000001069 | 251 |
| 295 | 3300031239 | Ga0265328_10000012 | Ga0265328_10000012122 | 251 |
| 296 | 3300031239 | Ga0265328_10002376 | Ga0265328_100023768 | 251 |
| 297 | 3300031239 | Ga0265328_10024271 | Ga0265328_100242712 | 251 |
| 298 | 3300031239 | Ga0265328_10066901 | Ga0265328_100669012 | 251 |
| 299 | 3300031241 | Ga0265325_10007695 | Ga0265325_100076956 | 251 |
| 300 | 3300031241 | Ga0265325_10038017 | Ga0265325_100380172 | 251 |
| 301 | 3300031241 | Ga0265325_10095578 | Ga0265325_100955781 | 251 |
| 302 | 3300031242 | Ga0265329_10004856 | Ga0265329_100048563 | 251 |
| 303 | 3300031242 | Ga0265329_10023545 | Ga0265329_100235453 | 251 |
| 304 | 3300031247 | Ga0265340_10000506 | Ga0265340_1000050613 | 251 |
| 305 | 3300031247 | Ga0265340_10181153 | Ga0265340_101811531 | 251 |
| 306 | 3300031249 | Ga0265339_10000107 | Ga0265339_1000010728 | 251 |
| 307 | 3300031249 | Ga0265339_10001426 | Ga0265339_100014265 | 251 |
| 308 | 3300031250 | Ga0265331_10001315 | Ga0265331_1000131518 | 251 |
| 309 | 3300031250 | Ga0265331_10013348 | Ga0265331_100133483 | 251 |
| 310 | 3300031251 | Ga0265327_10004701 | Ga0265327_100047012 | 251 |
| 311 | 3300031344 | Ga0265316_10003717 | Ga0265316_1000371714 | 251 |
| 312 | 3300031344 | Ga0265316_10031965 | Ga0265316_100319655 | 251 |
| 313 | 3300031456 | Ga0307513_10067952 | Ga0307513_100679522 | 251 |
| 314 | 3300031456 | Ga0307513_10140621 | Ga0307513_101406213 | 251 |
| 315 | 3300031456 | Ga0307513_10158415 | Ga0307513_101584152 | 251 |
| 316 | 3300031595 | Ga0265313_10000131 | Ga0265313_1000013134 | 251 |
| 317 | 3300031595 | Ga0265313_10103190 | Ga0265313_101031901 | 251 |
| 318 | 3300031711 | Ga0265314_10004714 | Ga0265314_100047149 | 251 |
| 319 | 3300031711 | Ga0265314_10013526 | Ga0265314_100135264 | 251 |
| 320 | 3300031712 | Ga0265342_10000116 | Ga0265342_1000011635 | 251 |
| 321 | 3300031712 | Ga0265342_10102095 | Ga0265342_101020952 | 251 |
| 322 | 3300031712 | Ga0265342_10137037 | Ga0265342_101370372 | 251 |
| 323 | 3300031824 | Ga0307413_10155310 | Ga0307413_101553103 | 251 |
| 324 | 3300031824 | Ga0307413_10302389 | Ga0307413_103023892 | 251 |
| 325 | 3300031995 | Ga0307409_100631356 | Ga0307409_1006313561 | 251 |
| 326 | 3300032002 | Ga0307416_100282083 | Ga0307416_1002820833 | 251 |
| 327 | 3300032004 | Ga0307414_10402960 | Ga0307414_104029602 | 251 |
| 328 | 3300032005 | Ga0307411_10157700 | Ga0307411_101577003 | 251 |
| 329 | 3300032126 | Ga0307415_100061565 | Ga0307415_1000615652 | 251 |
| 330 | 3300033180 | Ga0307510_10088607 | Ga0307510_100886073 | 251 |
| 331 | 3300034816 | Ga0373930_0009738 | Ga0373930_0009738_527_1288 | 251 |
| 332 | 3300034820 | Ga0373959_0036018 | Ga0373959_0036018_114_875 | 251 |
| 333 | 3300035083 | Ga0373926_0175535 | Ga0373926_0175535_16_777 | 251 |
| 334 | 3300035086 | Ga0373934_0010894 | Ga0373934_0010894_559_1320 | 251 |
| 335 | 3300035112 | Ga0373932_0077584 | Ga0373932_0077584_249_1010 | 251 |
| 336 | 3300035113 | Ga0373936_0010438 | Ga0373936_0010438_2529_3284 | 251 |
| 337 | 3300035113 | Ga0373936_0013323 | Ga0373936_0013323_2115_2876 | 251 |
| 338 | 3300035113 | Ga0373936_0050949 | Ga0373936_0050949_92_853 | 251 |
| 339 | 3300035116 | Ga0373945_0006568 | Ga0373945_0006568_1730_2491 | 251 |
| 340 | 3300035117 | Ga0373953_0000673 | Ga0373953_0000673_6231_7022 | 251 |
| 341 | 3300035117 | Ga0373953_0025074 | Ga0373953_0025074_37_798 | 251 |
| 342 | 3300035118 | Ga0373954_0005265 | Ga0373954_0005265_911_1672 | 251 |
| 343 | 3300035119 | Ga0373956_0006410 | Ga0373956_0006410_69_830 | 251 |
| 344 | 3300035119 | Ga0373956_0155210 | Ga0373956_0155210_155_946 | 251 |
| 345 | 3300035119 | Ga0373956_0260717 | Ga0373956_0260717_44_805 | 251 |
| 346 | 3300035121 | Ga0373960_0012973 | Ga0373960_0012973_1159_1920 | 251 |
| 347 | 3300035170 | Ga0373943_0004964 | Ga0373943_0004964_4169_4960 | 251 |
| 348 | 3300035170 | Ga0373943_0034310 | Ga0373943_0034310_1113_1874 | 251 |
| 349 | 3300035170 | Ga0373943_0135388 | Ga0373943_0135388_181_942 | 251 |
| 350 | 3300035170 | Ga0373943_0360124 | Ga0373943_0360124_32_793 | 251 |
| 351 | 3300035171 | Ga0373946_0037156 | Ga0373946_0037156_215_1006 | 251 |
| 352 | 3300035171 | Ga0373946_0149219 | Ga0373946_0149219_44_805 | 251 |
| 353 | 3300035172 | Ga0373955_0001256 | Ga0373955_0001256_6759_7550 | 251 |
| 354 | 3300035172 | Ga0373955_0027969 | Ga0373955_0027969_633_1394 | 251 |
| 355 | 3300035207 | Ga0373942_0006658 | Ga0373942_0006658_1087_1848 | 251 |
| 356 | 3300035410 | Ga0373924_0011970 | Ga0373924_0011970_1335_2096 | 251 |
| 357 | 3300035410 | Ga0373924_0014390 | Ga0373924_0014390_1952_2743 | 251 |
| 358 | 3300035691 | Ga0373931_0002668 | Ga0373931_0002668_5099_5860 | 251 |
| 359 | 3300035691 | Ga0373931_0044501 | Ga0373931_0044501_1182_1943 | 251 |
| 360 | 3300035692 | Ga0373935_0002077 | Ga0373935_0002077_3405_4196 | 251 |
| 361 | 3300035692 | Ga0373935_0034179 | Ga0373935_0034179_903_1664 | 251 |
| 362 | 3300035695 | Ga0373927_0002764 | Ga0373927_0002764_7215_7976 | 251 |
| 363 | 3300035695 | Ga0373927_0019891 | Ga0373927_0019891_153_944 | 251 |
| 364 | 3300035695 | Ga0373927_0026383 | Ga0373927_0026383_163_924 | 251 |
| 365 | 3300035695 | Ga0373927_0200292 | Ga0373927_0200292_474_1235 | 251 |
| 366 | 3300035724 | Ga0373933_0001029 | Ga0373933_0001029_9136_9897 | 251 |
| 367 | 3300035724 | Ga0373933_0042164 | Ga0373933_0042164_537_1295 | 251 |
| 368 | 3300035724 | Ga0373933_0080826 | Ga0373933_0080826_645_1409 | 251 |
| 369 | 3300035724 | Ga0373933_0082302 | Ga0373933_0082302_236_1027 | 251 |
| 370 | 3300035725 | Ga0373947_0002111 | Ga0373947_0002111_6846_7607 | 251 |
| 371 | 3300035725 | Ga0373947_0003550 | Ga0373947_0003550_7943_8704 | 251 |
| 372 | 3300035725 | Ga0373947_0329595 | Ga0373947_0329595_44_814 | 251 |
| 373 | 3300036401 | Ga0373937_0001173 | Ga0373937_0001173_5792_6553 | 251 |
| 374 | 3300036401 | Ga0373937_0031691 | Ga0373937_0031691_505_1263 | 251 |
| 375 | 3300036401 | Ga0373937_0743069 | Ga0373937_0743069_88_849 | 251 |
| 376 | 3300036401 | Ga0373937_0838515 | Ga0373937_0838515_13_774 | 251 |
| 377 | 3300037068 | Ga0373925_0000793 | Ga0373925_0000793_10235_11026 | 251 |
| 378 | 3300037068 | Ga0373925_0557774 | Ga0373925_0557774_76_837 | 251 |
| 379 | 3300037312 | Ga0395899_0012445 | Ga0395899_0012445_3959_4717 | 251 |
| 380 | 3300037312 | Ga0395899_0114629 | Ga0395899_0114629_385_1143 | 251 |
| 381 | 3300037418 | Ga0395900_0009060 | Ga0395900_0009060_2029_2787 | 251 |
| 382 | 3300037418 | Ga0395900_0271765 | Ga0395900_0271765_772_1530 | 251 |
| 383 | 3300037418 | Ga0395900_0625099 | Ga0395900_0625099_132_890 | 251 |
| 384 | 3300037466 | Ga0395898_0023199 | Ga0395898_0023199_1472_2230 | 251 |
| 385 | 3300037853 | Ga0436364_1215520 | Ga0436364_1215520_186_962 | 251 |
| 386 | 3300037853 | Ga0436364_1529500 | Ga0436364_1529500_417_1178 | 251 |
| 387 | 3300038443 | Ga0395901_0001645 | Ga0395901_0001645_20237_20995 | 251 |
| 388 | 3300038443 | Ga0395901_0025404 | Ga0395901_0025404_2470_3228 | 251 |
| 389 | 3300038443 | Ga0395901_0026006 | Ga0395901_0026006_1794_2552 | 251 |
| 390 | 3300038443 | Ga0395901_0390194 | Ga0395901_0390194_369_1148 | 251 |
| 391 | 3300039437 | Ga0436365_0430782 | Ga0436365_0430782_1239_2000 | 251 |
| 392 | 3300039437 | Ga0436365_0830368 | Ga0436365_0830368_1824_2585 | 251 |
| 393 | 3300039447 | Ga0436361_0420967 | Ga0436361_0420967_240_1001 | 251 |
| 394 | 3300039447 | Ga0436361_0668079 | Ga0436361_0668079_2684_3445 | 251 |
| 395 | 3300039447 | Ga0436361_0724097 | Ga0436361_0724097_1046_1822 | 251 |
| 396 | 3300039447 | Ga0436361_1046016 | Ga0436361_1046016_2439_3200 | 251 |
| 397 | 3300039447 | Ga0436361_1119238 | Ga0436361_1119238_106_867 | 251 |
| 398 | 3300039450 | Ga0436363_0350608 | Ga0436363_0350608_105_863 | 251 |
| 399 | 3300044658 | Ga0466972_0025874 | Ga0466972_0025874_394_1167 | 251 |
| 400 | 3300045976 | Ga0466967_0822135 | Ga0466967_0822135_10_786 | 251 |
| 401 | 3300046454 | Ga0495592_0002595 | Ga0495592_0002595_8386_9147 | 251 |
| 402 | 3300046454 | Ga0495592_0008363 | Ga0495592_0008363_6772_7563 | 251 |
| 403 | 3300046454 | Ga0495592_0084559 | Ga0495592_0084559_607_1368 | 251 |
| 404 | 3300046455 | Ga0495603_0000945 | Ga0495603_0000945_4596_5357 | 251 |
| 405 | 3300046459 | Ga0495629_0002712 | Ga0495629_0002712_4515_5276 | 251 |
| 406 | 3300046459 | Ga0495629_0021588 | Ga0495629_0021588_3534_4295 | 251 |
| 407 | 3300046459 | Ga0495629_0213165 | Ga0495629_0213165_520_1311 | 251 |
| 408 | 3300046460 | Ga0495638_0024385 | Ga0495638_0024385_1144_1905 | 251 |
| 409 | 3300046461 | Ga0495641_0003285 | Ga0495641_0003285_6060_6821 | 251 |
| 410 | 3300046462 | Ga0495651_0000267 | Ga0495651_0000267_12576_13337 | 251 |
| 411 | 3300046462 | Ga0495651_0028181 | Ga0495651_0028181_675_1466 | 251 |
| 412 | 3300046462 | Ga0495651_0328189 | Ga0495651_0328189_182_943 | 251 |
| 413 | 3300046463 | Ga0495653_0000993 | Ga0495653_0000993_3003_3794 | 251 |
| 414 | 3300046463 | Ga0495653_0009531 | Ga0495653_0009531_743_1504 | 251 |
| 415 | 3300046472 | Ga0495580_0002080 | Ga0495580_0002080_7929_8690 | 251 |
| 416 | 3300046473 | Ga0495582_0000292 | Ga0495582_0000292_10365_11126 | 251 |
| 417 | 3300046475 | Ga0495639_0001550 | Ga0495639_0001550_2620_3381 | 251 |
| 418 | 3300046476 | Ga0495662_0000849 | Ga0495662_0000849_8154_8915 | 251 |
| 419 | 3300046476 | Ga0495662_0034549 | Ga0495662_0034549_1637_2401 | 251 |
| 420 | 3300046476 | Ga0495662_0156496 | Ga0495662_0156496_186_977 | 251 |
| 421 | 3300046477 | Ga0495664_0000008 | Ga0495664_0000008_302262_303053 | 251 |
| 422 | 3300046477 | Ga0495664_0001948 | Ga0495664_0001948_328_1089 | 251 |
| 423 | 3300046477 | Ga0495664_0083945 | Ga0495664_0083945_874_1635 | 251 |
| 424 | 3300046491 | Ga0495584_0013470 | Ga0495584_0013470_2787_3551 | 251 |
| 425 | 3300046499 | Ga0495594_0001470 | Ga0495594_0001470_2374_3135 | 251 |
| 426 | 3300046499 | Ga0495594_0186359 | Ga0495594_0186359_367_1128 | 251 |
| 427 | 3300046511 | Ga0495608_0000226 | Ga0495608_0000226_21071_21832 | 251 |
| 428 | 3300046511 | Ga0495608_0000752 | Ga0495608_0000752_17992_18783 | 251 |
| 429 | 3300046512 | Ga0495610_0029435 | Ga0495610_0029435_722_1486 | 251 |
| 430 | 3300046514 | Ga0495618_0000826 | Ga0495618_0000826_2816_3607 | 251 |
| 431 | 3300046514 | Ga0495618_0002717 | Ga0495618_0002717_2891_3652 | 251 |
| 432 | 3300046514 | Ga0495618_0005562 | Ga0495618_0005562_1503_2264 | 251 |
| 433 | 3300046514 | Ga0495618_0190742 | Ga0495618_0190742_318_1079 | 251 |
| 434 | 3300046516 | Ga0495628_0000802 | Ga0495628_0000802_18083_18874 | 251 |
| 435 | 3300046516 | Ga0495628_0182750 | Ga0495628_0182750_276_1037 | 251 |
| 436 | 3300046516 | Ga0495628_0210369 | Ga0495628_0210369_329_1090 | 251 |
| 437 | 3300046516 | Ga0495628_0273683 | Ga0495628_0273683_118_879 | 251 |
| 438 | 3300046517 | Ga0495630_0005531 | Ga0495630_0005531_3764_4555 | 251 |
| 439 | 3300046517 | Ga0495630_0007451 | Ga0495630_0007451_123_884 | 251 |
| 440 | 3300046517 | Ga0495630_0098543 | Ga0495630_0098543_15_776 | 251 |
| 441 | 3300046517 | Ga0495630_0162145 | Ga0495630_0162145_608_1369 | 251 |
| 442 | 3300046517 | Ga0495630_0304170 | Ga0495630_0304170_179_940 | 251 |
| 443 | 3300046524 | Ga0495648_0004029 | Ga0495648_0004029_8550_9329 | 251 |
| 444 | 3300046529 | Ga0495652_0000005 | Ga0495652_0000005_302348_303139 | 251 |
| 445 | 3300046529 | Ga0495652_0031701 | Ga0495652_0031701_3277_4038 | 251 |
| 446 | 3300046529 | Ga0495652_0098290 | Ga0495652_0098290_915_1676 | 251 |
| 447 | 3300046531 | Ga0495665_0007476 | Ga0495665_0007476_2699_3460 | 251 |
| 448 | 3300046533 | Ga0495640_0000020 | Ga0495640_0000020_181_972 | 251 |
| 449 | 3300046533 | Ga0495640_0001646 | Ga0495640_0001646_3046_3807 | 251 |
| 450 | 3300046533 | Ga0495640_0019558 | Ga0495640_0019558_2910_3674 | 251 |
| 451 | 3300046533 | Ga0495640_0042775 | Ga0495640_0042775_2320_3081 | 251 |
| 452 | 3300046533 | Ga0495640_0053872 | Ga0495640_0053872_129_890 | 251 |
| 453 | 3300046535 | Ga0495586_0008127 | Ga0495586_0008127_91_852 | 251 |
| 454 | 3300046535 | Ga0495586_0098135 | Ga0495586_0098135_189_950 | 251 |
| 455 | 3300046536 | Ga0495587_0000005 | Ga0495587_0000005_55346_56137 | 251 |
| 456 | 3300046536 | Ga0495587_0001299 | Ga0495587_0001299_283_1044 | 251 |
| 457 | 3300046536 | Ga0495587_0033618 | Ga0495587_0033618_2131_2892 | 251 |
| 458 | 3300046543 | Ga0495645_0000007 | Ga0495645_0000007_33523_34314 | 251 |
| 459 | 3300046543 | Ga0495645_0001446 | Ga0495645_0001446_3504_4265 | 251 |
| 460 | 3300046543 | Ga0495645_0167364 | Ga0495645_0167364_377_1138 | 251 |
| 461 | 3300046557 | Ga0495622_0000730 | Ga0495622_0000730_15590_16351 | 251 |
| 462 | 3300046559 | Ga0495667_0000417 | Ga0495667_0000417_10010_10771 | 251 |
| 463 | 3300046559 | Ga0495667_0000618 | Ga0495667_0000618_3860_4651 | 251 |
| 464 | 3300046559 | Ga0495667_0024401 | Ga0495667_0024401_1847_2608 | 251 |
| 465 | 3300046642 | Ga0495634_0001197 | Ga0495634_0001197_12649_13410 | 251 |
| 466 | 3300046642 | Ga0495634_0004645 | Ga0495634_0004645_5367_6128 | 251 |
| 467 | 3300046642 | Ga0495634_0014340 | Ga0495634_0014340_1255_2046 | 251 |
| 468 | 3300046642 | Ga0495634_0017125 | Ga0495634_0017125_4266_5027 | 251 |
| 469 | 3300046642 | Ga0495634_0056664 | Ga0495634_0056664_1264_2025 | 251 |
| 470 | 3300046663 | Ga0495635_0000010 | Ga0495635_0000010_239113_239904 | 251 |
| 471 | 3300046663 | Ga0495635_0007245 | Ga0495635_0007245_1959_2720 | 251 |
| 472 | 3300046663 | Ga0495635_0012783 | Ga0495635_0012783_483_1244 | 251 |
| 473 | 3300046663 | Ga0495635_0084233 | Ga0495635_0084233_1316_2077 | 251 |
| 474 | 3300046674 | Ga0495588_0001338 | Ga0495588_0001338_423_1184 | 251 |
| 475 | 3300046675 | Ga0495657_0006151 | Ga0495657_0006151_5820_6611 | 251 |
| 476 | 3300046678 | Ga0495599_0000240 | Ga0495599_0000240_18033_18824 | 251 |
| 477 | 3300046678 | Ga0495599_0008292 | Ga0495599_0008292_166_927 | 251 |
| 478 | 3300046678 | Ga0495599_0219060 | Ga0495599_0219060_347_1108 | 251 |
| 479 | 3300046679 | Ga0495623_0001009 | Ga0495623_0001009_18047_18838 | 251 |
| 480 | 3300046679 | Ga0495623_0044694 | Ga0495623_0044694_1216_1977 | 251 |
| 481 | 3300046679 | Ga0495623_0176924 | Ga0495623_0176924_21_782 | 251 |
| 482 | 3300046680 | Ga0495646_0000663 | Ga0495646_0000663_17876_18667 | 251 |
| 483 | 3300046680 | Ga0495646_0250332 | Ga0495646_0250332_50_811 | 251 |
| 484 | 3300046681 | Ga0495647_0000586 | Ga0495647_0000586_3104_3865 | 251 |
| 485 | 3300046683 | Ga0495658_0001493 | Ga0495658_0001493_9246_10007 | 251 |
| 486 | 3300046683 | Ga0495658_0217937 | Ga0495658_0217937_157_921 | 251 |
| 487 | 3300046689 | Ga0495613_0000652 | Ga0495613_0000652_13456_14217 | 251 |
| 488 | 3300046689 | Ga0495613_0442760 | Ga0495613_0442760_61_822 | 251 |
| 489 | 3300046809 | Ga0495600_0000016 | Ga0495600_0000016_3840_4631 | 251 |
| 490 | 3300046809 | Ga0495600_0029967 | Ga0495600_0029967_1297_2058 | 251 |
| 491 | 3300047315 | Ga0495581_0045927 | Ga0495581_0045927_336_1127 | 251 |
| 492 | 3300047315 | Ga0495581_0097307 | Ga0495581_0097307_495_1256 | 251 |
| 493 | 3300047315 | Ga0495581_0206094 | Ga0495581_0206094_311_1081 | 251 |
| 494 | 3300047315 | Ga0495581_0214093 | Ga0495581_0214093_74_835 | 251 |
| 495 | 3300047315 | Ga0495581_0224576 | Ga0495581_0224576_239_1000 | 251 |
| 496 | 3300047317 | Ga0495604_0000634 | Ga0495604_0000634_18905_19666 | 251 |
| 497 | 3300047317 | Ga0495604_0001065 | Ga0495604_0001065_3902_4693 | 251 |
| 498 | 3300047319 | Ga0495674_0000012 | Ga0495674_0000012_15861_16652 | 251 |
| 499 | 3300047319 | Ga0495674_0001892 | Ga0495674_0001892_18243_19004 | 251 |
| 500 | 3300047319 | Ga0495674_0002470 | Ga0495674_0002470_4887_5648 | 251 |
| 501 | 3300047319 | Ga0495674_0109121 | Ga0495674_0109121_1470_2234 | 251 |
| 502 | 3300047319 | Ga0495674_0312067 | Ga0495674_0312067_81_845 | 251 |
| 503 | 3300047321 | Ga0495676_0221730 | Ga0495676_0221730_395_1165 | 251 |
| 504 | 3300047321 | Ga0495676_0233955 | Ga0495676_0233955_361_1122 | 251 |
| 505 | 3300047322 | Ga0495680_0001504 | Ga0495680_0001504_18367_19128 | 251 |
| 506 | 3300047322 | Ga0495680_0034751 | Ga0495680_0034751_236_1027 | 251 |
| 507 | 3300047322 | Ga0495680_0155228 | Ga0495680_0155228_19_780 | 251 |
| 508 | 3300047444 | Ga0495675_0271982 | Ga0495675_0271982_180_941 | 251 |
| 509 | 3300047471 | Ga0495684_0001027 | Ga0495684_0001027_18037_18828 | 251 |
| 510 | 3300047471 | Ga0495684_0069917 | Ga0495684_0069917_170_931 | 251 |
| 511 | 3300047471 | Ga0495684_0081519 | Ga0495684_0081519_78_839 | 251 |
| 512 | 3300047673 | Ga0495593_0003844 | Ga0495593_0003844_4670_5431 | 251 |
| 513 | 3300047673 | Ga0495593_0096876 | Ga0495593_0096876_605_1396 | 251 |
| 514 | 3300048088 | Ga0495602_0001567 | Ga0495602_0001567_18097_18888 | 251 |
| 515 | 3300048088 | Ga0495602_0015059 | Ga0495602_0015059_3442_4203 | 251 |
| 516 | 3300048088 | Ga0495602_0043419 | Ga0495602_0043419_18_779 | 251 |
| 517 | 3300048088 | Ga0495602_0260754 | Ga0495602_0260754_141_902 | 251 |
| 518 | 3300048089 | Ga0495614_0000798 | Ga0495614_0000798_4509_5270 | 251 |
| 519 | 3300048903 | Ga0496100_0000386 | Ga0496100_0000386_8669_9430 | 251 |
| 520 | 3300048903 | Ga0496100_0068230 | Ga0496100_0068230_748_1509 | 251 |
| 521 | 3300048903 | Ga0496100_0145217 | Ga0496100_0145217_891_1652 | 251 |
| 522 | 3300048904 | Ga0496101_0001608 | Ga0496101_0001608_11321_12082 | 251 |
| 523 | 3300048904 | Ga0496101_0033440 | Ga0496101_0033440_1820_2581 | 251 |
| 524 | 3300048904 | Ga0496101_0169041 | Ga0496101_0169041_843_1604 | 251 |
| 525 | 3300048905 | Ga0496102_0021728 | Ga0496102_0021728_4129_4890 | 251 |
| 526 | 3300048905 | Ga0496102_0337578 | Ga0496102_0337578_450_1211 | 251 |
| 527 | 3300048907 | Ga0496104_0028292 | Ga0496104_0028292_51_812 | 251 |
| 528 | 3300048907 | Ga0496104_0030395 | Ga0496104_0030395_3348_4118 | 251 |
| 529 | 3300048907 | Ga0496104_0156567 | Ga0496104_0156567_547_1308 | 251 |
| 530 | 3300048907 | Ga0496104_0203282 | Ga0496104_0203282_678_1448 | 251 |
| 531 | 3300048907 | Ga0496104_0272943 | Ga0496104_0272943_275_1036 | 251 |
| 532 | 3300048907 | Ga0496104_0382034 | Ga0496104_0382034_378_1139 | 251 |
| 533 | 3300048907 | Ga0496104_0407281 | Ga0496104_0407281_159_920 | 251 |
| 534 | 3300048908 | Ga0496105_0000577 | Ga0496105_0000577_18329_19090 | 251 |
| 535 | 3300048908 | Ga0496105_0001440 | Ga0496105_0001440_12573_13343 | 251 |
| 536 | 3300048908 | Ga0496105_0044270 | Ga0496105_0044270_1478_2239 | 251 |
| 537 | 3300048908 | Ga0496105_0089217 | Ga0496105_0089217_856_1617 | 251 |
| 538 | 3300048909 | Ga0496106_0000936 | Ga0496106_0000936_5132_5893 | 251 |
| 539 | 3300048909 | Ga0496106_0048536 | Ga0496106_0048536_1184_1945 | 251 |
| 540 | 3300048909 | Ga0496106_0267626 | Ga0496106_0267626_60_821 | 251 |
| 541 | 3300048909 | Ga0496106_0454247 | Ga0496106_0454247_164_925 | 251 |
| 542 | 3300048910 | Ga0496107_0003679 | Ga0496107_0003679_3821_4582 | 251 |
| 543 | 3300048910 | Ga0496107_0075383 | Ga0496107_0075383_510_1271 | 251 |
| 544 | 3300048911 | Ga0496108_0001099 | Ga0496108_0001099_11985_12755 | 251 |
| 545 | 3300048912 | Ga0496109_0005653 | Ga0496109_0005653_1995_2765 | 251 |
| 546 | 3300048912 | Ga0496109_0034719 | Ga0496109_0034719_2359_3120 | 251 |
| 547 | 3300048912 | Ga0496109_0063118 | Ga0496109_0063118_2419_3180 | 251 |
| 548 | 3300048912 | Ga0496109_0132048 | Ga0496109_0132048_181_942 | 251 |
| 549 | 3300048912 | Ga0496109_0472977 | Ga0496109_0472977_391_1152 | 251 |
| 550 | 3300048913 | Ga0496110_0006526 | Ga0496110_0006526_4028_4798 | 251 |
| 551 | 3300048913 | Ga0496110_0010410 | Ga0496110_0010410_4551_5312 | 251 |
| 552 | 3300048913 | Ga0496110_0135880 | Ga0496110_0135880_871_1632 | 251 |
| 553 | 3300048913 | Ga0496110_0146982 | Ga0496110_0146982_1049_1810 | 251 |
| 554 | 3300048913 | Ga0496110_0472103 | Ga0496110_0472103_132_893 | 251 |
| 555 | 3300048914 | Ga0496111_0001036 | Ga0496111_0001036_13637_14407 | 251 |
| 556 | 3300048914 | Ga0496111_0101113 | Ga0496111_0101113_373_1134 | 251 |
| 557 | 3300048914 | Ga0496111_0225681 | Ga0496111_0225681_340_1110 | 251 |
| 558 | 3300048915 | Ga0496112_0007251 | Ga0496112_0007251_846_1607 | 251 |
| 559 | 3300048915 | Ga0496112_0010555 | Ga0496112_0010555_4653_5423 | 251 |
| 560 | 3300048915 | Ga0496112_0028281 | Ga0496112_0028281_3979_4740 | 251 |
| 561 | 3300048916 | Ga0496113_0010202 | Ga0496113_0010202_1091_1861 | 251 |
| 562 | 3300048916 | Ga0496113_0035630 | Ga0496113_0035630_1106_1867 | 251 |
| 563 | 3300048916 | Ga0496113_0245133 | Ga0496113_0245133_292_1053 | 251 |
| 564 | 3300048917 | Ga0496114_0001665 | Ga0496114_0001665_10941_11702 | 251 |
| 565 | 3300048917 | Ga0496114_0059122 | Ga0496114_0059122_842_1603 | 251 |
| 566 | 3300048918 | Ga0496115_0004212 | Ga0496115_0004212_7459_8229 | 251 |
| 567 | 3300048918 | Ga0496115_0022781 | Ga0496115_0022781_1383_2144 | 251 |
| 568 | 3300048918 | Ga0496115_0060641 | Ga0496115_0060641_1424_2185 | 251 |
| 569 | 3300048918 | Ga0496115_0246226 | Ga0496115_0246226_92_853 | 251 |
| 570 | 3300048918 | Ga0496115_0289532 | Ga0496115_0289532_410_1171 | 251 |
| 571 | 3300048921 | Ga0496118_0289312 | Ga0496118_0289312_14_775 | 251 |
| 572 | 3300048922 | Ga0496119_0002304 | Ga0496119_0002304_8727_9485 | 251 |
| 573 | 3300048925 | Ga0496122_0029679 | Ga0496122_0029679_3258_4013 | 251 |
| 574 | 3300048926 | Ga0496123_0001703 | Ga0496123_0001703_13608_14363 | 251 |
| 575 | 3300049568 | Ga0501031_0147951 | Ga0501031_0147951_291_1085 | 251 |
| 576 | 3300049571 | Ga0501034_0005569 | Ga0501034_0005569_8733_9491 | 251 |
| 577 | 3300049571 | Ga0501034_0037874 | Ga0501034_0037874_1780_2541 | 251 |
| 578 | 3300049574 | Ga0501038_0297549 | Ga0501038_0297549_354_1148 | 251 |
| 579 | 3300049575 | Ga0501039_0063551 | Ga0501039_0063551_872_1666 | 251 |
| 580 | 3300049575 | Ga0501039_0123595 | Ga0501039_0123595_133_915 | 251 |
| 581 | 3300049576 | Ga0501040_0034656 | Ga0501040_0034656_583_1377 | 251 |
| 582 | 3300049576 | Ga0501040_0040377 | Ga0501040_0040377_292_1086 | 251 |
| 583 | 3300049576 | Ga0501040_0204774 | Ga0501040_0204774_37_819 | 251 |
| 584 | 3300049577 | Ga0501041_0066717 | Ga0501041_0066717_1143_1937 | 251 |
| 585 | 3300049577 | Ga0501041_0107712 | Ga0501041_0107712_464_1246 | 251 |
| 586 | 3300049579 | Ga0501043_0190887 | Ga0501043_0190887_396_1190 | 251 |
| 587 | 3300049580 | Ga0501046_0181075 | Ga0501046_0181075_507_1268 | 251 |
| 588 | 3300049582 | Ga0501048_0000736 | Ga0501048_0000736_19298_20059 | 251 |
| 589 | 3300049584 | Ga0501068_0006174 | Ga0501068_0006174_622_1380 | 251 |
| 590 | 3300049587 | Ga0501071_0233973 | Ga0501071_0233973_417_1211 | 251 |
| 591 | 3300049590 | Ga0501074_0433417 | Ga0501074_0433417_91_852 | 251 |
| 592 | 3300049591 | Ga0501075_0104615 | Ga0501075_0104615_719_1513 | 251 |
| 593 | 3300049591 | Ga0501075_0135814 | Ga0501075_0135814_788_1582 | 251 |
| 594 | 3300049593 | Ga0501077_0037456 | Ga0501077_0037456_2037_2831 | 251 |
| 595 | 3300049593 | Ga0501077_0038511 | Ga0501077_0038511_271_1065 | 251 |
| 596 | 3300049741 | Ga0501079_0140869 | Ga0501079_0140869_961_1743 | 251 |
| 597 | 3300049741 | Ga0501079_0556996 | Ga0501079_0556996_37_813 | 251 |
| 598 | 3300049743 | Ga0501081_0006724 | Ga0501081_0006724_2060_2854 | 251 |
| 599 | 3300049743 | Ga0501081_0044717 | Ga0501081_0044717_285_1079 | 251 |
| 600 | 3300049743 | Ga0501081_0163142 | Ga0501081_0163142_749_1531 | 251 |
| 601 | 3300049744 | Ga0501083_0110068 | Ga0501083_0110068_786_1553 | 251 |
| 602 | 3300049744 | Ga0501083_0119140 | Ga0501083_0119140_817_1611 | 251 |
| 603 | 3300049824 | Ga0501045_0047311 | Ga0501045_0047311_2042_2836 | 251 |
| 604 | 3300049824 | Ga0501045_0155339 | Ga0501045_0155339_397_1191 | 251 |
| 605 | 3300050489 | nmdc:mga03683_139443_c1 | nmdc:mga03683_139443_c1_261_1022 | 251 |
| 606 | 3300050489 | nmdc:mga03683_608_c1 | nmdc:mga03683_608_c1_4948_5709 | 251 |
| 607 | 3300050490 | nmdc:mga03n38_137420_c1 | nmdc:mga03n38_137420_c1_245_1006 | 251 |
| 608 | 3300050491 | nmdc:mga00v17_49851_c1 | nmdc:mga00v17_49851_c1_593_1354 | 251 |
| 609 | 3300050492 | nmdc:mga0yw44_198467_c1 | nmdc:mga0yw44_198467_c1_479_1240 | 251 |
| 610 | 3300050492 | nmdc:mga0yw44_2155_c1 | nmdc:mga0yw44_2155_c1_5075_5836 | 251 |
| 611 | 3300050492 | nmdc:mga0yw44_34864_c2 | nmdc:mga0yw44_34864_c2_355_1116 | 251 |
| 612 | 3300050492 | nmdc:mga0yw44_48183_c1 | nmdc:mga0yw44_48183_c1_1393_2154 | 251 |
| 613 | 3300050492 | nmdc:mga0yw44_87507_c2 | nmdc:mga0yw44_87507_c2_182_943 | 251 |
| 614 | 3300050495 | nmdc:mga04h51_24987_c1 | nmdc:mga04h51_24987_c1_79_840 | 251 |
| 615 | 3300050496 | nmdc:mga07m45_243067_c1 | nmdc:mga07m45_243067_c1_13_774 | 251 |
| 616 | 3300050496 | nmdc:mga07m45_33114_c1 | nmdc:mga07m45_33114_c1_837_1598 | 251 |
| 617 | 3300050496 | nmdc:mga07m45_69532_c1 | nmdc:mga07m45_69532_c1_466_1227 | 251 |
| 618 | 3300050507 | nmdc:mga05p37_267208_c1 | nmdc:mga05p37_267208_c1_1071_1832 | 251 |
| 619 | 3300050508 | nmdc:mga09592_304303_c1 | nmdc:mga09592_304303_c1_59_820 | 251 |
| 620 | 3300050510 | nmdc:mga06r32_24791_c1 | nmdc:mga06r32_24791_c1_4482_5243 | 251 |
| 621 | 3300050510 | nmdc:mga06r32_50085_c1 | nmdc:mga06r32_50085_c1_2775_3557 | 251 |
| 622 | 3300050511 | nmdc:mga08y16_387316_c1 | nmdc:mga08y16_387316_c1_35_808 | 251 |
| 623 | 3300050516 | nmdc:mga0sz30_100888_c1 | nmdc:mga0sz30_100888_c1_328_1089 | 251 |
| 624 | 3300050516 | nmdc:mga0sz30_17589_c1 | nmdc:mga0sz30_17589_c1_570_1331 | 251 |
| 625 | 3300050516 | nmdc:mga0sz30_2513_c1 | nmdc:mga0sz30_2513_c1_2059_2820 | 251 |
| 626 | 3300053077 | Ga0495601_0000011 | Ga0495601_0000011_10197_10988 | 251 |
| 627 | 3300053077 | Ga0495601_0000880 | Ga0495601_0000880_8814_9575 | 251 |
| 628 | 3300053077 | Ga0495601_0006281 | Ga0495601_0006281_4946_5707 | 251 |
| 629 | 3300053077 | Ga0495601_0041000 | Ga0495601_0041000_1775_2539 | 251 |
| 630 | 3300053077 | Ga0495601_0049794 | Ga0495601_0049794_50_811 | 251 |
| 631 | 3300053078 | Ga0495612_0002032 | Ga0495612_0002032_2918_3679 | 251 |
| 632 | 3300053078 | Ga0495612_0002357 | Ga0495612_0002357_201_992 | 251 |
| 633 | 3300053078 | Ga0495612_0006886 | Ga0495612_0006886_3767_4528 | 251 |
| 634 | 3300053084 | Ga0495595_0000308 | Ga0495595_0000308_1268_2029 | 251 |
| 635 | 3300053084 | Ga0495595_0000906 | Ga0495595_0000906_7991_8782 | 251 |
| 636 | 3300053084 | Ga0495595_0070098 | Ga0495595_0070098_749_1510 | 251 |
| 637 | 3300053085 | Ga0495619_0000013 | Ga0495619_0000013_10118_10909 | 251 |
| 638 | 3300053085 | Ga0495619_0001242 | Ga0495619_0001242_10787_11548 | 251 |
| 639 | 3300053085 | Ga0495619_0003116 | Ga0495619_0003116_6531_7292 | 251 |
| 640 | 3300053085 | Ga0495619_0005937 | Ga0495619_0005937_4149_4910 | 251 |
| 641 | 3300053085 | Ga0495619_0010198 | Ga0495619_0010198_4967_5728 | 251 |
| 642 | 3300053088 | Ga0500644_0196970 | Ga0500644_0196970_12_782 | 251 |
| 643 | 3300053096 | Ga0500641_0003638 | Ga0500641_0003638_1452_2213 | 251 |
| 644 | 3300053104 | Ga0500556_0000148 | Ga0500556_0000148_8645_9400 | 251 |
| 645 | 3300053104 | Ga0500556_0000229 | Ga0500556_0000229_37594_38358 | 251 |
| 646 | 3300053119 | Ga0500595_007088 | Ga0500595_007088_3585_4358 | 251 |
| 647 | 3300053130 | Ga0500642_0105162 | Ga0500642_0105162_41_802 | 251 |
| 648 | 3300053136 | Ga0500559_0000528 | Ga0500559_0000528_18753_19514 | 251 |
| 649 | 3300053139 | Ga0500568_0041547 | Ga0500568_0041547_874_1641 | 251 |
| 650 | 3300053142 | Ga0500577_0074434 | Ga0500577_0074434_320_1081 | 251 |
| 651 | 3300053153 | Ga0500616_0113986 | Ga0500616_0113986_510_1274 | 251 |
| 652 | 3300053177 | Ga0500636_0032012 | Ga0500636_0032012_1359_2123 | 251 |
| 653 | 3300053725 | Ga0500576_031015 | Ga0500576_031015_250_1011 | 251 |
| 654 | 3300054114 | Ga0501084_0004692 | Ga0501084_0004692_3723_4490 | 251 |
| 655 | 3300054114 | Ga0501084_0016658 | Ga0501084_0016658_3516_4310 | 251 |
| 656 | 3300060353 | Ga0501082_0034656 | Ga0501082_0034656_599_1366 | 251 |
| 657 | 3300060353 | Ga0501082_0068633 | Ga0501082_0068633_1980_2774 | 251 |
| 658 | 3300061734 | Ga0530510_0025629 | Ga0530510_0025629_1960_2754 | 251 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ndc-assembly1.cif.gz_B | crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus | 0.9762 | 1 | 237 |
| 3ndc-assembly1.cif.gz_B | crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus | 0.9721 | 1 | 237 |
| 3nei-assembly1.cif.gz_B | crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus (no sah bound) | 0.9719 | 1 | 231 |
| 3nei-assembly1.cif.gz_A | crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus (no sah bound) | 0.9706 | 1 | 231 |
| 3ndc-assembly1.cif.gz_A | crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus | 0.9677 | 1 | 234 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3neiB01 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9857 | 1 | 110 | 3.40.1010.10 |
| 3neiB01 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9769 | 1 | 110 | 3.40.1010.10 |
| 4e16A01 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9664 | 2 | 110 | 3.40.1010.10 |
| 2cbfA01 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9536 | 2 | 110 | 3.40.1010.10 |
| 3neiB02 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9502 | 111 | 231 | 3.30.950.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A530BU87-F1-model_v4 | Precorrin-4 C(11)-methyltransferase | 0.9966 | 1 | 77 |
GO:0008168
GO:0032259 |
| AF-A0A530BU87-F1-model_v4 | Precorrin-4 C(11)-methyltransferase | 0.9838 | 1 | 77 |
GO:0008168
GO:0032259 |
| AF-A0A7V2RUB0-F1-model_v4 | Precorrin-4 C(11)-methyltransferase | 0.9836 | 1 | 177 |
GO:0009236
GO:0032259 GO:0046026 |
| AF-A0A5M3XA37-F1-model_v4 | Precorrin-4 C(11)-methyltransferase | 0.9807 | 1 | 246 |
GO:0009236
GO:0032259 GO:0046026 |
| AF-A0A4V2SPA7-F1-model_v4 | Precorrin-4 C11-methyltransferase | 0.9799 | 1 | 249 |
GO:0009236
GO:0032259 GO:0046026 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar