F473184

General Info

Members Datasets Scaffolds Average Seq Length
658 368 613 172

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10209171|Ga0307405_102091712
Length 197
Sequence MAALFRRCDPCPRFGALVPAVPVNVPMALLDILEFPDPRLRTKARPVDAAQVAGPAFQQLLDDMFETMYAAPGIGLAASQVDVHERFMVIDVSEEKDQPLVFLNPEILSREGEQVCQEGCLSVPGIFADVTRADRIRVRALGRDGQPFELDVDGLLAVCIQHEMDHLDGKLFVDYLSPLKREMVRKKLAKARRQAAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
3 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
4 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
5 2643221593 Lysobacter sp. Root690 Isolate Unclassified
6 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
7 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
8 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
9 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
10 2818991457 Xanthomonas translucens 569 Isolate Unclassified
11 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
12 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
13 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
14 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
15 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
16 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
17 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
18 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
19 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
20 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
21 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
22 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
23 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
24 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
25 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
26 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
27 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
28 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
29 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
30 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
31 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
32 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
33 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
34 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
35 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
36 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
37 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
38 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
39 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
40 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
41 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
42 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
43 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
44 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
45 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
46 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
47 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
48 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
49 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
50 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
51 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
52 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
53 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
54 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
55 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
56 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
57 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
58 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
59 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
60 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
61 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
62 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
65 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
66 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
67 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
68 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
69 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
70 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
71 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
72 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
73 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
74 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
75 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
76 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
77 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
78 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
79 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
80 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
81 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
82 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
83 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
84 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
85 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
86 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
87 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
88 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
89 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
90 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
93 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
94 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
95 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
96 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
97 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
102 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
103 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
104 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
105 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
106 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
107 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
108 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
109 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
112 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
122 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
140 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
143 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
146 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
147 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
153 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
154 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
156 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
157 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
218 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
219 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
220 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
221 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
222 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
228 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
229 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
230 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
231 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
232 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
235 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
236 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
243 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
244 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
245 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
246 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
247 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
248 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
249 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
252 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
253 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
254 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
255 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
256 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
257 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
258 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
259 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
260 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
261 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
262 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
263 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
264 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
265 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
266 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
267 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
268 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
269 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
270 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
271 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
272 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
273 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
274 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
275 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
276 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
277 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
278 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
279 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
280 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
281 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
282 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
283 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
284 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
285 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
286 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
287 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
288 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
289 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
290 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
291 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
292 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
293 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
294 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
295 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
296 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
297 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
298 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
299 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
300 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
304 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
305 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
306 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
307 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
308 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
309 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
310 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
341 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
345 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
346 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
347 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
348 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
349 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
350 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
351 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
354 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
355 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
356 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
357 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
360 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
361 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
362 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
363 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
366 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
367 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
368 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.86
Metatranscriptomes 0.3
Isolates 6.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 16.26
Nodule 0.15
Rhizoplane 3.04
Rhizosphere 65.96
Stem 0
Stem Tuber 0
Unclassified 14.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1124246 2162886007 Bacteria 2716
2 SwRhRL2b_contig_1325465 2162886007 Bacteria 2823
3 JGI24752J21851_1016343 3300001976 Bacteria 966
4 JGI24740J21852_10002686 3300001979 Bacteria 7983
5 JGI25156J39149_1018662 3300002705 Bacteria 1275
6 JGI25154J39366_1000483 3300002738 Bacteria 20639
7 JGI25152J39213_1000612 3300002773 Bacteria 19226
8 JGI25150J39212_1000741 3300002774 Bacteria 11523
9 JGI25159J45721_1049662 3300002987 Bacteria 579
10 JGI25151J46595_10000016 3300003187 Bacteria 249712
11 JGI25151J46595_10001145 3300003187 Bacteria 19226
12 JGI25151J46595_10067410 3300003187 Bacteria 1103
13 JGI25153J46596_10000801 3300003215 Bacteria 19226
14 rootH2_10032978 3300003320 Bacteria 6472
15 rootH1_10049495 3300003323 Bacteria 2826
16 Ga0055539_1012272 3300003752 Bacteria 1054
17 Ga0055533_1001999 3300003756 Bacteria 4972
18 Ga0055542_1000850 3300003762 Bacteria 21415
19 Ga0055542_1001034 3300003762 Bacteria 17453
20 Ga0055526_1000003 3300003771 Bacteria 413092
21 Ga0055526_1000247 3300003771 Bacteria 45809
22 Ga0055526_1017155 3300003771 Bacteria 2785
23 Ga0055537_1000055 3300003773 Bacteria 81951
24 Ga0055537_1000614 3300003773 Bacteria 19575
25 Ga0055524_1000002 3300003775 Bacteria 459550
26 Ga0055524_1010266 3300003775 Bacteria 3740
27 Ga0055524_1012482 3300003775 Bacteria 3258
28 Ga0055536_1000983 3300003781 Bacteria 18085
29 Ga0055536_1013870 3300003781 Bacteria 2870
30 Ga0055536_1013874 3300003781 Bacteria 2869
31 Ga0055536_1048315 3300003781 Bacteria 953
32 Ga0055534_1000062 3300003784 Bacteria 81951
33 Ga0055534_1000599 3300003784 Bacteria 18695
34 Ga0055528_1000001 3300003790 Bacteria 402384
35 Ga0055528_1000407 3300003790 Bacteria 34812
36 Ga0055530_10001944 3300003791 Bacteria 14108
37 Ga0055530_10001946 3300003791 Bacteria 14103
38 Ga0055530_10004373 3300003791 Bacteria 7317
39 Ga0055531_10014111 3300003794 Bacteria 3626
40 Ga0055531_10018514 3300003794 Bacteria 2870
41 Ga0055531_10018523 3300003794 Bacteria 2869
42 Ga0055531_10027564 3300003794 Bacteria 1988
43 Ga0055531_10028782 3300003794 Bacteria 1907
44 Ga0055541_1001734 3300003841 Bacteria 4589
45 Ga0058692_1000004 3300003856 Bacteria 431119
46 Ga0058692_1000078 3300003856 Bacteria 70873
47 Ga0065704_10000512 3300005289 Bacteria 18867
48 Ga0065704_10095357 3300005289 Bacteria 2490
49 Ga0065704_10101678 3300005289 Bacteria 2229
50 Ga0065707_10307730 3300005295 Bacteria 991
51 Ga0070658_10032518 3300005327 Bacteria 4193
52 Ga0070658_10689494 3300005327 Bacteria 886
53 Ga0070690_100119218 3300005330 Bacteria 1769
54 Ga0070670_100005119 3300005331 Bacteria 11034
55 Ga0070670_100122434 3300005331 Bacteria 2244
56 Ga0070677_10092205 3300005333 Bacteria 1320
57 Ga0068869_100244161 3300005334 Bacteria 1432
58 Ga0068869_100593831 3300005334 Bacteria 934
59 Ga0070680_100020213 3300005336 Bacteria 5283
60 Ga0070680_100309086 3300005336 Bacteria 1341
61 Ga0070682_100023544 3300005337 Bacteria 3657
62 Ga0070691_10119784 3300005341 Bacteria 1324
63 Ga0070687_100101169 3300005343 Bacteria 1614
64 Ga0070668_100033588 3300005347 Bacteria 3907
65 Ga0070668_100455252 3300005347 Bacteria 1101
66 Ga0070669_100041021 3300005353 Bacteria 3365
67 Ga0070669_100105619 3300005353 Bacteria 2131
68 Ga0070669_100435435 3300005353 Bacteria 1078
69 Ga0070675_100409438 3300005354 Bacteria 1211
70 Ga0070674_100138049 3300005356 Bacteria 1826
71 Ga0070674_100145557 3300005356 Bacteria 1783
72 Ga0070659_100028080 3300005366 Bacteria 4342
73 Ga0070667_100132112 3300005367 Bacteria 2180
74 Ga0070667_100403941 3300005367 Bacteria 1244
75 Ga0070701_10022043 3300005438 Bacteria 3050
76 Ga0070701_10050921 3300005438 Bacteria 2147
77 Ga0070701_10303542 3300005438 Bacteria 982
78 Ga0070711_100324028 3300005439 Bacteria 1232
79 Ga0070700_100037530 3300005441 Bacteria 2947
80 Ga0070694_100131986 3300005444 Bacteria 1805
81 Ga0070708_100158696 3300005445 Bacteria 2107
82 Ga0070678_100003261 3300005456 Bacteria 9018
83 Ga0070662_100240935 3300005457 Bacteria 1450
84 Ga0068867_100028324 3300005459 Bacteria 4033
85 Ga0068867_100029282 3300005459 Bacteria 3967
86 Ga0068867_100046885 3300005459 Bacteria 3176
87 Ga0070685_10085766 3300005466 Bacteria 1897
88 Ga0068853_100667983 3300005539 Bacteria 990
89 Ga0070672_100019487 3300005543 Bacteria 4925
90 Ga0070695_100451825 3300005545 Bacteria 985
91 Ga0070693_100200953 3300005547 Bacteria 1294
92 Ga0070693_100667432 3300005547 Bacteria 758
93 Ga0070665_100013456 3300005548 Bacteria 8230
94 Ga0070665_100014027 3300005548 Bacteria 8055
95 Ga0070665_100030222 3300005548 Bacteria 5453
96 Ga0070665_100779820 3300005548 Bacteria 969
97 Ga0068855_100732372 3300005563 Unclassified 1056
98 Ga0070664_100076347 3300005564 Bacteria 2879
99 Ga0070664_100445157 3300005564 Bacteria 1189
100 Ga0070664_100720267 3300005564 Bacteria 930
101 Ga0068854_100230445 3300005578 Bacteria 1470
102 Ga0070702_100005549 3300005615 Bacteria 5892
103 Ga0068859_100023611 3300005617 Bacteria 6172
104 Ga0068859_100414821 3300005617 Bacteria 1443
105 Ga0068864_100631335 3300005618 Bacteria 1042
106 Ga0068864_101244522 3300005618 Bacteria 744
107 Ga0068866_10289966 3300005718 Bacteria 1017
108 Ga0068861_100001173 3300005719 Bacteria 16320
109 Ga0068861_100098454 3300005719 Bacteria 2321
110 Ga0068861_100209909 3300005719 Bacteria 1639
111 Ga0068861_100500364 3300005719 Bacteria 1098
112 Ga0068870_10132417 3300005840 Bacteria 1450
113 Ga0068863_100029167 3300005841 Bacteria 5268
114 Ga0068863_100273556 3300005841 Bacteria 1635
115 Ga0068858_100095371 3300005842 Bacteria 2772
116 Ga0068858_100573778 3300005842 Bacteria 1093
117 Ga0068860_100023622 3300005843 Bacteria 5941
118 Ga0068862_100006827 3300005844 Bacteria 9463
119 Ga0068862_100012896 3300005844 Bacteria 6912
120 Ga0068862_100025278 3300005844 Bacteria 4986
121 Ga0068862_100350459 3300005844 Bacteria 1370
122 Ga0081539_10042689 3300005985 Bacteria 2638
123 Ga0075365_10180726 3300006038 Bacteria 1475
124 Ga0075364_10000016 3300006051 Bacteria 57197
125 Ga0075364_10055728 3300006051 Bacteria 2587
126 Ga0075364_10160562 3300006051 Bacteria 1517
127 Ga0075364_10334134 3300006051 Bacteria 1032
128 Ga0075364_10367567 3300006051 Bacteria 981
129 Ga0097621_100075208 3300006237 Bacteria 2799
130 Ga0075370_10214862 3300006353 Bacteria 1136
131 Ga0075431_100090831 3300006847 Bacteria 3152
132 Ga0075434_100956998 3300006871 Bacteria 871
133 Ga0068865_100017043 3300006881 Bacteria 4663
134 Ga0097620_100023611 3300006931 Bacteria 6172
135 Ga0097620_100414822 3300006931 Bacteria 1443
136 Ga0075435_100313412 3300007076 Bacteria 1343
137 Ga0105251_10002543 3300009011 Bacteria 14182
138 Ga0105251_10005401 3300009011 Bacteria 8362
139 Ga0105244_10088545 3300009036 Bacteria 1524
140 Ga0105244_10150248 3300009036 Bacteria 1116
141 Ga0111539_10011289 3300009094 Bacteria 11221
142 Ga0105245_10405214 3300009098 Bacteria 1364
143 Ga0114129_12097022 3300009147 Bacteria 682
144 Ga0105243_10003403 3300009148 Bacteria 12904
145 Ga0105243_10169492 3300009148 Bacteria 1889
146 Ga0105243_10247437 3300009148 Bacteria 1590
147 Ga0105243_10571796 3300009148 Bacteria 1083
148 Ga0105242_10127277 3300009176 Bacteria 2194
149 Ga0105248_10185208 3300009177 Bacteria 2346
150 Ga0105249_10023801 3300009553 Bacteria 5501
151 Ga0157373_10057320 3300013100 Bacteria 2763
152 Ga0157373_10175020 3300013100 Bacteria 1510
153 Ga0157371_10000509 3300013102 Bacteria 46826
154 Ga0157371_10482928 3300013102 Bacteria 913
155 Ga0157370_10011813 3300013104 Bacteria 9112
156 Ga0157370_10016557 3300013104 Bacteria 7459
157 Ga0157370_10339973 3300013104 Bacteria 1383
158 Ga0157369_10098068 3300013105 Bacteria 3126
159 Ga0157378_10673416 3300013297 Bacteria 1052
160 Ga0163162_10000642 3300013306 Bacteria 32380
161 Ga0163162_10196509 3300013306 Bacteria 2146
162 Ga0157372_10481003 3300013307 Bacteria 1448
163 Ga0157372_10492274 3300013307 Bacteria 1430
164 Ga0157375_11045002 3300013308 Bacteria 955
165 Ga0157380_10147002 3300014326 Bacteria 2032
166 Ga0157380_10187258 3300014326 Bacteria 1824
167 Ga0157380_10360227 3300014326 Bacteria 1364
168 Ga0157380_10712528 3300014326 Bacteria 1010
169 Ga0157380_10807638 3300014326 Bacteria 956
170 Ga0157380_11095325 3300014326 Bacteria 835
171 Ga0157380_11298025 3300014326 Bacteria 775
172 Ga0157380_12229879 3300014326 Bacteria 612
173 Ga0157380_12372905 3300014326 Bacteria 595
174 Ga0182008_10001256 3300014497 Bacteria 17405
175 Ga0182008_10002712 3300014497 Bacteria 10992
176 Ga0182006_1010651 3300015261 Bacteria 4078
177 Ga0182006_1018341 3300015261 Bacteria 2959
178 Ga0182006_1045768 3300015261 Bacteria 1701
179 Ga0182006_1060170 3300015261 Bacteria 1436
180 Ga0182007_10000142 3300015262 Bacteria 47856
181 Ga0182005_1000456 3300015265 Bacteria 21433
182 Ga0182005_1002506 3300015265 Bacteria 6521
183 Ga0183360_10003 3300015689 Bacteria 713221
184 Ga0163161_10001916 3300017792 Bacteria 15193
185 Ga0163161_10042753 3300017792 Bacteria 3261
186 Ga0163161_10050069 3300017792 Bacteria 3022
187 Ga0163161_10730226 3300017792 Bacteria 827
188 Ga0163161_10998746 3300017792 Bacteria 714
189 Ga0213872_10034666 3300021361 Bacteria 2310
190 Ga0213871_10001874 3300021441 Bacteria 3700
191 Ga0224712_10126973 3300022467 Bacteria 1110
192 Ga0209784_100452 3300025224 Bacteria 17499
193 Ga0209566_100858 3300025225 Bacteria 15007
194 Ga0209674_100076 3300025226 Bacteria 210323
195 Ga0209563_101746 3300025230 Bacteria 5474
196 Ga0207425_1000074 3300025245 Bacteria 108738
197 Ga0207425_1011909 3300025245 Bacteria 2057
198 Ga0207425_1023126 3300025245 Bacteria 1303
199 Ga0207425_1027643 3300025245 Bacteria 1156
200 Ga0209646_1000043 3300025246 Bacteria 343652
201 Ga0209148_1000162 3300025254 Bacteria 138642
202 Ga0209759_1007897 3300025256 Bacteria 3367
203 Ga0209129_1000150 3300025258 Bacteria 113886
204 Ga0209565_1000002 3300025263 Bacteria 1423083
205 Ga0209565_1000050 3300025263 Bacteria 213856
206 Ga0209673_1000002 3300025273 Bacteria 1423083
207 Ga0209673_1000199 3300025273 Bacteria 120904
208 Ga0209673_1014118 3300025273 Bacteria 3109
209 Ga0209130_1004188 3300025284 Bacteria 5638
210 Ga0209130_1012708 3300025284 Bacteria 2187
211 Ga0209675_1000002 3300025291 Bacteria 1423083
212 Ga0209675_1000007 3300025291 Bacteria 683430
213 Ga0209676_1000018 3300025292 Bacteria 631385
214 Ga0209676_1000052 3300025292 Bacteria 371539
215 Ga0209676_1000168 3300025292 Bacteria 156042
216 Ga0209676_1002246 3300025292 Bacteria 14279
217 Ga0209676_1002770 3300025292 Bacteria 11705
218 Ga0209676_1012232 3300025292 Bacteria 3393
219 Ga0209676_1068063 3300025292 Bacteria 857
220 Ga0209025_1000006 3300025294 Bacteria 1153444
221 Ga0209025_1000048 3300025294 Bacteria 335574
222 Ga0209025_1006331 3300025294 Bacteria 9231
223 Ga0209025_1007416 3300025294 Bacteria 8190
224 Ga0209025_1122811 3300025294 Bacteria 771
225 Ga0209564_1000004 3300025295 Bacteria 1424639
226 Ga0209564_1000061 3300025295 Bacteria 322795
227 Ga0209564_1007457 3300025295 Bacteria 5645
228 Ga0209758_1000056 3300025297 Bacteria 335574
229 Ga0209758_1012351 3300025297 Bacteria 4791
230 Ga0209758_1031408 3300025297 Bacteria 2178
231 Ga0209758_1070105 3300025297 Bacteria 1108
232 Ga0209050_1000382 3300025298 Bacteria 83595
233 Ga0209050_1000424 3300025298 Bacteria 77803
234 Ga0209050_1001351 3300025298 Bacteria 26975
235 Ga0209050_1008173 3300025298 Bacteria 5662
236 Ga0209050_1049812 3300025298 Bacteria 1070
237 Ga0209256_1000004 3300025299 Bacteria 1424643
238 Ga0209256_1001917 3300025299 Bacteria 19037
239 Ga0209256_1004346 3300025299 Bacteria 8983
240 Ga0209256_1004359 3300025299 Bacteria 8963
241 Ga0209051_1001153 3300025303 Bacteria 24028
242 Ga0209051_1009442 3300025303 Bacteria 5028
243 Ga0209257_1000035 3300025304 Bacteria 631463
244 Ga0209257_1000046 3300025304 Bacteria 477765
245 Ga0209257_1000147 3300025304 Bacteria 194105
246 Ga0209257_1000261 3300025304 Bacteria 121357
247 Ga0209257_1002362 3300025304 Bacteria 18933
248 Ga0209257_1007745 3300025304 Bacteria 6392
249 Ga0209257_1013698 3300025304 Bacteria 3572
250 Ga0209257_1028235 3300025304 Bacteria 1850
251 Ga0207655_1056203 3300025728 Bacteria 1553
252 Ga0207655_1065998 3300025728 Bacteria 1370
253 Ga0207713_1002835 3300025735 Bacteria 12196
254 Ga0207713_1010568 3300025735 Bacteria 5099
255 Ga0207642_10011268 3300025899 Bacteria 3182
256 Ga0207680_10618985 3300025903 Bacteria 775
257 Ga0207645_10001976 3300025907 Bacteria 16474
258 Ga0207705_10060700 3300025909 Bacteria 2731
259 Ga0207654_10003591 3300025911 Bacteria 7842
260 Ga0207693_10848888 3300025915 Bacteria 702
261 Ga0207660_10492294 3300025917 Bacteria 994
262 Ga0207660_10629718 3300025917 Bacteria 874
263 Ga0207662_10096692 3300025918 Bacteria 1825
264 Ga0207657_10029127 3300025919 Bacteria 5031
265 Ga0207652_10357870 3300025921 Bacteria 1317
266 Ga0207681_10020993 3300025923 Bacteria 4145
267 Ga0207681_10065932 3300025923 Bacteria 2505
268 Ga0207650_10002184 3300025925 Bacteria 13667
269 Ga0207650_10086120 3300025925 Bacteria 2392
270 Ga0207650_10296549 3300025925 Bacteria 1319
271 Ga0207687_10322955 3300025927 Bacteria 1250
272 Ga0207690_10472844 3300025932 Bacteria 1010
273 Ga0207706_10003669 3300025933 Bacteria 14656
274 Ga0207706_10410077 3300025933 Bacteria 1174
275 Ga0207686_10162912 3300025934 Bacteria 1565
276 Ga0207709_10000528 3300025935 Bacteria 33221
277 Ga0207709_10003695 3300025935 Bacteria 9012
278 Ga0207670_10012308 3300025936 Bacteria 5000
279 Ga0207669_10009378 3300025937 Bacteria 4658
280 Ga0207704_10042105 3300025938 Bacteria 2685
281 Ga0207691_10001458 3300025940 Bacteria 23567
282 Ga0207711_10165234 3300025941 Bacteria 2006
283 Ga0207689_10236613 3300025942 Bacteria 1509
284 Ga0207689_10301321 3300025942 Bacteria 1328
285 Ga0207679_10066842 3300025945 Bacteria 2695
286 Ga0207679_10265781 3300025945 Bacteria 1465
287 Ga0207668_10011240 3300025972 Bacteria 5434
288 Ga0207668_10024806 3300025972 Bacteria 3874
289 Ga0207668_10309289 3300025972 Bacteria 1307
290 Ga0207668_10432999 3300025972 Bacteria 1119
291 Ga0207658_10484093 3300025986 Bacteria 1100
292 Ga0207703_10076136 3300026035 Bacteria 2783
293 Ga0207639_11072175 3300026041 Bacteria 755
294 Ga0207678_10274595 3300026067 Bacteria 1446
295 Ga0207708_10013436 3300026075 Bacteria 6121
296 Ga0207708_10054745 3300026075 Bacteria 3042
297 Ga0207708_10216298 3300026075 Bacteria 1533
298 Ga0207702_10055987 3300026078 Bacteria 3347
299 Ga0207641_10068777 3300026088 Bacteria 3037
300 Ga0207641_10191868 3300026088 Bacteria 1878
301 Ga0207641_10332546 3300026088 Bacteria 1444
302 Ga0207641_10480033 3300026088 Bacteria 1205
303 Ga0207648_10002185 3300026089 Bacteria 21227
304 Ga0207648_10021900 3300026089 Bacteria 5741
305 Ga0207648_10087273 3300026089 Bacteria 2723
306 Ga0207648_11137401 3300026089 Bacteria 732
307 Ga0207676_10553283 3300026095 Bacteria 1099
308 Ga0207675_100001664 3300026118 Bacteria 22243
309 Ga0207675_100002324 3300026118 Bacteria 18877
310 Ga0207675_100004583 3300026118 Bacteria 13325
311 Ga0207675_100021836 3300026118 Bacteria 5960
312 Ga0207675_100345761 3300026118 Bacteria 1457
313 Ga0207683_10008928 3300026121 Bacteria 8540
314 Ga0209371_1000018 3300027312 Bacteria 614700
315 Ga0209371_1000025 3300027312 Bacteria 450640
316 Ga0209982_1020368 3300027552 Bacteria 1019
317 Ga0209983_1003270 3300027665 Bacteria 3478
318 Ga0209971_1003097 3300027682 Bacteria 3970
319 Ga0209998_10002149 3300027717 Bacteria 4584
320 Ga0209974_10013115 3300027876 Bacteria 2763
321 Ga0207428_10591594 3300027907 Bacteria 800
322 Ga0268266_10008586 3300028379 Bacteria 9073
323 Ga0268266_10421701 3300028379 Bacteria 1264
324 Ga0268266_10517271 3300028379 Bacteria 1141
325 Ga0268265_10013033 3300028380 Bacteria 5645
326 Ga0268265_10503311 3300028380 Bacteria 1142
327 Ga0268264_10076290 3300028381 Bacteria 2851
328 Ga0268264_10211888 3300028381 Bacteria 1779
329 Ga0268256_1000016 3300030500 Bacteria 614700
330 Ga0268256_1000027 3300030500 Bacteria 450640
331 Ga0316177_1011446 3300030731 Bacteria 5474
332 Ga0316176_1127381 3300030732 Bacteria 3510
333 Ga0314311_1144405 3300030733 Bacteria 3264
334 Ga0316183_1126505 3300030742 Bacteria 4946
335 Ga0316181_1013001 3300030744 Bacteria 1016
336 Ga0265340_10020325 3300031247 Bacteria 3413
337 Ga0307513_10000429 3300031456 Bacteria 60815
338 Ga0307513_10269691 3300031456 Bacteria 1486
339 Ga0307408_100336657 3300031548 Bacteria 1276
340 Ga0265313_10053216 3300031595 Bacteria 1928
341 Ga0316576_10631419 3300031727 Bacteria 780
342 Ga0307405_10208711 3300031731 Bacteria 1424
343 Ga0307405_10209171 3300031731 Bacteria 1423
344 Ga0307405_10334898 3300031731 Bacteria 1161
345 Ga0307413_10000988 3300031824 Bacteria 10222
346 Ga0307413_10014349 3300031824 Bacteria 4020
347 Ga0307413_10138231 3300031824 Bacteria 1679
348 Ga0307413_10437716 3300031824 Bacteria 1034
349 Ga0307413_10671430 3300031824 Bacteria 857
350 Ga0307410_10024677 3300031852 Bacteria 3760
351 Ga0307406_10046763 3300031901 Bacteria 2724
352 Ga0307407_10087701 3300031903 Bacteria 1899
353 Ga0307412_10005903 3300031911 Bacteria 6896
354 Ga0307412_10200107 3300031911 Bacteria 1516
355 Ga0307412_10210209 3300031911 Bacteria 1484
356 Ga0307412_10328376 3300031911 Bacteria 1220
357 Ga0307409_100028513 3300031995 Bacteria 3979
358 Ga0307409_101231822 3300031995 Bacteria 772
359 Ga0307416_100027413 3300032002 Bacteria 4218
360 Ga0307416_100213906 3300032002 Bacteria 1842
361 Ga0307416_100257492 3300032002 Bacteria 1703
362 Ga0307416_100360964 3300032002 Bacteria 1475
363 Ga0307416_100761670 3300032002 Bacteria 1061
364 Ga0307414_10013082 3300032004 Bacteria 4930
365 Ga0307414_10014535 3300032004 Bacteria 4724
366 Ga0307414_10023786 3300032004 Bacteria 3893
367 Ga0307414_10024265 3300032004 Bacteria 3864
368 Ga0307414_10042335 3300032004 Bacteria 3093
369 Ga0307414_10093508 3300032004 Bacteria 2241
370 Ga0307414_10110862 3300032004 Bacteria 2088
371 Ga0307414_10129121 3300032004 Bacteria 1958
372 Ga0307414_10231284 3300032004 Bacteria 1524
373 Ga0307414_10276667 3300032004 Bacteria 1408
374 Ga0307414_10516957 3300032004 Bacteria 1059
375 Ga0307414_10661998 3300032004 Bacteria 942
376 Ga0307411_10017098 3300032005 Bacteria 4121
377 Ga0307411_10295281 3300032005 Bacteria 1297
378 Ga0307415_100010718 3300032126 Bacteria 5206
379 Ga0307415_100851999 3300032126 Bacteria 836
380 Ga0316574_0055569 3300035398 Bacteria 2474
381 Ga0395900_0003560 3300037418 Bacteria 16750
382 Ga0395905_0002540 3300037471 Bacteria 20135
383 Ga0395905_0026642 3300037471 Bacteria 5451
384 Ga0436364_0679110 3300037853 Bacteria 1766
385 Ga0237819_02706 3300038705 Bacteria 3423
386 Ga0400485_20806 3300038735 Bacteria 11157
387 Ga0400486_26303 3300038742 Bacteria 6112
388 Ga0400483_059047 3300039062 Bacteria 9494
389 Ga0400489_95599 3300039093 Bacteria 23383
390 Ga0400487_59073 3300039110 Bacteria 6398
391 Ga0436360_0303389 3300039438 Bacteria 30232
392 Ga0436360_0521760 3300039438 Bacteria 518
393 Ga0436360_0941386 3300039438 Bacteria 976
394 Ga0436361_0524379 3300039447 Bacteria 7028
395 Ga0436363_0422774 3300039450 Bacteria 937
396 Ga0436363_1434014 3300039450 Bacteria 2134
397 Ga0436362_0256845 3300039453 Bacteria 770
398 Ga0436362_0872713 3300039453 Bacteria 10063
399 Ga0439436_0019829 3300041404 Bacteria 2005
400 Ga0439436_0031686 3300041404 Bacteria 1534
401 Ga0439436_0049564 3300041404 Bacteria 1190
402 Ga0439447_000492 3300041407 Bacteria 14679
403 Ga0439465_0000375 3300041413 Bacteria 12836
404 Ga0439465_0000617 3300041413 Bacteria 10808
405 Ga0439465_0014660 3300041413 Bacteria 2443
406 Ga0439465_0056714 3300041413 Bacteria 1291
407 Ga0451789_0970999 3300041443 Bacteria 1489
408 Ga0451791_1017899 3300041451 Bacteria 1547
409 Ga0451793_1242350 3300041452 Bacteria 2420
410 Ga0451793_1699778 3300041452 Bacteria 3082
411 Ga0451797_1448458 3300041453 Bacteria 3706
412 Ga0451800_0326087 3300041459 Bacteria 2968
413 Ga0451802_0157001 3300041460 Bacteria 684
414 Ga0451802_0874384 3300041460 Bacteria 2099
415 Ga0451806_205037 3300041462 Bacteria 2586
416 Ga0451804_0675874 3300041463 Bacteria 1979
417 Ga0451807_1218172 3300041486 Bacteria 2883
418 Ga0451833_0862655 3300041491 Bacteria 879
419 Ga0451837_1270090 3300041494 Bacteria 2500
420 Ga0451839_0227527 3300041496 Bacteria 760
421 Ga0451843_0025158 3300041509 Bacteria 1877
422 Ga0439431_0007467 3300041997 Bacteria 2439
423 Ga0439431_0034730 3300041997 Bacteria 1265
424 Ga0439433_0006452 3300041999 Bacteria 2524
425 Ga0439433_0017301 3300041999 Bacteria 1600
426 Ga0439445_0000472 3300042004 Bacteria 8181
427 Ga0439432_005050 3300042006 Bacteria 4770
428 Ga0439432_048759 3300042006 Bacteria 1325
429 Ga0439449_0000016 3300042007 Bacteria 49059
430 Ga0439449_0007148 3300042007 Bacteria 4248
431 Ga0439449_0012977 3300042007 Bacteria 3133
432 Ga0439449_0033248 3300042007 Bacteria 1921
433 Ga0439449_0043301 3300042007 Bacteria 1671
434 Ga0450911_001075 3300042115 Bacteria 6884
435 Ga0450894_046905 3300042131 Bacteria 630
436 Ga0450906_018587 3300042145 Bacteria 1247
437 Ga0439446_0082606 3300042156 Bacteria 997
438 Ga0439464_0050872 3300042439 Bacteria 1198
439 Ga0439440_0010694 3300042993 Bacteria 1923
440 Ga0439440_0032406 3300042993 Bacteria 1241
441 Ga0466966_0124048 3300044684 Bacteria 1585
442 Ga0495627_012925 3300046453 Bacteria 2947
443 Ga0495590_0002699 3300046457 Bacteria 7332
444 Ga0495638_0002077 3300046460 Bacteria 17009
445 Ga0495638_0018520 3300046460 Bacteria 4623
446 Ga0495638_0026208 3300046460 Bacteria 3781
447 Ga0495638_0060323 3300046460 Bacteria 2347
448 Ga0495638_0087513 3300046460 Bacteria 1882
449 Ga0495605_0154667 3300046474 Bacteria 1021
450 Ga0495607_0006816 3300046501 Bacteria 7973
451 Ga0495610_0003143 3300046512 Bacteria 13114
452 Ga0495610_0052050 3300046512 Bacteria 1989
453 Ga0495616_0033813 3300046513 Bacteria 2660
454 Ga0495616_0070639 3300046513 Bacteria 1690
455 Ga0495630_0325491 3300046517 Bacteria 1175
456 Ga0495631_0001419 3300046518 Bacteria 14555
457 Ga0495632_0063089 3300046519 Bacteria 1795
458 Ga0495632_0122409 3300046519 Bacteria 1215
459 Ga0495643_0001536 3300046522 Bacteria 20716
460 Ga0495643_0070612 3300046522 Bacteria 1834
461 Ga0495648_0314218 3300046524 Bacteria 729
462 Ga0495663_0003689 3300046525 Bacteria 4383
463 Ga0495663_0016003 3300046525 Bacteria 2118
464 Ga0495663_0021410 3300046525 Bacteria 1862
465 Ga0495663_0083384 3300046525 Bacteria 1032
466 Ga0495663_0090594 3300046525 Bacteria 996
467 Ga0495654_0304575 3300046530 Unclassified 650
468 Ga0495586_0050033 3300046535 Bacteria 2260
469 Ga0495598_0002739 3300046537 Bacteria 3659
470 Ga0495633_0001972 3300046558 Bacteria 14877
471 Ga0495633_0011609 3300046558 Bacteria 4738
472 Ga0495633_0089362 3300046558 Bacteria 1432
473 Ga0495633_0095109 3300046558 Bacteria 1384
474 Ga0495656_0002680 3300046615 Bacteria 5944
475 Ga0495668_0000951 3300046616 Bacteria 32160
476 Ga0495625_0058494 3300046660 Bacteria 2739
477 Ga0495625_0106805 3300046660 Bacteria 1916
478 Ga0495658_0014564 3300046683 Bacteria 4022
479 Ga0495670_0028250 3300046691 Bacteria 2781
480 Ga0495671_0002955 3300046692 Bacteria 10574
481 Ga0495649_0286783 3300046694 Bacteria 840
482 Ga0495660_0002707 3300046810 Bacteria 11190
483 Ga0495636_0004551 3300047318 Bacteria 5432
484 Ga0495636_0019822 3300047318 Bacteria 2705
485 Ga0495672_0001653 3300047320 Bacteria 21663
486 Ga0495672_0078637 3300047320 Bacteria 1844
487 Ga0495685_002200 3300047447 Bacteria 6066
488 Ga0495681_0034282 3300047470 Bacteria 2531
489 Ga0495686_0002109 3300047472 Bacteria 19488
490 Ga0495686_0339575 3300047472 Bacteria 819
491 Ga0496100_0793735 3300048903 Bacteria 742
492 Ga0496101_0141005 3300048904 Bacteria 1837
493 Ga0496102_0641756 3300048905 Bacteria 985
494 Ga0496105_0046263 3300048908 Bacteria 3591
495 Ga0496109_0216750 3300048912 Bacteria 1800
496 Ga0496109_0386696 3300048912 Bacteria 1322
497 Ga0496109_1025904 3300048912 Bacteria 762
498 Ga0496113_0203922 3300048916 Bacteria 1572
499 Ga0496114_0006644 3300048917 Bacteria 9113
500 Ga0496116_0004127 3300048919 Bacteria 13996
501 Ga0496116_0038194 3300048919 Bacteria 3337
502 Ga0496117_0001057 3300048920 Bacteria 42009
503 Ga0496117_0003169 3300048920 Bacteria 19552
504 Ga0496117_0003395 3300048920 Bacteria 18532
505 Ga0496117_0059763 3300048920 Bacteria 2630
506 Ga0496117_0103856 3300048920 Bacteria 1790
507 Ga0496118_0000661 3300048921 Bacteria 56425
508 Ga0496118_0003383 3300048921 Bacteria 20155
509 Ga0496118_0007411 3300048921 Bacteria 11641
510 Ga0496118_0011181 3300048921 Bacteria 8787
511 Ga0496118_0146826 3300048921 Bacteria 1483
512 Ga0496119_0000192 3300048922 Bacteria 85787
513 Ga0496119_0002158 3300048922 Bacteria 22096
514 Ga0496119_0004988 3300048922 Bacteria 12956
515 Ga0496120_0001184 3300048923 Bacteria 33176
516 Ga0496120_0002178 3300048923 Bacteria 20782
517 Ga0496121_0002087 3300048924 Bacteria 31540
518 Ga0496121_0005214 3300048924 Bacteria 16838
519 Ga0496121_0036564 3300048924 Bacteria 4374
520 Ga0496121_0132836 3300048924 Bacteria 1859
521 Ga0496122_0001623 3300048925 Bacteria 35103
522 Ga0496122_0002776 3300048925 Bacteria 24122
523 Ga0496122_0004567 3300048925 Bacteria 17062
524 Ga0496122_0006518 3300048925 Bacteria 13369
525 Ga0496122_0011939 3300048925 Bacteria 8720
526 Ga0496122_0018455 3300048925 Bacteria 6443
527 Ga0496122_0048968 3300048925 Bacteria 3243
528 Ga0496123_0001282 3300048926 Bacteria 35895
529 Ga0496123_0002342 3300048926 Bacteria 23773
530 Ga0496123_0003872 3300048926 Bacteria 16282
531 Ga0496123_0017574 3300048926 Bacteria 5744
532 Ga0496123_0036629 3300048926 Bacteria 3476
533 Ga0496123_0039932 3300048926 Bacteria 3277
534 Ga0496123_0141990 3300048926 Bacteria 1311
535 Ga0496123_0144176 3300048926 Bacteria 1296
536 Ga0496124_0000006 3300048927 Bacteria 904259
537 Ga0496124_0002117 3300048927 Bacteria 26727
538 Ga0496124_0002767 3300048927 Bacteria 22294
539 Ga0496124_0004759 3300048927 Bacteria 15630
540 Ga0496124_0006154 3300048927 Bacteria 13165
541 Ga0496124_0008856 3300048927 Bacteria 10448
542 Ga0496124_0016163 3300048927 Bacteria 7114
543 Ga0496124_0019984 3300048927 Bacteria 6208
544 Ga0496125_0005651 3300048928 Bacteria 13801
545 Ga0496125_0017000 3300048928 Bacteria 6954
546 Ga0496125_0033097 3300048928 Bacteria 4580
547 Ga0496125_0036821 3300048928 Bacteria 4263
548 Ga0496125_0100131 3300048928 Bacteria 2137
549 Ga0496125_0172361 3300048928 Bacteria 1452
550 Ga0496126_0005622 3300048929 Bacteria 14253
551 Ga0496126_0008005 3300048929 Bacteria 11474
552 Ga0496126_0234937 3300048929 Bacteria 1534
553 Ga0501307_026680 3300049162 Bacteria 782
554 Ga0501031_0212793 3300049568 Bacteria 1259
555 Ga0501032_0067090 3300049569 Bacteria 2397
556 Ga0501033_0097370 3300049570 Bacteria 2149
557 Ga0501034_0000192 3300049571 Bacteria 115486
558 Ga0501034_0003141 3300049571 Bacteria 19011
559 Ga0501034_0008435 3300049571 Bacteria 10886
560 Ga0501034_0184804 3300049571 Bacteria 2048
561 Ga0501034_0204364 3300049571 Bacteria 1932
562 Ga0501034_0308524 3300049571 Bacteria 1517
563 Ga0501034_1054239 3300049571 Bacteria 695
564 Ga0501036_0050271 3300049572 Bacteria 3530
565 Ga0501036_0199942 3300049572 Bacteria 1681
566 Ga0501037_0027307 3300049573 Bacteria 4218
567 Ga0501037_0164402 3300049573 Bacteria 1581
568 Ga0501038_0062095 3300049574 Bacteria 3193
569 Ga0501038_0083910 3300049574 Bacteria 2681
570 Ga0501038_0365905 3300049574 Bacteria 1121
571 Ga0501039_0160997 3300049575 Bacteria 1764
572 Ga0501039_0285648 3300049575 Bacteria 1297
573 Ga0501043_0151626 3300049579 Bacteria 1814
574 Ga0501047_0000530 3300049581 Bacteria 41265
575 Ga0501047_0001922 3300049581 Bacteria 19965
576 Ga0501047_0181848 3300049581 Bacteria 1969
577 Ga0501067_0000246 3300049583 Bacteria 29961
578 Ga0501068_0100438 3300049584 Bacteria 1793
579 Ga0501069_0001146 3300049585 Bacteria 12815
580 Ga0501070_0003602 3300049586 Bacteria 13395
581 Ga0501070_0010276 3300049586 Bacteria 7914
582 Ga0501070_0976115 3300049586 Bacteria 658
583 Ga0501072_0000311 3300049588 Bacteria 34577
584 Ga0501073_0011567 3300049589 Bacteria 6453
585 Ga0501073_0174141 3300049589 Bacteria 1489
586 Ga0501074_0003929 3300049590 Bacteria 10592
587 Ga0501074_0024799 3300049590 Bacteria 4356
588 Ga0501257_009998 3300049686 Bacteria 2148
589 Ga0501079_0002396 3300049741 Bacteria 13591
590 Ga0501080_0007973 3300049742 Bacteria 9597
591 Ga0501080_0008098 3300049742 Bacteria 9524
592 Ga0501080_0088508 3300049742 Bacteria 2876
593 Ga0501083_0000540 3300049744 Bacteria 24122
594 Ga0501035_0033403 3300049822 Bacteria 4679
595 Ga0501035_0204255 3300049822 Bacteria 1693
596 Ga0501035_0563007 3300049822 Bacteria 932
597 Ga0501044_0002948 3300049823 Bacteria 19352
598 Ga0501044_0102705 3300049823 Bacteria 2874
599 Ga0501044_0418440 3300049823 Bacteria 1250
600 Ga0501045_0155248 3300049824 Bacteria 1703
601 nmdc:mga00v17_1192_c1 3300050491 Bacteria 6692
602 nmdc:mga07m45_423425_c1 3300050496 Bacteria 772
603 nmdc:mga0qj67_667589_c1 3300050509 Bacteria 829
604 nmdc:mga06r32_755050_c1 3300050510 Bacteria 936
605 nmdc:mga08y16_581492_c1 3300050511 Bacteria 1131
606 nmdc:mga08y16_658569_c1 3300050511 Bacteria 1050
607 Ga0500644_0025886 3300053088 Bacteria 1811
608 Ga0500634_0000139 3300053161 Bacteria 26249
609 Ga0500634_0061963 3300053161 Bacteria 1983
610 Ga0500611_081125 3300053727 Bacteria 810
611 Ga0500565_000076 3300053734 Bacteria 4724
612 Ga0501084_0083639 3300054114 Bacteria 2679
613 Ga0501082_0019471 3300060353 Bacteria 5851

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0521760 Ga0436360_0521760_15_473 150
2 3300037418 Ga0395900_0003560 Ga0395900_0003560_101_595 161
3 3300037471 Ga0395905_0026642 Ga0395905_0026642_3901_4395 161
4 iso_pu_bacteria 2911138879 2911139432 162
5 3300031731 Ga0307405_10334898 Ga0307405_103348982 163
6 3300032002 Ga0307416_100761670 Ga0307416_1007616702 163
7 3300005295 Ga0065707_10307730 Ga0065707_103077301 164
8 3300005331 Ga0070670_100122434 Ga0070670_1001224342 164
9 3300005354 Ga0070675_100409438 Ga0070675_1004094381 164
10 3300005367 Ga0070667_100403941 Ga0070667_1004039412 164
11 3300005563 Ga0068855_100732372 Ga0068855_1007323722 164
12 3300005564 Ga0070664_100720267 Ga0070664_1007202671 164
13 3300005618 Ga0068864_101244522 Ga0068864_1012445221 164
14 3300005841 Ga0068863_100273556 Ga0068863_1002735562 164
15 3300005842 Ga0068858_100573778 Ga0068858_1005737781 164
16 3300005844 Ga0068862_100025278 Ga0068862_1000252782 164
17 3300009177 Ga0105248_10185208 Ga0105248_101852083 164
18 3300014326 Ga0157380_12372905 Ga0157380_123729051 164
19 3300025925 Ga0207650_10296549 Ga0207650_102965492 164
20 3300025941 Ga0207711_10165234 Ga0207711_101652342 164
21 3300025986 Ga0207658_10484093 Ga0207658_104840931 164
22 3300026088 Ga0207641_10191868 Ga0207641_101918682 164
23 3300026118 Ga0207675_100345761 Ga0207675_1003457612 164
24 3300031727 Ga0316576_10631419 Ga0316576_106314191 164
25 3300050511 nmdc:mga08y16_658569_c1 nmdc:mga08y16_658569_c1_357_860 164
26 3300013104 Ga0157370_10016557 Ga0157370_100165575 165
27 3300013104 Ga0157370_10339973 Ga0157370_103399731 165
28 3300025911 Ga0207654_10003591 Ga0207654_100035912 165
29 3300049571 Ga0501034_0003141 Ga0501034_0003141_3193_3690 165
30 3300049571 Ga0501034_0184804 Ga0501034_0184804_1286_1783 165
31 3300049571 Ga0501034_0308524 Ga0501034_0308524_755_1252 165
32 3300049572 Ga0501036_0050271 Ga0501036_0050271_1355_1852 165
33 3300049573 Ga0501037_0027307 Ga0501037_0027307_718_1215 165
34 3300049573 Ga0501037_0164402 Ga0501037_0164402_965_1462 165
35 3300049574 Ga0501038_0083910 Ga0501038_0083910_1454_1951 165
36 3300049575 Ga0501039_0285648 Ga0501039_0285648_73_570 165
37 3300049581 Ga0501047_0000530 Ga0501047_0000530_25363_25860 165
38 3300049581 Ga0501047_0001922 Ga0501047_0001922_14657_15154 165
39 3300049583 Ga0501067_0000246 Ga0501067_0000246_27010_27507 165
40 3300049584 Ga0501068_0100438 Ga0501068_0100438_79_576 165
41 3300049585 Ga0501069_0001146 Ga0501069_0001146_1681_2178 165
42 3300049586 Ga0501070_0003602 Ga0501070_0003602_2597_3094 165
43 3300049586 Ga0501070_0010276 Ga0501070_0010276_266_763 165
44 3300049588 Ga0501072_0000311 Ga0501072_0000311_13728_14225 165
45 3300049589 Ga0501073_0011567 Ga0501073_0011567_3223_3720 165
46 3300049589 Ga0501073_0174141 Ga0501073_0174141_738_1235 165
47 3300049590 Ga0501074_0003929 Ga0501074_0003929_872_1369 165
48 3300049590 Ga0501074_0024799 Ga0501074_0024799_257_754 165
49 3300049741 Ga0501079_0002396 Ga0501079_0002396_11910_12407 165
50 3300049742 Ga0501080_0007973 Ga0501080_0007973_883_1380 165
51 3300049742 Ga0501080_0008098 Ga0501080_0008098_3193_3690 165
52 3300049742 Ga0501080_0088508 Ga0501080_0088508_266_763 165
53 3300049744 Ga0501083_0000540 Ga0501083_0000540_13467_13964 165
54 3300049822 Ga0501035_0204255 Ga0501035_0204255_1014_1511 165
55 3300049822 Ga0501035_0563007 Ga0501035_0563007_419_916 165
56 3300049823 Ga0501044_0002948 Ga0501044_0002948_2734_3231 165
57 3300049823 Ga0501044_0418440 Ga0501044_0418440_477_974 165
58 3300054114 Ga0501084_0083639 Ga0501084_0083639_1821_2318 165
59 3300013306 Ga0163162_10000642 Ga0163162_1000064213 166
60 3300014326 Ga0157380_11095325 Ga0157380_110953252 166
61 iso_pu_bacteria 2576861471 2578456812 166
62 iso_pu_bacteria 2643221579 2643906573 166
63 iso_pu_bacteria 2643221581 2643913913 166
64 iso_pu_bacteria 2643221593 2643973641 166
65 iso_pu_bacteria 2747842428 2747951098 166
66 iso_pu_bacteria 2747842501 2748017605 166
67 iso_pu_bacteria 2765235840 2765580691 166
68 iso_pu_bacteria 2816332141 2816518300 166
69 iso_pu_bacteria 2818991457 2819661498 166
70 iso_pu_bacteria 2842391507 2842395060 166
71 iso_pu_bacteria 2842757796 2842760701 166
72 iso_pu_bacteria 2842780639 2842782451 166
73 iso_pu_bacteria 2852649853 2852651972 166
74 iso_pu_bacteria 2852684882 2852687390 166
75 iso_pu_bacteria 2857442823 2857444328 166
76 iso_pu_bacteria 2874220319 2874223353 166
77 iso_pu_bacteria 2895498888 2895502864 166
78 iso_pu_bacteria 2895511927 2895512906 166
79 iso_pu_bacteria 2895522137 2895522914 166
80 iso_pu_bacteria 2895525241 2895525313 166
81 iso_pu_bacteria 2919089067 2919092425 166
82 iso_pu_bacteria 2919130084 2919130799 166
83 iso_pu_bacteria 2919134579 2919137141 166
84 iso_pu_bacteria 2923516293 2923516380 166
85 iso_pu_bacteria 2928496128 2928499956 166
86 iso_pu_bacteria 2929195423 2929196026 166
87 iso_pu_bacteria 2931380184 2931383227 166
88 iso_pu_bacteria 2937610967 2937614177 166
89 iso_pu_bacteria 2939589442 2939589981 166
90 iso_pu_bacteria 2939622612 2939624362 166
91 iso_pu_bacteria 2939626828 2939629301 166
92 iso_pu_bacteria 2941475908 2941478606 166
93 iso_pu_bacteria 2941489479 2941491195 166
94 iso_pu_bacteria 2961047084 2961050117 166
95 iso_pu_bacteria 2961064222 2961064741 166
96 iso_pu_bacteria 2974307012 2974307419 166
97 iso_pu_bacteria 2977247770 2977248166 166
98 iso_pu_bacteria 2984514374 2984517378 166
99 iso_pu_bacteria 2987605356 2987609040 166
100 iso_pu_bacteria 2995948881 2995953720 166
101 iso_pu_bacteria 8003014200 8003017773 166
102 iso_pu_bacteria 8021622325 8021625963 166
103 iso_pu_bacteria 8021648035 8021652077 166
104 3300001976 JGI24752J21851_1016343 JGI24752J21851_10163432 167
105 3300001979 JGI24740J21852_10002686 JGI24740J21852_100026865 167
106 3300002705 JGI25156J39149_1018662 JGI25156J39149_10186622 167
107 3300002738 JGI25154J39366_1000483 JGI25154J39366_100048312 167
108 3300003752 Ga0055539_1012272 Ga0055539_10122722 167
109 3300003756 Ga0055533_1001999 Ga0055533_10019992 167
110 3300003762 Ga0055542_1000850 Ga0055542_10008505 167
111 3300003762 Ga0055542_1001034 Ga0055542_10010348 167
112 3300003841 Ga0055541_1001734 Ga0055541_10017341 167
113 3300005327 Ga0070658_10032518 Ga0070658_100325183 167
114 3300005327 Ga0070658_10689494 Ga0070658_106894942 167
115 3300005330 Ga0070690_100119218 Ga0070690_1001192182 167
116 3300005333 Ga0070677_10092205 Ga0070677_100922051 167
117 3300005334 Ga0068869_100244161 Ga0068869_1002441612 167
118 3300005334 Ga0068869_100593831 Ga0068869_1005938311 167
119 3300005336 Ga0070680_100020213 Ga0070680_1000202131 167
120 3300005337 Ga0070682_100023544 Ga0070682_1000235443 167
121 3300005341 Ga0070691_10119784 Ga0070691_101197842 167
122 3300005343 Ga0070687_100101169 Ga0070687_1001011692 167
123 3300005353 Ga0070669_100041021 Ga0070669_1000410213 167
124 3300005356 Ga0070674_100138049 Ga0070674_1001380491 167
125 3300005366 Ga0070659_100028080 Ga0070659_1000280804 167
126 3300005438 Ga0070701_10022043 Ga0070701_100220432 167
127 3300005438 Ga0070701_10050921 Ga0070701_100509212 167
128 3300005438 Ga0070701_10303542 Ga0070701_103035421 167
129 3300005439 Ga0070711_100324028 Ga0070711_1003240282 167
130 3300005441 Ga0070700_100037530 Ga0070700_1000375302 167
131 3300005444 Ga0070694_100131986 Ga0070694_1001319862 167
132 3300005445 Ga0070708_100158696 Ga0070708_1001586962 167
133 3300005457 Ga0070662_100240935 Ga0070662_1002409352 167
134 3300005459 Ga0068867_100028324 Ga0068867_1000283243 167
135 3300005459 Ga0068867_100046885 Ga0068867_1000468852 167
136 3300005466 Ga0070685_10085766 Ga0070685_100857663 167
137 3300005539 Ga0068853_100667983 Ga0068853_1006679831 167
138 3300005545 Ga0070695_100451825 Ga0070695_1004518251 167
139 3300005547 Ga0070693_100200953 Ga0070693_1002009532 167
140 3300005548 Ga0070665_100014027 Ga0070665_1000140275 167
141 3300005564 Ga0070664_100076347 Ga0070664_1000763473 167
142 3300005578 Ga0068854_100230445 Ga0068854_1002304452 167
143 3300005615 Ga0070702_100005549 Ga0070702_1000055495 167
144 3300005617 Ga0068859_100023611 Ga0068859_1000236113 167
145 3300005617 Ga0068859_100414821 Ga0068859_1004148211 167
146 3300005618 Ga0068864_100631335 Ga0068864_1006313352 167
147 3300005718 Ga0068866_10289966 Ga0068866_102899661 167
148 3300005719 Ga0068861_100001173 Ga0068861_1000011735 167
149 3300005719 Ga0068861_100098454 Ga0068861_1000984542 167
150 3300005719 Ga0068861_100209909 Ga0068861_1002099091 167
151 3300005719 Ga0068861_100500364 Ga0068861_1005003642 167
152 3300005841 Ga0068863_100029167 Ga0068863_1000291673 167
153 3300005842 Ga0068858_100095371 Ga0068858_1000953713 167
154 3300005843 Ga0068860_100023622 Ga0068860_1000236222 167
155 3300005844 Ga0068862_100006827 Ga0068862_1000068273 167
156 3300005844 Ga0068862_100012896 Ga0068862_1000128966 167
157 3300006237 Ga0097621_100075208 Ga0097621_1000752082 167
158 3300006847 Ga0075431_100090831 Ga0075431_1000908312 167
159 3300006871 Ga0075434_100956998 Ga0075434_1009569981 167
160 3300006881 Ga0068865_100017043 Ga0068865_1000170432 167
161 3300006931 Ga0097620_100023611 Ga0097620_1000236115 167
162 3300006931 Ga0097620_100414822 Ga0097620_1004148222 167
163 3300007076 Ga0075435_100313412 Ga0075435_1003134122 167
164 3300009094 Ga0111539_10011289 Ga0111539_100112894 167
165 3300009147 Ga0114129_12097022 Ga0114129_120970221 167
166 3300009148 Ga0105243_10169492 Ga0105243_101694922 167
167 3300009176 Ga0105242_10127277 Ga0105242_101272771 167
168 3300009553 Ga0105249_10023801 Ga0105249_100238015 167
169 3300013297 Ga0157378_10673416 Ga0157378_106734162 167
170 3300013306 Ga0163162_10196509 Ga0163162_101965093 167
171 3300013307 Ga0157372_10492274 Ga0157372_104922741 167
172 3300013308 Ga0157375_11045002 Ga0157375_110450021 167
173 3300014326 Ga0157380_10147002 Ga0157380_101470022 167
174 3300014326 Ga0157380_10360227 Ga0157380_103602272 167
175 3300014326 Ga0157380_10712528 Ga0157380_107125282 167
176 3300014326 Ga0157380_10807638 Ga0157380_108076382 167
177 3300014326 Ga0157380_11298025 Ga0157380_112980251 167
178 3300025224 Ga0209784_100452 Ga0209784_1004522 167
179 3300025225 Ga0209566_100858 Ga0209566_1008589 167
180 3300025226 Ga0209674_100076 Ga0209674_100076125 167
181 3300025230 Ga0209563_101746 Ga0209563_1017463 167
182 3300025246 Ga0209646_1000043 Ga0209646_100004399 167
183 3300025254 Ga0209148_1000162 Ga0209148_100016238 167
184 3300025256 Ga0209759_1007897 Ga0209759_10078972 167
185 3300025899 Ga0207642_10011268 Ga0207642_100112682 167
186 3300025907 Ga0207645_10001976 Ga0207645_100019767 167
187 3300025915 Ga0207693_10848888 Ga0207693_108488882 167
188 3300025917 Ga0207660_10629718 Ga0207660_106297182 167
189 3300025918 Ga0207662_10096692 Ga0207662_100966922 167
190 3300025923 Ga0207681_10020993 Ga0207681_100209932 167
191 3300025925 Ga0207650_10086120 Ga0207650_100861203 167
192 3300025933 Ga0207706_10003669 Ga0207706_1000366910 167
193 3300025934 Ga0207686_10162912 Ga0207686_101629122 167
194 3300025936 Ga0207670_10012308 Ga0207670_100123082 167
195 3300025938 Ga0207704_10042105 Ga0207704_100421052 167
196 3300025942 Ga0207689_10236613 Ga0207689_102366132 167
197 3300025942 Ga0207689_10301321 Ga0207689_103013212 167
198 3300025945 Ga0207679_10066842 Ga0207679_100668422 167
199 3300025972 Ga0207668_10011240 Ga0207668_100112405 167
200 3300026035 Ga0207703_10076136 Ga0207703_100761363 167
201 3300026067 Ga0207678_10274595 Ga0207678_102745952 167
202 3300026075 Ga0207708_10013436 Ga0207708_100134365 167
203 3300026075 Ga0207708_10054745 Ga0207708_100547452 167
204 3300026075 Ga0207708_10216298 Ga0207708_102162981 167
205 3300026078 Ga0207702_10055987 Ga0207702_100559874 167
206 3300026088 Ga0207641_10068777 Ga0207641_100687772 167
207 3300026088 Ga0207641_10480033 Ga0207641_104800332 167
208 3300026089 Ga0207648_10002185 Ga0207648_1000218515 167
209 3300026089 Ga0207648_10087273 Ga0207648_100872733 167
210 3300026089 Ga0207648_11137401 Ga0207648_111374011 167
211 3300026095 Ga0207676_10553283 Ga0207676_105532831 167
212 3300026118 Ga0207675_100001664 Ga0207675_10000166418 167
213 3300026118 Ga0207675_100002324 Ga0207675_10000232417 167
214 3300026118 Ga0207675_100004583 Ga0207675_1000045838 167
215 3300026118 Ga0207675_100021836 Ga0207675_1000218362 167
216 3300027552 Ga0209982_1020368 Ga0209982_10203681 167
217 3300027665 Ga0209983_1003270 Ga0209983_10032702 167
218 3300027682 Ga0209971_1003097 Ga0209971_10030973 167
219 3300027717 Ga0209998_10002149 Ga0209998_100021494 167
220 3300027876 Ga0209974_10013115 Ga0209974_100131152 167
221 3300027907 Ga0207428_10591594 Ga0207428_105915942 167
222 3300028379 Ga0268266_10008586 Ga0268266_100085865 167
223 3300028380 Ga0268265_10013033 Ga0268265_100130335 167
224 3300028381 Ga0268264_10076290 Ga0268264_100762901 167
225 3300028381 Ga0268264_10211888 Ga0268264_102118882 167
226 3300031247 Ga0265340_10020325 Ga0265340_100203254 167
227 3300031548 Ga0307408_100336657 Ga0307408_1003366572 167
228 3300031595 Ga0265313_10053216 Ga0265313_100532162 167
229 3300031731 Ga0307405_10208711 Ga0307405_102087112 167
230 3300031824 Ga0307413_10014349 Ga0307413_100143492 167
231 3300031824 Ga0307413_10138231 Ga0307413_101382312 167
232 3300031852 Ga0307410_10024677 Ga0307410_100246772 167
233 3300031901 Ga0307406_10046763 Ga0307406_100467633 167
234 3300031903 Ga0307407_10087701 Ga0307407_100877012 167
235 3300031995 Ga0307409_100028513 Ga0307409_1000285133 167
236 3300032002 Ga0307416_100257492 Ga0307416_1002574922 167
237 3300032002 Ga0307416_100360964 Ga0307416_1003609641 167
238 3300032005 Ga0307411_10017098 Ga0307411_100170984 167
239 3300032126 Ga0307415_100010718 Ga0307415_1000107185 167
240 3300035398 Ga0316574_0055569 Ga0316574_0055569_567_1109 167
241 3300037471 Ga0395905_0002540 Ga0395905_0002540_3915_4427 167
242 3300038735 Ga0400485_20806 Ga0400485_20806_3988_4521 167
243 3300038742 Ga0400486_26303 Ga0400486_26303_2605_3138 167
244 3300039062 Ga0400483_059047 Ga0400483_059047_123_656 167
245 3300039093 Ga0400489_95599 Ga0400489_95599_294_827 167
246 3300039110 Ga0400487_59073 Ga0400487_59073_2945_3478 167
247 3300041460 Ga0451802_0157001 Ga0451802_0157001_38_577 167
248 3300041491 Ga0451833_0862655 Ga0451833_0862655_92_604 167
249 3300042006 Ga0439432_048759 Ga0439432_048759_491_1000 167
250 3300042007 Ga0439449_0007148 Ga0439449_0007148_3713_4222 167
251 3300042131 Ga0450894_046905 Ga0450894_046905_52_591 167
252 3300042439 Ga0439464_0050872 Ga0439464_0050872_518_1057 167
253 3300042993 Ga0439440_0010694 Ga0439440_0010694_992_1504 167
254 3300042993 Ga0439440_0032406 Ga0439440_0032406_85_624 167
255 3300044684 Ga0466966_0124048 Ga0466966_0124048_570_1112 167
256 3300046457 Ga0495590_0002699 Ga0495590_0002699_4972_5511 167
257 3300046460 Ga0495638_0026208 Ga0495638_0026208_1102_1719 167
258 3300046460 Ga0495638_0087513 Ga0495638_0087513_1155_1694 167
259 3300046517 Ga0495630_0325491 Ga0495630_0325491_463_1005 167
260 3300046519 Ga0495632_0063089 Ga0495632_0063089_16_555 167
261 3300046519 Ga0495632_0122409 Ga0495632_0122409_630_1169 167
262 3300046530 Ga0495654_0304575 Ga0495654_0304575_98_637 167
263 3300046535 Ga0495586_0050033 Ga0495586_0050033_1366_1908 167
264 3300046660 Ga0495625_0058494 Ga0495625_0058494_196_735 167
265 3300046683 Ga0495658_0014564 Ga0495658_0014564_1647_2189 167
266 3300046694 Ga0495649_0286783 Ga0495649_0286783_277_816 167
267 3300047472 Ga0495686_0339575 Ga0495686_0339575_85_624 167
268 3300048903 Ga0496100_0793735 Ga0496100_0793735_11_550 167
269 3300049586 Ga0501070_0976115 Ga0501070_0976115_87_626 167
270 3300050496 nmdc:mga07m45_423425_c1 nmdc:mga07m45_423425_c1_42_578 167
271 3300050509 nmdc:mga0qj67_667589_c1 nmdc:mga0qj67_667589_c1_232_777 167
272 3300050510 nmdc:mga06r32_755050_c1 nmdc:mga06r32_755050_c1_338_883 167
273 3300050511 nmdc:mga08y16_581492_c1 nmdc:mga08y16_581492_c1_483_1028 167
274 3300053088 Ga0500644_0025886 Ga0500644_0025886_103_642 167
275 3300053161 Ga0500634_0061963 Ga0500634_0061963_552_1100 167
276 3300053727 Ga0500611_081125 Ga0500611_081125_152_691 167
277 3300060353 Ga0501082_0019471 Ga0501082_0019471_5093_5596 167
278 3300030731 Ga0316177_1011446 Ga0316177_10114464 169
279 3300030733 Ga0314311_1144405 Ga0314311_11444052 169
280 3300031824 Ga0307413_10671430 Ga0307413_106714302 169
281 3300032002 Ga0307416_100027413 Ga0307416_1000274135 169
282 3300041404 Ga0439436_0049564 Ga0439436_0049564_494_1003 169
283 3300042145 Ga0450906_018587 Ga0450906_018587_642_1151 169
284 3300047318 Ga0495636_0004551 Ga0495636_0004551_488_1003 169
285 3300047447 Ga0495685_002200 Ga0495685_002200_2771_3286 169
286 3300049686 Ga0501257_009998 Ga0501257_009998_235_750 169
287 2162886007 SwRhRL2b_contig_1124246 SwRhRL2b_0470.00007510 170
288 2162886007 SwRhRL2b_contig_1325465 SwRhRL2b_0682.00003550 170
289 3300002773 JGI25152J39213_1000612 JGI25152J39213_10006128 170
290 3300002774 JGI25150J39212_1000741 JGI25150J39212_10007415 170
291 3300002987 JGI25159J45721_1049662 JGI25159J45721_10496621 170
292 3300003187 JGI25151J46595_10000016 JGI25151J46595_1000001685 170
293 3300003187 JGI25151J46595_10001145 JGI25151J46595_1000114512 170
294 3300003187 JGI25151J46595_10067410 JGI25151J46595_100674101 170
295 3300003215 JGI25153J46596_10000801 JGI25153J46596_1000080112 170
296 3300003320 rootH2_10032978 rootH2_100329787 170
297 3300003323 rootH1_10049495 rootH1_100494952 170
298 3300003771 Ga0055526_1000003 Ga0055526_1000003225 170
299 3300003771 Ga0055526_1000247 Ga0055526_10002478 170
300 3300003771 Ga0055526_1017155 Ga0055526_10171553 170
301 3300003773 Ga0055537_1000055 Ga0055537_100005512 170
302 3300003773 Ga0055537_1000614 Ga0055537_10006147 170
303 3300003775 Ga0055524_1000002 Ga0055524_1000002142 170
304 3300003775 Ga0055524_1010266 Ga0055524_10102664 170
305 3300003775 Ga0055524_1012482 Ga0055524_10124823 170
306 3300003781 Ga0055536_1000983 Ga0055536_10009837 170
307 3300003781 Ga0055536_1013870 Ga0055536_10138701 170
308 3300003781 Ga0055536_1013874 Ga0055536_10138741 170
309 3300003781 Ga0055536_1048315 Ga0055536_10483151 170
310 3300003784 Ga0055534_1000062 Ga0055534_100006212 170
311 3300003784 Ga0055534_1000599 Ga0055534_100059914 170
312 3300003790 Ga0055528_1000001 Ga0055528_1000001142 170
313 3300003790 Ga0055528_1000407 Ga0055528_100040719 170
314 3300003791 Ga0055530_10001944 Ga0055530_100019441 170
315 3300003791 Ga0055530_10001946 Ga0055530_100019461 170
316 3300003791 Ga0055530_10004373 Ga0055530_100043736 170
317 3300003794 Ga0055531_10014111 Ga0055531_100141112 170
318 3300003794 Ga0055531_10018514 Ga0055531_100185141 170
319 3300003794 Ga0055531_10018523 Ga0055531_100185231 170
320 3300003794 Ga0055531_10027564 Ga0055531_100275641 170
321 3300003794 Ga0055531_10028782 Ga0055531_100287821 170
322 3300003856 Ga0058692_1000004 Ga0058692_100000413 170
323 3300003856 Ga0058692_1000078 Ga0058692_100007846 170
324 3300005289 Ga0065704_10000512 Ga0065704_1000051217 170
325 3300005289 Ga0065704_10095357 Ga0065704_100953572 170
326 3300005289 Ga0065704_10101678 Ga0065704_101016781 170
327 3300005331 Ga0070670_100005119 Ga0070670_10000511910 170
328 3300005336 Ga0070680_100309086 Ga0070680_1003090862 170
329 3300005347 Ga0070668_100033588 Ga0070668_1000335884 170
330 3300005347 Ga0070668_100455252 Ga0070668_1004552522 170
331 3300005353 Ga0070669_100105619 Ga0070669_1001056192 170
332 3300005353 Ga0070669_100435435 Ga0070669_1004354351 170
333 3300005356 Ga0070674_100145557 Ga0070674_1001455573 170
334 3300005367 Ga0070667_100132112 Ga0070667_1001321122 170
335 3300005456 Ga0070678_100003261 Ga0070678_1000032617 170
336 3300005459 Ga0068867_100029282 Ga0068867_1000292823 170
337 3300005543 Ga0070672_100019487 Ga0070672_1000194874 170
338 3300005547 Ga0070693_100667432 Ga0070693_1006674321 170
339 3300005548 Ga0070665_100013456 Ga0070665_1000134562 170
340 3300005548 Ga0070665_100030222 Ga0070665_1000302223 170
341 3300005548 Ga0070665_100779820 Ga0070665_1007798202 170
342 3300005564 Ga0070664_100445157 Ga0070664_1004451572 170
343 3300005840 Ga0068870_10132417 Ga0068870_101324172 170
344 3300005844 Ga0068862_100350459 Ga0068862_1003504592 170
345 3300005985 Ga0081539_10042689 Ga0081539_100426893 170
346 3300006038 Ga0075365_10180726 Ga0075365_101807262 170
347 3300006051 Ga0075364_10000016 Ga0075364_100000167 170
348 3300006051 Ga0075364_10055728 Ga0075364_100557282 170
349 3300006051 Ga0075364_10160562 Ga0075364_101605622 170
350 3300006051 Ga0075364_10334134 Ga0075364_103341342 170
351 3300006051 Ga0075364_10367567 Ga0075364_103675672 170
352 3300006353 Ga0075370_10214862 Ga0075370_102148621 170
353 3300009011 Ga0105251_10002543 Ga0105251_100025437 170
354 3300009011 Ga0105251_10005401 Ga0105251_100054012 170
355 3300009036 Ga0105244_10088545 Ga0105244_100885452 170
356 3300009036 Ga0105244_10150248 Ga0105244_101502482 170
357 3300009098 Ga0105245_10405214 Ga0105245_104052142 170
358 3300009148 Ga0105243_10003403 Ga0105243_100034039 170
359 3300009148 Ga0105243_10247437 Ga0105243_102474371 170
360 3300009148 Ga0105243_10571796 Ga0105243_105717962 170
361 3300013100 Ga0157373_10057320 Ga0157373_100573202 170
362 3300013100 Ga0157373_10175020 Ga0157373_101750201 170
363 3300013102 Ga0157371_10000509 Ga0157371_1000050913 170
364 3300013102 Ga0157371_10482928 Ga0157371_104829282 170
365 3300013104 Ga0157370_10011813 Ga0157370_100118132 170
366 3300013105 Ga0157369_10098068 Ga0157369_100980683 170
367 3300013307 Ga0157372_10481003 Ga0157372_104810032 170
368 3300014326 Ga0157380_10187258 Ga0157380_101872581 170
369 3300014326 Ga0157380_12229879 Ga0157380_122298791 170
370 3300014497 Ga0182008_10001256 Ga0182008_1000125614 170
371 3300014497 Ga0182008_10002712 Ga0182008_100027126 170
372 3300015261 Ga0182006_1010651 Ga0182006_10106514 170
373 3300015261 Ga0182006_1018341 Ga0182006_10183413 170
374 3300015261 Ga0182006_1045768 Ga0182006_10457682 170
375 3300015261 Ga0182006_1060170 Ga0182006_10601701 170
376 3300015262 Ga0182007_10000142 Ga0182007_1000014231 170
377 3300015265 Ga0182005_1000456 Ga0182005_100045613 170
378 3300015265 Ga0182005_1002506 Ga0182005_10025067 170
379 3300015689 Ga0183360_10003 Ga0183360_10003420 170
380 3300017792 Ga0163161_10001916 Ga0163161_100019167 170
381 3300017792 Ga0163161_10042753 Ga0163161_100427533 170
382 3300017792 Ga0163161_10050069 Ga0163161_100500693 170
383 3300017792 Ga0163161_10730226 Ga0163161_107302261 170
384 3300017792 Ga0163161_10998746 Ga0163161_109987462 170
385 3300021361 Ga0213872_10034666 Ga0213872_100346663 170
386 3300021441 Ga0213871_10001874 Ga0213871_100018743 170
387 3300022467 Ga0224712_10126973 Ga0224712_101269732 170
388 3300025245 Ga0207425_1000074 Ga0207425_100007495 170
389 3300025245 Ga0207425_1011909 Ga0207425_10119092 170
390 3300025245 Ga0207425_1023126 Ga0207425_10231262 170
391 3300025245 Ga0207425_1027643 Ga0207425_10276431 170
392 3300025258 Ga0209129_1000150 Ga0209129_100015095 170
393 3300025263 Ga0209565_1000002 Ga0209565_1000002438 170
394 3300025263 Ga0209565_1000050 Ga0209565_100005081 170
395 3300025273 Ga0209673_1000002 Ga0209673_1000002438 170
396 3300025273 Ga0209673_1000199 Ga0209673_100019980 170
397 3300025273 Ga0209673_1014118 Ga0209673_10141183 170
398 3300025284 Ga0209130_1004188 Ga0209130_10041884 170
399 3300025284 Ga0209130_1012708 Ga0209130_10127083 170
400 3300025291 Ga0209675_1000002 Ga0209675_1000002438 170
401 3300025291 Ga0209675_1000007 Ga0209675_1000007407 170
402 3300025292 Ga0209676_1000018 Ga0209676_1000018162 170
403 3300025292 Ga0209676_1000052 Ga0209676_1000052321 170
404 3300025292 Ga0209676_1000168 Ga0209676_1000168108 170
405 3300025292 Ga0209676_1002246 Ga0209676_100224613 170
406 3300025292 Ga0209676_1002770 Ga0209676_10027702 170
407 3300025292 Ga0209676_1012232 Ga0209676_10122322 170
408 3300025292 Ga0209676_1068063 Ga0209676_10680632 170
409 3300025294 Ga0209025_1000006 Ga0209025_1000006919 170
410 3300025294 Ga0209025_1000048 Ga0209025_100004895 170
411 3300025294 Ga0209025_1006331 Ga0209025_10063316 170
412 3300025294 Ga0209025_1007416 Ga0209025_10074163 170
413 3300025294 Ga0209025_1122811 Ga0209025_11228111 170
414 3300025295 Ga0209564_1000004 Ga0209564_1000004439 170
415 3300025295 Ga0209564_1000061 Ga0209564_1000061180 170
416 3300025295 Ga0209564_1007457 Ga0209564_10074573 170
417 3300025297 Ga0209758_1000056 Ga0209758_100005695 170
418 3300025297 Ga0209758_1012351 Ga0209758_10123512 170
419 3300025297 Ga0209758_1031408 Ga0209758_10314083 170
420 3300025297 Ga0209758_1070105 Ga0209758_10701052 170
421 3300025298 Ga0209050_1000382 Ga0209050_100038270 170
422 3300025298 Ga0209050_1000424 Ga0209050_100042467 170
423 3300025298 Ga0209050_1001351 Ga0209050_10013515 170
424 3300025298 Ga0209050_1008173 Ga0209050_10081736 170
425 3300025298 Ga0209050_1049812 Ga0209050_10498121 170
426 3300025299 Ga0209256_1000004 Ga0209256_1000004439 170
427 3300025299 Ga0209256_1001917 Ga0209256_100191711 170
428 3300025299 Ga0209256_1004346 Ga0209256_10043466 170
429 3300025299 Ga0209256_1004359 Ga0209256_10043593 170
430 3300025303 Ga0209051_1001153 Ga0209051_100115322 170
431 3300025303 Ga0209051_1009442 Ga0209051_10094422 170
432 3300025304 Ga0209257_1000035 Ga0209257_1000035162 170
433 3300025304 Ga0209257_1000046 Ga0209257_1000046397 170
434 3300025304 Ga0209257_1000147 Ga0209257_100014727 170
435 3300025304 Ga0209257_1000261 Ga0209257_100026178 170
436 3300025304 Ga0209257_1002362 Ga0209257_100236213 170
437 3300025304 Ga0209257_1007745 Ga0209257_10077453 170
438 3300025304 Ga0209257_1013698 Ga0209257_10136984 170
439 3300025304 Ga0209257_1028235 Ga0209257_10282352 170
440 3300025728 Ga0207655_1056203 Ga0207655_10562032 170
441 3300025728 Ga0207655_1065998 Ga0207655_10659982 170
442 3300025735 Ga0207713_1002835 Ga0207713_10028353 170
443 3300025735 Ga0207713_1010568 Ga0207713_10105682 170
444 3300025903 Ga0207680_10618985 Ga0207680_106189852 170
445 3300025909 Ga0207705_10060700 Ga0207705_100607003 170
446 3300025917 Ga0207660_10492294 Ga0207660_104922942 170
447 3300025919 Ga0207657_10029127 Ga0207657_100291275 170
448 3300025921 Ga0207652_10357870 Ga0207652_103578702 170
449 3300025923 Ga0207681_10065932 Ga0207681_100659322 170
450 3300025925 Ga0207650_10002184 Ga0207650_100021845 170
451 3300025927 Ga0207687_10322955 Ga0207687_103229552 170
452 3300025932 Ga0207690_10472844 Ga0207690_104728442 170
453 3300025933 Ga0207706_10410077 Ga0207706_104100771 170
454 3300025935 Ga0207709_10000528 Ga0207709_1000052814 170
455 3300025935 Ga0207709_10003695 Ga0207709_100036952 170
456 3300025937 Ga0207669_10009378 Ga0207669_100093782 170
457 3300025940 Ga0207691_10001458 Ga0207691_100014586 170
458 3300025945 Ga0207679_10265781 Ga0207679_102657811 170
459 3300025972 Ga0207668_10024806 Ga0207668_100248062 170
460 3300025972 Ga0207668_10309289 Ga0207668_103092892 170
461 3300025972 Ga0207668_10432999 Ga0207668_104329992 170
462 3300026041 Ga0207639_11072175 Ga0207639_110721751 170
463 3300026088 Ga0207641_10332546 Ga0207641_103325462 170
464 3300026089 Ga0207648_10021900 Ga0207648_100219003 170
465 3300026121 Ga0207683_10008928 Ga0207683_100089287 170
466 3300027312 Ga0209371_1000018 Ga0209371_1000018379 170
467 3300027312 Ga0209371_1000025 Ga0209371_1000025273 170
468 3300028379 Ga0268266_10421701 Ga0268266_104217012 170
469 3300028379 Ga0268266_10517271 Ga0268266_105172711 170
470 3300028380 Ga0268265_10503311 Ga0268265_105033112 170
471 3300030500 Ga0268256_1000016 Ga0268256_1000016379 170
472 3300030500 Ga0268256_1000027 Ga0268256_1000027273 170
473 3300030732 Ga0316176_1127381 Ga0316176_11273813 170
474 3300030742 Ga0316183_1126505 Ga0316183_11265053 170
475 3300030744 Ga0316181_1013001 Ga0316181_10130011 170
476 3300031456 Ga0307513_10000429 Ga0307513_1000042924 170
477 3300031456 Ga0307513_10269691 Ga0307513_102696912 170
478 3300031731 Ga0307405_10209171 Ga0307405_102091712 170
479 3300031824 Ga0307413_10000988 Ga0307413_100009882 170
480 3300031824 Ga0307413_10437716 Ga0307413_104377162 170
481 3300031911 Ga0307412_10005903 Ga0307412_100059031 170
482 3300031911 Ga0307412_10200107 Ga0307412_102001072 170
483 3300031911 Ga0307412_10210209 Ga0307412_102102092 170
484 3300031911 Ga0307412_10328376 Ga0307412_103283762 170
485 3300031995 Ga0307409_101231822 Ga0307409_1012318221 170
486 3300032002 Ga0307416_100213906 Ga0307416_1002139062 170
487 3300032004 Ga0307414_10013082 Ga0307414_100130825 170
488 3300032004 Ga0307414_10014535 Ga0307414_100145355 170
489 3300032004 Ga0307414_10023786 Ga0307414_100237862 170
490 3300032004 Ga0307414_10024265 Ga0307414_100242652 170
491 3300032004 Ga0307414_10042335 Ga0307414_100423353 170
492 3300032004 Ga0307414_10093508 Ga0307414_100935082 170
493 3300032004 Ga0307414_10110862 Ga0307414_101108622 170
494 3300032004 Ga0307414_10129121 Ga0307414_101291212 170
495 3300032004 Ga0307414_10231284 Ga0307414_102312842 170
496 3300032004 Ga0307414_10276667 Ga0307414_102766671 170
497 3300032004 Ga0307414_10516957 Ga0307414_105169572 170
498 3300032004 Ga0307414_10661998 Ga0307414_106619981 170
499 3300032005 Ga0307411_10295281 Ga0307411_102952812 170
500 3300032126 Ga0307415_100851999 Ga0307415_1008519991 170
501 3300037853 Ga0436364_0679110 Ga0436364_0679110_159_689 170
502 3300038705 Ga0237819_02706 Ga0237819_02706_1493_2005 170
503 3300039438 Ga0436360_0303389 Ga0436360_0303389_3999_4529 170
504 3300039438 Ga0436360_0941386 Ga0436360_0941386_410_934 170
505 3300039447 Ga0436361_0524379 Ga0436361_0524379_772_1302 170
506 3300039450 Ga0436363_0422774 Ga0436363_0422774_55_585 170
507 3300039450 Ga0436363_1434014 Ga0436363_1434014_695_1225 170
508 3300039453 Ga0436362_0256845 Ga0436362_0256845_197_727 170
509 3300039453 Ga0436362_0872713 Ga0436362_0872713_1992_2522 170
510 3300041404 Ga0439436_0019829 Ga0439436_0019829_754_1269 170
511 3300041404 Ga0439436_0031686 Ga0439436_0031686_401_922 170
512 3300041407 Ga0439447_000492 Ga0439447_000492_7620_8132 170
513 3300041413 Ga0439465_0000375 Ga0439465_0000375_11929_12450 170
514 3300041413 Ga0439465_0000617 Ga0439465_0000617_2885_3400 170
515 3300041413 Ga0439465_0014660 Ga0439465_0014660_657_1172 170
516 3300041413 Ga0439465_0056714 Ga0439465_0056714_407_922 170
517 3300041443 Ga0451789_0970999 Ga0451789_0970999_379_900 170
518 3300041451 Ga0451791_1017899 Ga0451791_1017899_329_850 170
519 3300041452 Ga0451793_1242350 Ga0451793_1242350_434_946 170
520 3300041452 Ga0451793_1699778 Ga0451793_1699778_1212_1733 170
521 3300041453 Ga0451797_1448458 Ga0451797_1448458_2456_2977 170
522 3300041459 Ga0451800_0326087 Ga0451800_0326087_1536_2048 170
523 3300041460 Ga0451802_0874384 Ga0451802_0874384_262_783 170
524 3300041462 Ga0451806_205037 Ga0451806_205037_625_1137 170
525 3300041463 Ga0451804_0675874 Ga0451804_0675874_449_961 170
526 3300041486 Ga0451807_1218172 Ga0451807_1218172_732_1244 170
527 3300041494 Ga0451837_1270090 Ga0451837_1270090_147_668 170
528 3300041496 Ga0451839_0227527 Ga0451839_0227527_166_678 170
529 3300041509 Ga0451843_0025158 Ga0451843_0025158_286_798 170
530 3300041997 Ga0439431_0007467 Ga0439431_0007467_292_813 170
531 3300041997 Ga0439431_0034730 Ga0439431_0034730_320_832 170
532 3300041999 Ga0439433_0006452 Ga0439433_0006452_430_945 170
533 3300041999 Ga0439433_0017301 Ga0439433_0017301_162_683 170
534 3300042004 Ga0439445_0000472 Ga0439445_0000472_5275_5787 170
535 3300042006 Ga0439432_005050 Ga0439432_005050_1630_2142 170
536 3300042007 Ga0439449_0000016 Ga0439449_0000016_29378_29893 170
537 3300042007 Ga0439449_0012977 Ga0439449_0012977_1307_1822 170
538 3300042007 Ga0439449_0033248 Ga0439449_0033248_627_1142 170
539 3300042007 Ga0439449_0043301 Ga0439449_0043301_371_892 170
540 3300042115 Ga0450911_001075 Ga0450911_001075_160_672 170
541 3300042156 Ga0439446_0082606 Ga0439446_0082606_428_949 170
542 3300046453 Ga0495627_012925 Ga0495627_012925_1952_2464 170
543 3300046460 Ga0495638_0002077 Ga0495638_0002077_5395_5907 170
544 3300046460 Ga0495638_0018520 Ga0495638_0018520_465_977 170
545 3300046460 Ga0495638_0060323 Ga0495638_0060323_360_881 170
546 3300046474 Ga0495605_0154667 Ga0495605_0154667_219_782 170
547 3300046501 Ga0495607_0006816 Ga0495607_0006816_415_978 170
548 3300046512 Ga0495610_0003143 Ga0495610_0003143_5223_5735 170
549 3300046512 Ga0495610_0052050 Ga0495610_0052050_454_966 170
550 3300046513 Ga0495616_0033813 Ga0495616_0033813_1420_1932 170
551 3300046513 Ga0495616_0070639 Ga0495616_0070639_321_842 170
552 3300046518 Ga0495631_0001419 Ga0495631_0001419_224_787 170
553 3300046522 Ga0495643_0001536 Ga0495643_0001536_5353_5865 170
554 3300046522 Ga0495643_0070612 Ga0495643_0070612_544_1065 170
555 3300046524 Ga0495648_0314218 Ga0495648_0314218_134_655 170
556 3300046525 Ga0495663_0003689 Ga0495663_0003689_311_832 170
557 3300046525 Ga0495663_0016003 Ga0495663_0016003_376_888 170
558 3300046525 Ga0495663_0021410 Ga0495663_0021410_1199_1711 170
559 3300046525 Ga0495663_0083384 Ga0495663_0083384_416_928 170
560 3300046525 Ga0495663_0090594 Ga0495663_0090594_238_753 170
561 3300046537 Ga0495598_0002739 Ga0495598_0002739_2260_2778 170
562 3300046558 Ga0495633_0001972 Ga0495633_0001972_8126_8638 170
563 3300046558 Ga0495633_0011609 Ga0495633_0011609_3898_4410 170
564 3300046558 Ga0495633_0089362 Ga0495633_0089362_422_934 170
565 3300046558 Ga0495633_0095109 Ga0495633_0095109_117_629 170
566 3300046615 Ga0495656_0002680 Ga0495656_0002680_880_1395 170
567 3300046616 Ga0495668_0000951 Ga0495668_0000951_6463_6975 170
568 3300046660 Ga0495625_0106805 Ga0495625_0106805_714_1226 170
569 3300046691 Ga0495670_0028250 Ga0495670_0028250_384_899 170
570 3300046692 Ga0495671_0002955 Ga0495671_0002955_4336_4857 170
571 3300046810 Ga0495660_0002707 Ga0495660_0002707_5368_5880 170
572 3300047318 Ga0495636_0019822 Ga0495636_0019822_1214_1729 170
573 3300047320 Ga0495672_0001653 Ga0495672_0001653_6285_6797 170
574 3300047320 Ga0495672_0078637 Ga0495672_0078637_1043_1555 170
575 3300047470 Ga0495681_0034282 Ga0495681_0034282_748_1311 170
576 3300047472 Ga0495686_0002109 Ga0495686_0002109_13744_14256 170
577 3300048904 Ga0496101_0141005 Ga0496101_0141005_747_1268 170
578 3300048905 Ga0496102_0641756 Ga0496102_0641756_332_850 170
579 3300048908 Ga0496105_0046263 Ga0496105_0046263_2589_3101 170
580 3300048912 Ga0496109_0216750 Ga0496109_0216750_25_543 170
581 3300048912 Ga0496109_0386696 Ga0496109_0386696_530_1048 170
582 3300048912 Ga0496109_1025904 Ga0496109_1025904_122_643 170
583 3300048916 Ga0496113_0203922 Ga0496113_0203922_491_1003 170
584 3300048917 Ga0496114_0006644 Ga0496114_0006644_2272_2784 170
585 3300048919 Ga0496116_0004127 Ga0496116_0004127_5454_5966 170
586 3300048919 Ga0496116_0038194 Ga0496116_0038194_2340_2852 170
587 3300048920 Ga0496117_0001057 Ga0496117_0001057_11095_11607 170
588 3300048920 Ga0496117_0003169 Ga0496117_0003169_13740_14252 170
589 3300048920 Ga0496117_0003395 Ga0496117_0003395_5337_5849 170
590 3300048920 Ga0496117_0059763 Ga0496117_0059763_1332_1844 170
591 3300048920 Ga0496117_0103856 Ga0496117_0103856_334_846 170
592 3300048921 Ga0496118_0000661 Ga0496118_0000661_42107_42619 170
593 3300048921 Ga0496118_0003383 Ga0496118_0003383_4607_5119 170
594 3300048921 Ga0496118_0007411 Ga0496118_0007411_6015_6527 170
595 3300048921 Ga0496118_0011181 Ga0496118_0011181_6210_6722 170
596 3300048921 Ga0496118_0146826 Ga0496118_0146826_360_872 170
597 3300048922 Ga0496119_0000192 Ga0496119_0000192_6494_7006 170
598 3300048922 Ga0496119_0002158 Ga0496119_0002158_5773_6285 170
599 3300048922 Ga0496119_0004988 Ga0496119_0004988_12346_12858 170
600 3300048923 Ga0496120_0001184 Ga0496120_0001184_5794_6306 170
601 3300048923 Ga0496120_0002178 Ga0496120_0002178_6555_7067 170
602 3300048924 Ga0496121_0002087 Ga0496121_0002087_9038_9550 170
603 3300048924 Ga0496121_0005214 Ga0496121_0005214_11062_11574 170
604 3300048924 Ga0496121_0036564 Ga0496121_0036564_2492_3004 170
605 3300048924 Ga0496121_0132836 Ga0496121_0132836_334_846 170
606 3300048925 Ga0496122_0001623 Ga0496122_0001623_28805_29317 170
607 3300048925 Ga0496122_0002776 Ga0496122_0002776_5667_6182 170
608 3300048925 Ga0496122_0004567 Ga0496122_0004567_13838_14359 170
609 3300048925 Ga0496122_0006518 Ga0496122_0006518_10610_11122 170
610 3300048925 Ga0496122_0011939 Ga0496122_0011939_8086_8598 170
611 3300048925 Ga0496122_0018455 Ga0496122_0018455_1838_2350 170
612 3300048925 Ga0496122_0048968 Ga0496122_0048968_387_899 170
613 3300048926 Ga0496123_0001282 Ga0496123_0001282_5804_6316 170
614 3300048926 Ga0496123_0002342 Ga0496123_0002342_17980_18495 170
615 3300048926 Ga0496123_0003872 Ga0496123_0003872_10040_10561 170
616 3300048926 Ga0496123_0017574 Ga0496123_0017574_4889_5401 170
617 3300048926 Ga0496123_0036629 Ga0496123_0036629_296_817 170
618 3300048926 Ga0496123_0039932 Ga0496123_0039932_2345_2857 170
619 3300048926 Ga0496123_0141990 Ga0496123_0141990_727_1239 170
620 3300048926 Ga0496123_0144176 Ga0496123_0144176_154_666 170
621 3300048927 Ga0496124_0000006 Ga0496124_0000006_498970_499533 170
622 3300048927 Ga0496124_0002117 Ga0496124_0002117_12720_13232 170
623 3300048927 Ga0496124_0002767 Ga0496124_0002767_15964_16476 170
624 3300048927 Ga0496124_0004759 Ga0496124_0004759_5233_5745 170
625 3300048927 Ga0496124_0006154 Ga0496124_0006154_12428_12940 170
626 3300048927 Ga0496124_0008856 Ga0496124_0008856_174_686 170
627 3300048927 Ga0496124_0016163 Ga0496124_0016163_862_1374 170
628 3300048927 Ga0496124_0019984 Ga0496124_0019984_5471_5983 170
629 3300048928 Ga0496125_0005651 Ga0496125_0005651_13230_13742 170
630 3300048928 Ga0496125_0017000 Ga0496125_0017000_6320_6832 170
631 3300048928 Ga0496125_0033097 Ga0496125_0033097_1504_2016 170
632 3300048928 Ga0496125_0036821 Ga0496125_0036821_3064_3576 170
633 3300048928 Ga0496125_0100131 Ga0496125_0100131_955_1467 170
634 3300048928 Ga0496125_0172361 Ga0496125_0172361_697_1209 170
635 3300048929 Ga0496126_0005622 Ga0496126_0005622_13619_14131 170
636 3300048929 Ga0496126_0008005 Ga0496126_0008005_379_891 170
637 3300048929 Ga0496126_0234937 Ga0496126_0234937_906_1418 170
638 3300049162 Ga0501307_026680 Ga0501307_026680_55_576 170
639 3300049568 Ga0501031_0212793 Ga0501031_0212793_438_950 170
640 3300049569 Ga0501032_0067090 Ga0501032_0067090_1163_1675 170
641 3300049570 Ga0501033_0097370 Ga0501033_0097370_227_739 170
642 3300049571 Ga0501034_0000192 Ga0501034_0000192_18464_18976 170
643 3300049571 Ga0501034_0008435 Ga0501034_0008435_4956_5471 170
644 3300049571 Ga0501034_0204364 Ga0501034_0204364_1180_1692 170
645 3300049571 Ga0501034_1054239 Ga0501034_1054239_98_610 170
646 3300049572 Ga0501036_0199942 Ga0501036_0199942_722_1234 170
647 3300049574 Ga0501038_0062095 Ga0501038_0062095_199_711 170
648 3300049574 Ga0501038_0365905 Ga0501038_0365905_356_868 170
649 3300049575 Ga0501039_0160997 Ga0501039_0160997_662_1174 170
650 3300049579 Ga0501043_0151626 Ga0501043_0151626_482_994 170
651 3300049581 Ga0501047_0181848 Ga0501047_0181848_1234_1746 170
652 3300049822 Ga0501035_0033403 Ga0501035_0033403_1696_2208 170
653 3300049823 Ga0501044_0102705 Ga0501044_0102705_217_729 170
654 3300049824 Ga0501045_0155248 Ga0501045_0155248_1178_1693 170
655 3300050491 nmdc:mga00v17_1192_c1 nmdc:mga00v17_1192_c1_5625_6137 170
656 3300053161 Ga0500634_0000139 Ga0500634_0000139_19475_19987 170
657 3300053734 Ga0500565_000076 Ga0500565_000076_56_568 170
658 iso_pu_bacteria 8021626552 8021627299 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

29

182

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k6l-assembly1.cif.gz_A the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9833 2 167
5j46-assembly1.cif.gz_A crystal structure of a peptide deformylase from burkholderia multivorans 0.9772 1 167
3fwx-assembly2.cif.gz_B the crystal structure of the peptide deformylase from vibrio cholerae o1 biovar el tor str. n16961 0.9736 3 167
3k6l-assembly3.cif.gz_C the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9731 3 162
3k6l-assembly1.cif.gz_A the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9715 2 167
ID Description Score Start End Superfamily
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9598 1 152 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9567 1 148 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9534 1 152 3.90.45.10
4je6A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9505 2 148 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9477 6 145 3.90.45.10
ID Description Score Start End GO Terms
AF-Q8PG20-F1-model_v4 Peptide deformylase 2 (PDF 2) (EC 3.5.1.88) (Polypeptide deformylase 2) 1.001 1 170 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A2S7F0R2-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 1.001 1 170 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A840JW24-F1-model_v4 deleted 1 1 170
AF-A0A0R0AA41-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9994 1 170 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A856YA22-F1-model_v4 deleted 0.9984 2 170

Feature Viewer

pLDDT pTM Quality
95.02 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map