F473184
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 658 | 368 | 613 | 172 |
Family's Representative Sequence
| Representative Sequence | 3300031731|Ga0307405_10209171|Ga0307405_102091712 |
| Length | 197 |
| Sequence | MAALFRRCDPCPRFGALVPAVPVNVPMALLDILEFPDPRLRTKARPVDAAQVAGPAFQQLLDDMFETMYAAPGIGLAASQVDVHERFMVIDVSEEKDQPLVFLNPEILSREGEQVCQEGCLSVPGIFADVTRADRIRVRALGRDGQPFELDVDGLLAVCIQHEMDHLDGKLFVDYLSPLKREMVRKKLAKARRQAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 3 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 4 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 5 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 6 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 7 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 8 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 9 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 10 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 11 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 12 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 13 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 14 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 15 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 16 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 17 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 18 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 19 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 20 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 21 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 22 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 23 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 24 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 25 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 26 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 27 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 28 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 29 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 30 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 31 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 32 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 33 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 34 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 35 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 36 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 37 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 38 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 39 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 40 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 41 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 42 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 43 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 44 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 45 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 46 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 47 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 48 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 49 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 50 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 51 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 52 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 53 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 54 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 59 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 61 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 62 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 63 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 64 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 65 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 66 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 67 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 68 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 69 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 71 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 74 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 92 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 94 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 99 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 103 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 104 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 105 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 106 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 107 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 108 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 109 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 110 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 111 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 112 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 113 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 146 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 147 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 156 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 219 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 220 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 221 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 222 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 223 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 224 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 228 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 230 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 231 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 232 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 233 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 235 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 236 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 237 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 238 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 239 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 240 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 241 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 242 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 243 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 244 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 245 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 246 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 247 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 248 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 249 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 250 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 251 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 252 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 253 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 254 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 255 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 256 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 266 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 267 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 268 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 269 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 270 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 271 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 272 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 273 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 274 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 275 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 276 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 277 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 278 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 279 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 280 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 281 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 315 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 317 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 318 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 319 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 320 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 321 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 322 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 323 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 324 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 325 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 326 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 327 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 348 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 355 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 356 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 361 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 362 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 363 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 366 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 367 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 368 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.86 |
| Metatranscriptomes | 0.3 |
| Isolates | 6.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 16.26 |
| Nodule | 0.15 |
| Rhizoplane | 3.04 |
| Rhizosphere | 65.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1124246 | 2162886007 | Bacteria | 2716 |
| 2 | SwRhRL2b_contig_1325465 | 2162886007 | Bacteria | 2823 |
| 3 | JGI24752J21851_1016343 | 3300001976 | Bacteria | 966 |
| 4 | JGI24740J21852_10002686 | 3300001979 | Bacteria | 7983 |
| 5 | JGI25156J39149_1018662 | 3300002705 | Bacteria | 1275 |
| 6 | JGI25154J39366_1000483 | 3300002738 | Bacteria | 20639 |
| 7 | JGI25152J39213_1000612 | 3300002773 | Bacteria | 19226 |
| 8 | JGI25150J39212_1000741 | 3300002774 | Bacteria | 11523 |
| 9 | JGI25159J45721_1049662 | 3300002987 | Bacteria | 579 |
| 10 | JGI25151J46595_10000016 | 3300003187 | Bacteria | 249712 |
| 11 | JGI25151J46595_10001145 | 3300003187 | Bacteria | 19226 |
| 12 | JGI25151J46595_10067410 | 3300003187 | Bacteria | 1103 |
| 13 | JGI25153J46596_10000801 | 3300003215 | Bacteria | 19226 |
| 14 | rootH2_10032978 | 3300003320 | Bacteria | 6472 |
| 15 | rootH1_10049495 | 3300003323 | Bacteria | 2826 |
| 16 | Ga0055539_1012272 | 3300003752 | Bacteria | 1054 |
| 17 | Ga0055533_1001999 | 3300003756 | Bacteria | 4972 |
| 18 | Ga0055542_1000850 | 3300003762 | Bacteria | 21415 |
| 19 | Ga0055542_1001034 | 3300003762 | Bacteria | 17453 |
| 20 | Ga0055526_1000003 | 3300003771 | Bacteria | 413092 |
| 21 | Ga0055526_1000247 | 3300003771 | Bacteria | 45809 |
| 22 | Ga0055526_1017155 | 3300003771 | Bacteria | 2785 |
| 23 | Ga0055537_1000055 | 3300003773 | Bacteria | 81951 |
| 24 | Ga0055537_1000614 | 3300003773 | Bacteria | 19575 |
| 25 | Ga0055524_1000002 | 3300003775 | Bacteria | 459550 |
| 26 | Ga0055524_1010266 | 3300003775 | Bacteria | 3740 |
| 27 | Ga0055524_1012482 | 3300003775 | Bacteria | 3258 |
| 28 | Ga0055536_1000983 | 3300003781 | Bacteria | 18085 |
| 29 | Ga0055536_1013870 | 3300003781 | Bacteria | 2870 |
| 30 | Ga0055536_1013874 | 3300003781 | Bacteria | 2869 |
| 31 | Ga0055536_1048315 | 3300003781 | Bacteria | 953 |
| 32 | Ga0055534_1000062 | 3300003784 | Bacteria | 81951 |
| 33 | Ga0055534_1000599 | 3300003784 | Bacteria | 18695 |
| 34 | Ga0055528_1000001 | 3300003790 | Bacteria | 402384 |
| 35 | Ga0055528_1000407 | 3300003790 | Bacteria | 34812 |
| 36 | Ga0055530_10001944 | 3300003791 | Bacteria | 14108 |
| 37 | Ga0055530_10001946 | 3300003791 | Bacteria | 14103 |
| 38 | Ga0055530_10004373 | 3300003791 | Bacteria | 7317 |
| 39 | Ga0055531_10014111 | 3300003794 | Bacteria | 3626 |
| 40 | Ga0055531_10018514 | 3300003794 | Bacteria | 2870 |
| 41 | Ga0055531_10018523 | 3300003794 | Bacteria | 2869 |
| 42 | Ga0055531_10027564 | 3300003794 | Bacteria | 1988 |
| 43 | Ga0055531_10028782 | 3300003794 | Bacteria | 1907 |
| 44 | Ga0055541_1001734 | 3300003841 | Bacteria | 4589 |
| 45 | Ga0058692_1000004 | 3300003856 | Bacteria | 431119 |
| 46 | Ga0058692_1000078 | 3300003856 | Bacteria | 70873 |
| 47 | Ga0065704_10000512 | 3300005289 | Bacteria | 18867 |
| 48 | Ga0065704_10095357 | 3300005289 | Bacteria | 2490 |
| 49 | Ga0065704_10101678 | 3300005289 | Bacteria | 2229 |
| 50 | Ga0065707_10307730 | 3300005295 | Bacteria | 991 |
| 51 | Ga0070658_10032518 | 3300005327 | Bacteria | 4193 |
| 52 | Ga0070658_10689494 | 3300005327 | Bacteria | 886 |
| 53 | Ga0070690_100119218 | 3300005330 | Bacteria | 1769 |
| 54 | Ga0070670_100005119 | 3300005331 | Bacteria | 11034 |
| 55 | Ga0070670_100122434 | 3300005331 | Bacteria | 2244 |
| 56 | Ga0070677_10092205 | 3300005333 | Bacteria | 1320 |
| 57 | Ga0068869_100244161 | 3300005334 | Bacteria | 1432 |
| 58 | Ga0068869_100593831 | 3300005334 | Bacteria | 934 |
| 59 | Ga0070680_100020213 | 3300005336 | Bacteria | 5283 |
| 60 | Ga0070680_100309086 | 3300005336 | Bacteria | 1341 |
| 61 | Ga0070682_100023544 | 3300005337 | Bacteria | 3657 |
| 62 | Ga0070691_10119784 | 3300005341 | Bacteria | 1324 |
| 63 | Ga0070687_100101169 | 3300005343 | Bacteria | 1614 |
| 64 | Ga0070668_100033588 | 3300005347 | Bacteria | 3907 |
| 65 | Ga0070668_100455252 | 3300005347 | Bacteria | 1101 |
| 66 | Ga0070669_100041021 | 3300005353 | Bacteria | 3365 |
| 67 | Ga0070669_100105619 | 3300005353 | Bacteria | 2131 |
| 68 | Ga0070669_100435435 | 3300005353 | Bacteria | 1078 |
| 69 | Ga0070675_100409438 | 3300005354 | Bacteria | 1211 |
| 70 | Ga0070674_100138049 | 3300005356 | Bacteria | 1826 |
| 71 | Ga0070674_100145557 | 3300005356 | Bacteria | 1783 |
| 72 | Ga0070659_100028080 | 3300005366 | Bacteria | 4342 |
| 73 | Ga0070667_100132112 | 3300005367 | Bacteria | 2180 |
| 74 | Ga0070667_100403941 | 3300005367 | Bacteria | 1244 |
| 75 | Ga0070701_10022043 | 3300005438 | Bacteria | 3050 |
| 76 | Ga0070701_10050921 | 3300005438 | Bacteria | 2147 |
| 77 | Ga0070701_10303542 | 3300005438 | Bacteria | 982 |
| 78 | Ga0070711_100324028 | 3300005439 | Bacteria | 1232 |
| 79 | Ga0070700_100037530 | 3300005441 | Bacteria | 2947 |
| 80 | Ga0070694_100131986 | 3300005444 | Bacteria | 1805 |
| 81 | Ga0070708_100158696 | 3300005445 | Bacteria | 2107 |
| 82 | Ga0070678_100003261 | 3300005456 | Bacteria | 9018 |
| 83 | Ga0070662_100240935 | 3300005457 | Bacteria | 1450 |
| 84 | Ga0068867_100028324 | 3300005459 | Bacteria | 4033 |
| 85 | Ga0068867_100029282 | 3300005459 | Bacteria | 3967 |
| 86 | Ga0068867_100046885 | 3300005459 | Bacteria | 3176 |
| 87 | Ga0070685_10085766 | 3300005466 | Bacteria | 1897 |
| 88 | Ga0068853_100667983 | 3300005539 | Bacteria | 990 |
| 89 | Ga0070672_100019487 | 3300005543 | Bacteria | 4925 |
| 90 | Ga0070695_100451825 | 3300005545 | Bacteria | 985 |
| 91 | Ga0070693_100200953 | 3300005547 | Bacteria | 1294 |
| 92 | Ga0070693_100667432 | 3300005547 | Bacteria | 758 |
| 93 | Ga0070665_100013456 | 3300005548 | Bacteria | 8230 |
| 94 | Ga0070665_100014027 | 3300005548 | Bacteria | 8055 |
| 95 | Ga0070665_100030222 | 3300005548 | Bacteria | 5453 |
| 96 | Ga0070665_100779820 | 3300005548 | Bacteria | 969 |
| 97 | Ga0068855_100732372 | 3300005563 | Unclassified | 1056 |
| 98 | Ga0070664_100076347 | 3300005564 | Bacteria | 2879 |
| 99 | Ga0070664_100445157 | 3300005564 | Bacteria | 1189 |
| 100 | Ga0070664_100720267 | 3300005564 | Bacteria | 930 |
| 101 | Ga0068854_100230445 | 3300005578 | Bacteria | 1470 |
| 102 | Ga0070702_100005549 | 3300005615 | Bacteria | 5892 |
| 103 | Ga0068859_100023611 | 3300005617 | Bacteria | 6172 |
| 104 | Ga0068859_100414821 | 3300005617 | Bacteria | 1443 |
| 105 | Ga0068864_100631335 | 3300005618 | Bacteria | 1042 |
| 106 | Ga0068864_101244522 | 3300005618 | Bacteria | 744 |
| 107 | Ga0068866_10289966 | 3300005718 | Bacteria | 1017 |
| 108 | Ga0068861_100001173 | 3300005719 | Bacteria | 16320 |
| 109 | Ga0068861_100098454 | 3300005719 | Bacteria | 2321 |
| 110 | Ga0068861_100209909 | 3300005719 | Bacteria | 1639 |
| 111 | Ga0068861_100500364 | 3300005719 | Bacteria | 1098 |
| 112 | Ga0068870_10132417 | 3300005840 | Bacteria | 1450 |
| 113 | Ga0068863_100029167 | 3300005841 | Bacteria | 5268 |
| 114 | Ga0068863_100273556 | 3300005841 | Bacteria | 1635 |
| 115 | Ga0068858_100095371 | 3300005842 | Bacteria | 2772 |
| 116 | Ga0068858_100573778 | 3300005842 | Bacteria | 1093 |
| 117 | Ga0068860_100023622 | 3300005843 | Bacteria | 5941 |
| 118 | Ga0068862_100006827 | 3300005844 | Bacteria | 9463 |
| 119 | Ga0068862_100012896 | 3300005844 | Bacteria | 6912 |
| 120 | Ga0068862_100025278 | 3300005844 | Bacteria | 4986 |
| 121 | Ga0068862_100350459 | 3300005844 | Bacteria | 1370 |
| 122 | Ga0081539_10042689 | 3300005985 | Bacteria | 2638 |
| 123 | Ga0075365_10180726 | 3300006038 | Bacteria | 1475 |
| 124 | Ga0075364_10000016 | 3300006051 | Bacteria | 57197 |
| 125 | Ga0075364_10055728 | 3300006051 | Bacteria | 2587 |
| 126 | Ga0075364_10160562 | 3300006051 | Bacteria | 1517 |
| 127 | Ga0075364_10334134 | 3300006051 | Bacteria | 1032 |
| 128 | Ga0075364_10367567 | 3300006051 | Bacteria | 981 |
| 129 | Ga0097621_100075208 | 3300006237 | Bacteria | 2799 |
| 130 | Ga0075370_10214862 | 3300006353 | Bacteria | 1136 |
| 131 | Ga0075431_100090831 | 3300006847 | Bacteria | 3152 |
| 132 | Ga0075434_100956998 | 3300006871 | Bacteria | 871 |
| 133 | Ga0068865_100017043 | 3300006881 | Bacteria | 4663 |
| 134 | Ga0097620_100023611 | 3300006931 | Bacteria | 6172 |
| 135 | Ga0097620_100414822 | 3300006931 | Bacteria | 1443 |
| 136 | Ga0075435_100313412 | 3300007076 | Bacteria | 1343 |
| 137 | Ga0105251_10002543 | 3300009011 | Bacteria | 14182 |
| 138 | Ga0105251_10005401 | 3300009011 | Bacteria | 8362 |
| 139 | Ga0105244_10088545 | 3300009036 | Bacteria | 1524 |
| 140 | Ga0105244_10150248 | 3300009036 | Bacteria | 1116 |
| 141 | Ga0111539_10011289 | 3300009094 | Bacteria | 11221 |
| 142 | Ga0105245_10405214 | 3300009098 | Bacteria | 1364 |
| 143 | Ga0114129_12097022 | 3300009147 | Bacteria | 682 |
| 144 | Ga0105243_10003403 | 3300009148 | Bacteria | 12904 |
| 145 | Ga0105243_10169492 | 3300009148 | Bacteria | 1889 |
| 146 | Ga0105243_10247437 | 3300009148 | Bacteria | 1590 |
| 147 | Ga0105243_10571796 | 3300009148 | Bacteria | 1083 |
| 148 | Ga0105242_10127277 | 3300009176 | Bacteria | 2194 |
| 149 | Ga0105248_10185208 | 3300009177 | Bacteria | 2346 |
| 150 | Ga0105249_10023801 | 3300009553 | Bacteria | 5501 |
| 151 | Ga0157373_10057320 | 3300013100 | Bacteria | 2763 |
| 152 | Ga0157373_10175020 | 3300013100 | Bacteria | 1510 |
| 153 | Ga0157371_10000509 | 3300013102 | Bacteria | 46826 |
| 154 | Ga0157371_10482928 | 3300013102 | Bacteria | 913 |
| 155 | Ga0157370_10011813 | 3300013104 | Bacteria | 9112 |
| 156 | Ga0157370_10016557 | 3300013104 | Bacteria | 7459 |
| 157 | Ga0157370_10339973 | 3300013104 | Bacteria | 1383 |
| 158 | Ga0157369_10098068 | 3300013105 | Bacteria | 3126 |
| 159 | Ga0157378_10673416 | 3300013297 | Bacteria | 1052 |
| 160 | Ga0163162_10000642 | 3300013306 | Bacteria | 32380 |
| 161 | Ga0163162_10196509 | 3300013306 | Bacteria | 2146 |
| 162 | Ga0157372_10481003 | 3300013307 | Bacteria | 1448 |
| 163 | Ga0157372_10492274 | 3300013307 | Bacteria | 1430 |
| 164 | Ga0157375_11045002 | 3300013308 | Bacteria | 955 |
| 165 | Ga0157380_10147002 | 3300014326 | Bacteria | 2032 |
| 166 | Ga0157380_10187258 | 3300014326 | Bacteria | 1824 |
| 167 | Ga0157380_10360227 | 3300014326 | Bacteria | 1364 |
| 168 | Ga0157380_10712528 | 3300014326 | Bacteria | 1010 |
| 169 | Ga0157380_10807638 | 3300014326 | Bacteria | 956 |
| 170 | Ga0157380_11095325 | 3300014326 | Bacteria | 835 |
| 171 | Ga0157380_11298025 | 3300014326 | Bacteria | 775 |
| 172 | Ga0157380_12229879 | 3300014326 | Bacteria | 612 |
| 173 | Ga0157380_12372905 | 3300014326 | Bacteria | 595 |
| 174 | Ga0182008_10001256 | 3300014497 | Bacteria | 17405 |
| 175 | Ga0182008_10002712 | 3300014497 | Bacteria | 10992 |
| 176 | Ga0182006_1010651 | 3300015261 | Bacteria | 4078 |
| 177 | Ga0182006_1018341 | 3300015261 | Bacteria | 2959 |
| 178 | Ga0182006_1045768 | 3300015261 | Bacteria | 1701 |
| 179 | Ga0182006_1060170 | 3300015261 | Bacteria | 1436 |
| 180 | Ga0182007_10000142 | 3300015262 | Bacteria | 47856 |
| 181 | Ga0182005_1000456 | 3300015265 | Bacteria | 21433 |
| 182 | Ga0182005_1002506 | 3300015265 | Bacteria | 6521 |
| 183 | Ga0183360_10003 | 3300015689 | Bacteria | 713221 |
| 184 | Ga0163161_10001916 | 3300017792 | Bacteria | 15193 |
| 185 | Ga0163161_10042753 | 3300017792 | Bacteria | 3261 |
| 186 | Ga0163161_10050069 | 3300017792 | Bacteria | 3022 |
| 187 | Ga0163161_10730226 | 3300017792 | Bacteria | 827 |
| 188 | Ga0163161_10998746 | 3300017792 | Bacteria | 714 |
| 189 | Ga0213872_10034666 | 3300021361 | Bacteria | 2310 |
| 190 | Ga0213871_10001874 | 3300021441 | Bacteria | 3700 |
| 191 | Ga0224712_10126973 | 3300022467 | Bacteria | 1110 |
| 192 | Ga0209784_100452 | 3300025224 | Bacteria | 17499 |
| 193 | Ga0209566_100858 | 3300025225 | Bacteria | 15007 |
| 194 | Ga0209674_100076 | 3300025226 | Bacteria | 210323 |
| 195 | Ga0209563_101746 | 3300025230 | Bacteria | 5474 |
| 196 | Ga0207425_1000074 | 3300025245 | Bacteria | 108738 |
| 197 | Ga0207425_1011909 | 3300025245 | Bacteria | 2057 |
| 198 | Ga0207425_1023126 | 3300025245 | Bacteria | 1303 |
| 199 | Ga0207425_1027643 | 3300025245 | Bacteria | 1156 |
| 200 | Ga0209646_1000043 | 3300025246 | Bacteria | 343652 |
| 201 | Ga0209148_1000162 | 3300025254 | Bacteria | 138642 |
| 202 | Ga0209759_1007897 | 3300025256 | Bacteria | 3367 |
| 203 | Ga0209129_1000150 | 3300025258 | Bacteria | 113886 |
| 204 | Ga0209565_1000002 | 3300025263 | Bacteria | 1423083 |
| 205 | Ga0209565_1000050 | 3300025263 | Bacteria | 213856 |
| 206 | Ga0209673_1000002 | 3300025273 | Bacteria | 1423083 |
| 207 | Ga0209673_1000199 | 3300025273 | Bacteria | 120904 |
| 208 | Ga0209673_1014118 | 3300025273 | Bacteria | 3109 |
| 209 | Ga0209130_1004188 | 3300025284 | Bacteria | 5638 |
| 210 | Ga0209130_1012708 | 3300025284 | Bacteria | 2187 |
| 211 | Ga0209675_1000002 | 3300025291 | Bacteria | 1423083 |
| 212 | Ga0209675_1000007 | 3300025291 | Bacteria | 683430 |
| 213 | Ga0209676_1000018 | 3300025292 | Bacteria | 631385 |
| 214 | Ga0209676_1000052 | 3300025292 | Bacteria | 371539 |
| 215 | Ga0209676_1000168 | 3300025292 | Bacteria | 156042 |
| 216 | Ga0209676_1002246 | 3300025292 | Bacteria | 14279 |
| 217 | Ga0209676_1002770 | 3300025292 | Bacteria | 11705 |
| 218 | Ga0209676_1012232 | 3300025292 | Bacteria | 3393 |
| 219 | Ga0209676_1068063 | 3300025292 | Bacteria | 857 |
| 220 | Ga0209025_1000006 | 3300025294 | Bacteria | 1153444 |
| 221 | Ga0209025_1000048 | 3300025294 | Bacteria | 335574 |
| 222 | Ga0209025_1006331 | 3300025294 | Bacteria | 9231 |
| 223 | Ga0209025_1007416 | 3300025294 | Bacteria | 8190 |
| 224 | Ga0209025_1122811 | 3300025294 | Bacteria | 771 |
| 225 | Ga0209564_1000004 | 3300025295 | Bacteria | 1424639 |
| 226 | Ga0209564_1000061 | 3300025295 | Bacteria | 322795 |
| 227 | Ga0209564_1007457 | 3300025295 | Bacteria | 5645 |
| 228 | Ga0209758_1000056 | 3300025297 | Bacteria | 335574 |
| 229 | Ga0209758_1012351 | 3300025297 | Bacteria | 4791 |
| 230 | Ga0209758_1031408 | 3300025297 | Bacteria | 2178 |
| 231 | Ga0209758_1070105 | 3300025297 | Bacteria | 1108 |
| 232 | Ga0209050_1000382 | 3300025298 | Bacteria | 83595 |
| 233 | Ga0209050_1000424 | 3300025298 | Bacteria | 77803 |
| 234 | Ga0209050_1001351 | 3300025298 | Bacteria | 26975 |
| 235 | Ga0209050_1008173 | 3300025298 | Bacteria | 5662 |
| 236 | Ga0209050_1049812 | 3300025298 | Bacteria | 1070 |
| 237 | Ga0209256_1000004 | 3300025299 | Bacteria | 1424643 |
| 238 | Ga0209256_1001917 | 3300025299 | Bacteria | 19037 |
| 239 | Ga0209256_1004346 | 3300025299 | Bacteria | 8983 |
| 240 | Ga0209256_1004359 | 3300025299 | Bacteria | 8963 |
| 241 | Ga0209051_1001153 | 3300025303 | Bacteria | 24028 |
| 242 | Ga0209051_1009442 | 3300025303 | Bacteria | 5028 |
| 243 | Ga0209257_1000035 | 3300025304 | Bacteria | 631463 |
| 244 | Ga0209257_1000046 | 3300025304 | Bacteria | 477765 |
| 245 | Ga0209257_1000147 | 3300025304 | Bacteria | 194105 |
| 246 | Ga0209257_1000261 | 3300025304 | Bacteria | 121357 |
| 247 | Ga0209257_1002362 | 3300025304 | Bacteria | 18933 |
| 248 | Ga0209257_1007745 | 3300025304 | Bacteria | 6392 |
| 249 | Ga0209257_1013698 | 3300025304 | Bacteria | 3572 |
| 250 | Ga0209257_1028235 | 3300025304 | Bacteria | 1850 |
| 251 | Ga0207655_1056203 | 3300025728 | Bacteria | 1553 |
| 252 | Ga0207655_1065998 | 3300025728 | Bacteria | 1370 |
| 253 | Ga0207713_1002835 | 3300025735 | Bacteria | 12196 |
| 254 | Ga0207713_1010568 | 3300025735 | Bacteria | 5099 |
| 255 | Ga0207642_10011268 | 3300025899 | Bacteria | 3182 |
| 256 | Ga0207680_10618985 | 3300025903 | Bacteria | 775 |
| 257 | Ga0207645_10001976 | 3300025907 | Bacteria | 16474 |
| 258 | Ga0207705_10060700 | 3300025909 | Bacteria | 2731 |
| 259 | Ga0207654_10003591 | 3300025911 | Bacteria | 7842 |
| 260 | Ga0207693_10848888 | 3300025915 | Bacteria | 702 |
| 261 | Ga0207660_10492294 | 3300025917 | Bacteria | 994 |
| 262 | Ga0207660_10629718 | 3300025917 | Bacteria | 874 |
| 263 | Ga0207662_10096692 | 3300025918 | Bacteria | 1825 |
| 264 | Ga0207657_10029127 | 3300025919 | Bacteria | 5031 |
| 265 | Ga0207652_10357870 | 3300025921 | Bacteria | 1317 |
| 266 | Ga0207681_10020993 | 3300025923 | Bacteria | 4145 |
| 267 | Ga0207681_10065932 | 3300025923 | Bacteria | 2505 |
| 268 | Ga0207650_10002184 | 3300025925 | Bacteria | 13667 |
| 269 | Ga0207650_10086120 | 3300025925 | Bacteria | 2392 |
| 270 | Ga0207650_10296549 | 3300025925 | Bacteria | 1319 |
| 271 | Ga0207687_10322955 | 3300025927 | Bacteria | 1250 |
| 272 | Ga0207690_10472844 | 3300025932 | Bacteria | 1010 |
| 273 | Ga0207706_10003669 | 3300025933 | Bacteria | 14656 |
| 274 | Ga0207706_10410077 | 3300025933 | Bacteria | 1174 |
| 275 | Ga0207686_10162912 | 3300025934 | Bacteria | 1565 |
| 276 | Ga0207709_10000528 | 3300025935 | Bacteria | 33221 |
| 277 | Ga0207709_10003695 | 3300025935 | Bacteria | 9012 |
| 278 | Ga0207670_10012308 | 3300025936 | Bacteria | 5000 |
| 279 | Ga0207669_10009378 | 3300025937 | Bacteria | 4658 |
| 280 | Ga0207704_10042105 | 3300025938 | Bacteria | 2685 |
| 281 | Ga0207691_10001458 | 3300025940 | Bacteria | 23567 |
| 282 | Ga0207711_10165234 | 3300025941 | Bacteria | 2006 |
| 283 | Ga0207689_10236613 | 3300025942 | Bacteria | 1509 |
| 284 | Ga0207689_10301321 | 3300025942 | Bacteria | 1328 |
| 285 | Ga0207679_10066842 | 3300025945 | Bacteria | 2695 |
| 286 | Ga0207679_10265781 | 3300025945 | Bacteria | 1465 |
| 287 | Ga0207668_10011240 | 3300025972 | Bacteria | 5434 |
| 288 | Ga0207668_10024806 | 3300025972 | Bacteria | 3874 |
| 289 | Ga0207668_10309289 | 3300025972 | Bacteria | 1307 |
| 290 | Ga0207668_10432999 | 3300025972 | Bacteria | 1119 |
| 291 | Ga0207658_10484093 | 3300025986 | Bacteria | 1100 |
| 292 | Ga0207703_10076136 | 3300026035 | Bacteria | 2783 |
| 293 | Ga0207639_11072175 | 3300026041 | Bacteria | 755 |
| 294 | Ga0207678_10274595 | 3300026067 | Bacteria | 1446 |
| 295 | Ga0207708_10013436 | 3300026075 | Bacteria | 6121 |
| 296 | Ga0207708_10054745 | 3300026075 | Bacteria | 3042 |
| 297 | Ga0207708_10216298 | 3300026075 | Bacteria | 1533 |
| 298 | Ga0207702_10055987 | 3300026078 | Bacteria | 3347 |
| 299 | Ga0207641_10068777 | 3300026088 | Bacteria | 3037 |
| 300 | Ga0207641_10191868 | 3300026088 | Bacteria | 1878 |
| 301 | Ga0207641_10332546 | 3300026088 | Bacteria | 1444 |
| 302 | Ga0207641_10480033 | 3300026088 | Bacteria | 1205 |
| 303 | Ga0207648_10002185 | 3300026089 | Bacteria | 21227 |
| 304 | Ga0207648_10021900 | 3300026089 | Bacteria | 5741 |
| 305 | Ga0207648_10087273 | 3300026089 | Bacteria | 2723 |
| 306 | Ga0207648_11137401 | 3300026089 | Bacteria | 732 |
| 307 | Ga0207676_10553283 | 3300026095 | Bacteria | 1099 |
| 308 | Ga0207675_100001664 | 3300026118 | Bacteria | 22243 |
| 309 | Ga0207675_100002324 | 3300026118 | Bacteria | 18877 |
| 310 | Ga0207675_100004583 | 3300026118 | Bacteria | 13325 |
| 311 | Ga0207675_100021836 | 3300026118 | Bacteria | 5960 |
| 312 | Ga0207675_100345761 | 3300026118 | Bacteria | 1457 |
| 313 | Ga0207683_10008928 | 3300026121 | Bacteria | 8540 |
| 314 | Ga0209371_1000018 | 3300027312 | Bacteria | 614700 |
| 315 | Ga0209371_1000025 | 3300027312 | Bacteria | 450640 |
| 316 | Ga0209982_1020368 | 3300027552 | Bacteria | 1019 |
| 317 | Ga0209983_1003270 | 3300027665 | Bacteria | 3478 |
| 318 | Ga0209971_1003097 | 3300027682 | Bacteria | 3970 |
| 319 | Ga0209998_10002149 | 3300027717 | Bacteria | 4584 |
| 320 | Ga0209974_10013115 | 3300027876 | Bacteria | 2763 |
| 321 | Ga0207428_10591594 | 3300027907 | Bacteria | 800 |
| 322 | Ga0268266_10008586 | 3300028379 | Bacteria | 9073 |
| 323 | Ga0268266_10421701 | 3300028379 | Bacteria | 1264 |
| 324 | Ga0268266_10517271 | 3300028379 | Bacteria | 1141 |
| 325 | Ga0268265_10013033 | 3300028380 | Bacteria | 5645 |
| 326 | Ga0268265_10503311 | 3300028380 | Bacteria | 1142 |
| 327 | Ga0268264_10076290 | 3300028381 | Bacteria | 2851 |
| 328 | Ga0268264_10211888 | 3300028381 | Bacteria | 1779 |
| 329 | Ga0268256_1000016 | 3300030500 | Bacteria | 614700 |
| 330 | Ga0268256_1000027 | 3300030500 | Bacteria | 450640 |
| 331 | Ga0316177_1011446 | 3300030731 | Bacteria | 5474 |
| 332 | Ga0316176_1127381 | 3300030732 | Bacteria | 3510 |
| 333 | Ga0314311_1144405 | 3300030733 | Bacteria | 3264 |
| 334 | Ga0316183_1126505 | 3300030742 | Bacteria | 4946 |
| 335 | Ga0316181_1013001 | 3300030744 | Bacteria | 1016 |
| 336 | Ga0265340_10020325 | 3300031247 | Bacteria | 3413 |
| 337 | Ga0307513_10000429 | 3300031456 | Bacteria | 60815 |
| 338 | Ga0307513_10269691 | 3300031456 | Bacteria | 1486 |
| 339 | Ga0307408_100336657 | 3300031548 | Bacteria | 1276 |
| 340 | Ga0265313_10053216 | 3300031595 | Bacteria | 1928 |
| 341 | Ga0316576_10631419 | 3300031727 | Bacteria | 780 |
| 342 | Ga0307405_10208711 | 3300031731 | Bacteria | 1424 |
| 343 | Ga0307405_10209171 | 3300031731 | Bacteria | 1423 |
| 344 | Ga0307405_10334898 | 3300031731 | Bacteria | 1161 |
| 345 | Ga0307413_10000988 | 3300031824 | Bacteria | 10222 |
| 346 | Ga0307413_10014349 | 3300031824 | Bacteria | 4020 |
| 347 | Ga0307413_10138231 | 3300031824 | Bacteria | 1679 |
| 348 | Ga0307413_10437716 | 3300031824 | Bacteria | 1034 |
| 349 | Ga0307413_10671430 | 3300031824 | Bacteria | 857 |
| 350 | Ga0307410_10024677 | 3300031852 | Bacteria | 3760 |
| 351 | Ga0307406_10046763 | 3300031901 | Bacteria | 2724 |
| 352 | Ga0307407_10087701 | 3300031903 | Bacteria | 1899 |
| 353 | Ga0307412_10005903 | 3300031911 | Bacteria | 6896 |
| 354 | Ga0307412_10200107 | 3300031911 | Bacteria | 1516 |
| 355 | Ga0307412_10210209 | 3300031911 | Bacteria | 1484 |
| 356 | Ga0307412_10328376 | 3300031911 | Bacteria | 1220 |
| 357 | Ga0307409_100028513 | 3300031995 | Bacteria | 3979 |
| 358 | Ga0307409_101231822 | 3300031995 | Bacteria | 772 |
| 359 | Ga0307416_100027413 | 3300032002 | Bacteria | 4218 |
| 360 | Ga0307416_100213906 | 3300032002 | Bacteria | 1842 |
| 361 | Ga0307416_100257492 | 3300032002 | Bacteria | 1703 |
| 362 | Ga0307416_100360964 | 3300032002 | Bacteria | 1475 |
| 363 | Ga0307416_100761670 | 3300032002 | Bacteria | 1061 |
| 364 | Ga0307414_10013082 | 3300032004 | Bacteria | 4930 |
| 365 | Ga0307414_10014535 | 3300032004 | Bacteria | 4724 |
| 366 | Ga0307414_10023786 | 3300032004 | Bacteria | 3893 |
| 367 | Ga0307414_10024265 | 3300032004 | Bacteria | 3864 |
| 368 | Ga0307414_10042335 | 3300032004 | Bacteria | 3093 |
| 369 | Ga0307414_10093508 | 3300032004 | Bacteria | 2241 |
| 370 | Ga0307414_10110862 | 3300032004 | Bacteria | 2088 |
| 371 | Ga0307414_10129121 | 3300032004 | Bacteria | 1958 |
| 372 | Ga0307414_10231284 | 3300032004 | Bacteria | 1524 |
| 373 | Ga0307414_10276667 | 3300032004 | Bacteria | 1408 |
| 374 | Ga0307414_10516957 | 3300032004 | Bacteria | 1059 |
| 375 | Ga0307414_10661998 | 3300032004 | Bacteria | 942 |
| 376 | Ga0307411_10017098 | 3300032005 | Bacteria | 4121 |
| 377 | Ga0307411_10295281 | 3300032005 | Bacteria | 1297 |
| 378 | Ga0307415_100010718 | 3300032126 | Bacteria | 5206 |
| 379 | Ga0307415_100851999 | 3300032126 | Bacteria | 836 |
| 380 | Ga0316574_0055569 | 3300035398 | Bacteria | 2474 |
| 381 | Ga0395900_0003560 | 3300037418 | Bacteria | 16750 |
| 382 | Ga0395905_0002540 | 3300037471 | Bacteria | 20135 |
| 383 | Ga0395905_0026642 | 3300037471 | Bacteria | 5451 |
| 384 | Ga0436364_0679110 | 3300037853 | Bacteria | 1766 |
| 385 | Ga0237819_02706 | 3300038705 | Bacteria | 3423 |
| 386 | Ga0400485_20806 | 3300038735 | Bacteria | 11157 |
| 387 | Ga0400486_26303 | 3300038742 | Bacteria | 6112 |
| 388 | Ga0400483_059047 | 3300039062 | Bacteria | 9494 |
| 389 | Ga0400489_95599 | 3300039093 | Bacteria | 23383 |
| 390 | Ga0400487_59073 | 3300039110 | Bacteria | 6398 |
| 391 | Ga0436360_0303389 | 3300039438 | Bacteria | 30232 |
| 392 | Ga0436360_0521760 | 3300039438 | Bacteria | 518 |
| 393 | Ga0436360_0941386 | 3300039438 | Bacteria | 976 |
| 394 | Ga0436361_0524379 | 3300039447 | Bacteria | 7028 |
| 395 | Ga0436363_0422774 | 3300039450 | Bacteria | 937 |
| 396 | Ga0436363_1434014 | 3300039450 | Bacteria | 2134 |
| 397 | Ga0436362_0256845 | 3300039453 | Bacteria | 770 |
| 398 | Ga0436362_0872713 | 3300039453 | Bacteria | 10063 |
| 399 | Ga0439436_0019829 | 3300041404 | Bacteria | 2005 |
| 400 | Ga0439436_0031686 | 3300041404 | Bacteria | 1534 |
| 401 | Ga0439436_0049564 | 3300041404 | Bacteria | 1190 |
| 402 | Ga0439447_000492 | 3300041407 | Bacteria | 14679 |
| 403 | Ga0439465_0000375 | 3300041413 | Bacteria | 12836 |
| 404 | Ga0439465_0000617 | 3300041413 | Bacteria | 10808 |
| 405 | Ga0439465_0014660 | 3300041413 | Bacteria | 2443 |
| 406 | Ga0439465_0056714 | 3300041413 | Bacteria | 1291 |
| 407 | Ga0451789_0970999 | 3300041443 | Bacteria | 1489 |
| 408 | Ga0451791_1017899 | 3300041451 | Bacteria | 1547 |
| 409 | Ga0451793_1242350 | 3300041452 | Bacteria | 2420 |
| 410 | Ga0451793_1699778 | 3300041452 | Bacteria | 3082 |
| 411 | Ga0451797_1448458 | 3300041453 | Bacteria | 3706 |
| 412 | Ga0451800_0326087 | 3300041459 | Bacteria | 2968 |
| 413 | Ga0451802_0157001 | 3300041460 | Bacteria | 684 |
| 414 | Ga0451802_0874384 | 3300041460 | Bacteria | 2099 |
| 415 | Ga0451806_205037 | 3300041462 | Bacteria | 2586 |
| 416 | Ga0451804_0675874 | 3300041463 | Bacteria | 1979 |
| 417 | Ga0451807_1218172 | 3300041486 | Bacteria | 2883 |
| 418 | Ga0451833_0862655 | 3300041491 | Bacteria | 879 |
| 419 | Ga0451837_1270090 | 3300041494 | Bacteria | 2500 |
| 420 | Ga0451839_0227527 | 3300041496 | Bacteria | 760 |
| 421 | Ga0451843_0025158 | 3300041509 | Bacteria | 1877 |
| 422 | Ga0439431_0007467 | 3300041997 | Bacteria | 2439 |
| 423 | Ga0439431_0034730 | 3300041997 | Bacteria | 1265 |
| 424 | Ga0439433_0006452 | 3300041999 | Bacteria | 2524 |
| 425 | Ga0439433_0017301 | 3300041999 | Bacteria | 1600 |
| 426 | Ga0439445_0000472 | 3300042004 | Bacteria | 8181 |
| 427 | Ga0439432_005050 | 3300042006 | Bacteria | 4770 |
| 428 | Ga0439432_048759 | 3300042006 | Bacteria | 1325 |
| 429 | Ga0439449_0000016 | 3300042007 | Bacteria | 49059 |
| 430 | Ga0439449_0007148 | 3300042007 | Bacteria | 4248 |
| 431 | Ga0439449_0012977 | 3300042007 | Bacteria | 3133 |
| 432 | Ga0439449_0033248 | 3300042007 | Bacteria | 1921 |
| 433 | Ga0439449_0043301 | 3300042007 | Bacteria | 1671 |
| 434 | Ga0450911_001075 | 3300042115 | Bacteria | 6884 |
| 435 | Ga0450894_046905 | 3300042131 | Bacteria | 630 |
| 436 | Ga0450906_018587 | 3300042145 | Bacteria | 1247 |
| 437 | Ga0439446_0082606 | 3300042156 | Bacteria | 997 |
| 438 | Ga0439464_0050872 | 3300042439 | Bacteria | 1198 |
| 439 | Ga0439440_0010694 | 3300042993 | Bacteria | 1923 |
| 440 | Ga0439440_0032406 | 3300042993 | Bacteria | 1241 |
| 441 | Ga0466966_0124048 | 3300044684 | Bacteria | 1585 |
| 442 | Ga0495627_012925 | 3300046453 | Bacteria | 2947 |
| 443 | Ga0495590_0002699 | 3300046457 | Bacteria | 7332 |
| 444 | Ga0495638_0002077 | 3300046460 | Bacteria | 17009 |
| 445 | Ga0495638_0018520 | 3300046460 | Bacteria | 4623 |
| 446 | Ga0495638_0026208 | 3300046460 | Bacteria | 3781 |
| 447 | Ga0495638_0060323 | 3300046460 | Bacteria | 2347 |
| 448 | Ga0495638_0087513 | 3300046460 | Bacteria | 1882 |
| 449 | Ga0495605_0154667 | 3300046474 | Bacteria | 1021 |
| 450 | Ga0495607_0006816 | 3300046501 | Bacteria | 7973 |
| 451 | Ga0495610_0003143 | 3300046512 | Bacteria | 13114 |
| 452 | Ga0495610_0052050 | 3300046512 | Bacteria | 1989 |
| 453 | Ga0495616_0033813 | 3300046513 | Bacteria | 2660 |
| 454 | Ga0495616_0070639 | 3300046513 | Bacteria | 1690 |
| 455 | Ga0495630_0325491 | 3300046517 | Bacteria | 1175 |
| 456 | Ga0495631_0001419 | 3300046518 | Bacteria | 14555 |
| 457 | Ga0495632_0063089 | 3300046519 | Bacteria | 1795 |
| 458 | Ga0495632_0122409 | 3300046519 | Bacteria | 1215 |
| 459 | Ga0495643_0001536 | 3300046522 | Bacteria | 20716 |
| 460 | Ga0495643_0070612 | 3300046522 | Bacteria | 1834 |
| 461 | Ga0495648_0314218 | 3300046524 | Bacteria | 729 |
| 462 | Ga0495663_0003689 | 3300046525 | Bacteria | 4383 |
| 463 | Ga0495663_0016003 | 3300046525 | Bacteria | 2118 |
| 464 | Ga0495663_0021410 | 3300046525 | Bacteria | 1862 |
| 465 | Ga0495663_0083384 | 3300046525 | Bacteria | 1032 |
| 466 | Ga0495663_0090594 | 3300046525 | Bacteria | 996 |
| 467 | Ga0495654_0304575 | 3300046530 | Unclassified | 650 |
| 468 | Ga0495586_0050033 | 3300046535 | Bacteria | 2260 |
| 469 | Ga0495598_0002739 | 3300046537 | Bacteria | 3659 |
| 470 | Ga0495633_0001972 | 3300046558 | Bacteria | 14877 |
| 471 | Ga0495633_0011609 | 3300046558 | Bacteria | 4738 |
| 472 | Ga0495633_0089362 | 3300046558 | Bacteria | 1432 |
| 473 | Ga0495633_0095109 | 3300046558 | Bacteria | 1384 |
| 474 | Ga0495656_0002680 | 3300046615 | Bacteria | 5944 |
| 475 | Ga0495668_0000951 | 3300046616 | Bacteria | 32160 |
| 476 | Ga0495625_0058494 | 3300046660 | Bacteria | 2739 |
| 477 | Ga0495625_0106805 | 3300046660 | Bacteria | 1916 |
| 478 | Ga0495658_0014564 | 3300046683 | Bacteria | 4022 |
| 479 | Ga0495670_0028250 | 3300046691 | Bacteria | 2781 |
| 480 | Ga0495671_0002955 | 3300046692 | Bacteria | 10574 |
| 481 | Ga0495649_0286783 | 3300046694 | Bacteria | 840 |
| 482 | Ga0495660_0002707 | 3300046810 | Bacteria | 11190 |
| 483 | Ga0495636_0004551 | 3300047318 | Bacteria | 5432 |
| 484 | Ga0495636_0019822 | 3300047318 | Bacteria | 2705 |
| 485 | Ga0495672_0001653 | 3300047320 | Bacteria | 21663 |
| 486 | Ga0495672_0078637 | 3300047320 | Bacteria | 1844 |
| 487 | Ga0495685_002200 | 3300047447 | Bacteria | 6066 |
| 488 | Ga0495681_0034282 | 3300047470 | Bacteria | 2531 |
| 489 | Ga0495686_0002109 | 3300047472 | Bacteria | 19488 |
| 490 | Ga0495686_0339575 | 3300047472 | Bacteria | 819 |
| 491 | Ga0496100_0793735 | 3300048903 | Bacteria | 742 |
| 492 | Ga0496101_0141005 | 3300048904 | Bacteria | 1837 |
| 493 | Ga0496102_0641756 | 3300048905 | Bacteria | 985 |
| 494 | Ga0496105_0046263 | 3300048908 | Bacteria | 3591 |
| 495 | Ga0496109_0216750 | 3300048912 | Bacteria | 1800 |
| 496 | Ga0496109_0386696 | 3300048912 | Bacteria | 1322 |
| 497 | Ga0496109_1025904 | 3300048912 | Bacteria | 762 |
| 498 | Ga0496113_0203922 | 3300048916 | Bacteria | 1572 |
| 499 | Ga0496114_0006644 | 3300048917 | Bacteria | 9113 |
| 500 | Ga0496116_0004127 | 3300048919 | Bacteria | 13996 |
| 501 | Ga0496116_0038194 | 3300048919 | Bacteria | 3337 |
| 502 | Ga0496117_0001057 | 3300048920 | Bacteria | 42009 |
| 503 | Ga0496117_0003169 | 3300048920 | Bacteria | 19552 |
| 504 | Ga0496117_0003395 | 3300048920 | Bacteria | 18532 |
| 505 | Ga0496117_0059763 | 3300048920 | Bacteria | 2630 |
| 506 | Ga0496117_0103856 | 3300048920 | Bacteria | 1790 |
| 507 | Ga0496118_0000661 | 3300048921 | Bacteria | 56425 |
| 508 | Ga0496118_0003383 | 3300048921 | Bacteria | 20155 |
| 509 | Ga0496118_0007411 | 3300048921 | Bacteria | 11641 |
| 510 | Ga0496118_0011181 | 3300048921 | Bacteria | 8787 |
| 511 | Ga0496118_0146826 | 3300048921 | Bacteria | 1483 |
| 512 | Ga0496119_0000192 | 3300048922 | Bacteria | 85787 |
| 513 | Ga0496119_0002158 | 3300048922 | Bacteria | 22096 |
| 514 | Ga0496119_0004988 | 3300048922 | Bacteria | 12956 |
| 515 | Ga0496120_0001184 | 3300048923 | Bacteria | 33176 |
| 516 | Ga0496120_0002178 | 3300048923 | Bacteria | 20782 |
| 517 | Ga0496121_0002087 | 3300048924 | Bacteria | 31540 |
| 518 | Ga0496121_0005214 | 3300048924 | Bacteria | 16838 |
| 519 | Ga0496121_0036564 | 3300048924 | Bacteria | 4374 |
| 520 | Ga0496121_0132836 | 3300048924 | Bacteria | 1859 |
| 521 | Ga0496122_0001623 | 3300048925 | Bacteria | 35103 |
| 522 | Ga0496122_0002776 | 3300048925 | Bacteria | 24122 |
| 523 | Ga0496122_0004567 | 3300048925 | Bacteria | 17062 |
| 524 | Ga0496122_0006518 | 3300048925 | Bacteria | 13369 |
| 525 | Ga0496122_0011939 | 3300048925 | Bacteria | 8720 |
| 526 | Ga0496122_0018455 | 3300048925 | Bacteria | 6443 |
| 527 | Ga0496122_0048968 | 3300048925 | Bacteria | 3243 |
| 528 | Ga0496123_0001282 | 3300048926 | Bacteria | 35895 |
| 529 | Ga0496123_0002342 | 3300048926 | Bacteria | 23773 |
| 530 | Ga0496123_0003872 | 3300048926 | Bacteria | 16282 |
| 531 | Ga0496123_0017574 | 3300048926 | Bacteria | 5744 |
| 532 | Ga0496123_0036629 | 3300048926 | Bacteria | 3476 |
| 533 | Ga0496123_0039932 | 3300048926 | Bacteria | 3277 |
| 534 | Ga0496123_0141990 | 3300048926 | Bacteria | 1311 |
| 535 | Ga0496123_0144176 | 3300048926 | Bacteria | 1296 |
| 536 | Ga0496124_0000006 | 3300048927 | Bacteria | 904259 |
| 537 | Ga0496124_0002117 | 3300048927 | Bacteria | 26727 |
| 538 | Ga0496124_0002767 | 3300048927 | Bacteria | 22294 |
| 539 | Ga0496124_0004759 | 3300048927 | Bacteria | 15630 |
| 540 | Ga0496124_0006154 | 3300048927 | Bacteria | 13165 |
| 541 | Ga0496124_0008856 | 3300048927 | Bacteria | 10448 |
| 542 | Ga0496124_0016163 | 3300048927 | Bacteria | 7114 |
| 543 | Ga0496124_0019984 | 3300048927 | Bacteria | 6208 |
| 544 | Ga0496125_0005651 | 3300048928 | Bacteria | 13801 |
| 545 | Ga0496125_0017000 | 3300048928 | Bacteria | 6954 |
| 546 | Ga0496125_0033097 | 3300048928 | Bacteria | 4580 |
| 547 | Ga0496125_0036821 | 3300048928 | Bacteria | 4263 |
| 548 | Ga0496125_0100131 | 3300048928 | Bacteria | 2137 |
| 549 | Ga0496125_0172361 | 3300048928 | Bacteria | 1452 |
| 550 | Ga0496126_0005622 | 3300048929 | Bacteria | 14253 |
| 551 | Ga0496126_0008005 | 3300048929 | Bacteria | 11474 |
| 552 | Ga0496126_0234937 | 3300048929 | Bacteria | 1534 |
| 553 | Ga0501307_026680 | 3300049162 | Bacteria | 782 |
| 554 | Ga0501031_0212793 | 3300049568 | Bacteria | 1259 |
| 555 | Ga0501032_0067090 | 3300049569 | Bacteria | 2397 |
| 556 | Ga0501033_0097370 | 3300049570 | Bacteria | 2149 |
| 557 | Ga0501034_0000192 | 3300049571 | Bacteria | 115486 |
| 558 | Ga0501034_0003141 | 3300049571 | Bacteria | 19011 |
| 559 | Ga0501034_0008435 | 3300049571 | Bacteria | 10886 |
| 560 | Ga0501034_0184804 | 3300049571 | Bacteria | 2048 |
| 561 | Ga0501034_0204364 | 3300049571 | Bacteria | 1932 |
| 562 | Ga0501034_0308524 | 3300049571 | Bacteria | 1517 |
| 563 | Ga0501034_1054239 | 3300049571 | Bacteria | 695 |
| 564 | Ga0501036_0050271 | 3300049572 | Bacteria | 3530 |
| 565 | Ga0501036_0199942 | 3300049572 | Bacteria | 1681 |
| 566 | Ga0501037_0027307 | 3300049573 | Bacteria | 4218 |
| 567 | Ga0501037_0164402 | 3300049573 | Bacteria | 1581 |
| 568 | Ga0501038_0062095 | 3300049574 | Bacteria | 3193 |
| 569 | Ga0501038_0083910 | 3300049574 | Bacteria | 2681 |
| 570 | Ga0501038_0365905 | 3300049574 | Bacteria | 1121 |
| 571 | Ga0501039_0160997 | 3300049575 | Bacteria | 1764 |
| 572 | Ga0501039_0285648 | 3300049575 | Bacteria | 1297 |
| 573 | Ga0501043_0151626 | 3300049579 | Bacteria | 1814 |
| 574 | Ga0501047_0000530 | 3300049581 | Bacteria | 41265 |
| 575 | Ga0501047_0001922 | 3300049581 | Bacteria | 19965 |
| 576 | Ga0501047_0181848 | 3300049581 | Bacteria | 1969 |
| 577 | Ga0501067_0000246 | 3300049583 | Bacteria | 29961 |
| 578 | Ga0501068_0100438 | 3300049584 | Bacteria | 1793 |
| 579 | Ga0501069_0001146 | 3300049585 | Bacteria | 12815 |
| 580 | Ga0501070_0003602 | 3300049586 | Bacteria | 13395 |
| 581 | Ga0501070_0010276 | 3300049586 | Bacteria | 7914 |
| 582 | Ga0501070_0976115 | 3300049586 | Bacteria | 658 |
| 583 | Ga0501072_0000311 | 3300049588 | Bacteria | 34577 |
| 584 | Ga0501073_0011567 | 3300049589 | Bacteria | 6453 |
| 585 | Ga0501073_0174141 | 3300049589 | Bacteria | 1489 |
| 586 | Ga0501074_0003929 | 3300049590 | Bacteria | 10592 |
| 587 | Ga0501074_0024799 | 3300049590 | Bacteria | 4356 |
| 588 | Ga0501257_009998 | 3300049686 | Bacteria | 2148 |
| 589 | Ga0501079_0002396 | 3300049741 | Bacteria | 13591 |
| 590 | Ga0501080_0007973 | 3300049742 | Bacteria | 9597 |
| 591 | Ga0501080_0008098 | 3300049742 | Bacteria | 9524 |
| 592 | Ga0501080_0088508 | 3300049742 | Bacteria | 2876 |
| 593 | Ga0501083_0000540 | 3300049744 | Bacteria | 24122 |
| 594 | Ga0501035_0033403 | 3300049822 | Bacteria | 4679 |
| 595 | Ga0501035_0204255 | 3300049822 | Bacteria | 1693 |
| 596 | Ga0501035_0563007 | 3300049822 | Bacteria | 932 |
| 597 | Ga0501044_0002948 | 3300049823 | Bacteria | 19352 |
| 598 | Ga0501044_0102705 | 3300049823 | Bacteria | 2874 |
| 599 | Ga0501044_0418440 | 3300049823 | Bacteria | 1250 |
| 600 | Ga0501045_0155248 | 3300049824 | Bacteria | 1703 |
| 601 | nmdc:mga00v17_1192_c1 | 3300050491 | Bacteria | 6692 |
| 602 | nmdc:mga07m45_423425_c1 | 3300050496 | Bacteria | 772 |
| 603 | nmdc:mga0qj67_667589_c1 | 3300050509 | Bacteria | 829 |
| 604 | nmdc:mga06r32_755050_c1 | 3300050510 | Bacteria | 936 |
| 605 | nmdc:mga08y16_581492_c1 | 3300050511 | Bacteria | 1131 |
| 606 | nmdc:mga08y16_658569_c1 | 3300050511 | Bacteria | 1050 |
| 607 | Ga0500644_0025886 | 3300053088 | Bacteria | 1811 |
| 608 | Ga0500634_0000139 | 3300053161 | Bacteria | 26249 |
| 609 | Ga0500634_0061963 | 3300053161 | Bacteria | 1983 |
| 610 | Ga0500611_081125 | 3300053727 | Bacteria | 810 |
| 611 | Ga0500565_000076 | 3300053734 | Bacteria | 4724 |
| 612 | Ga0501084_0083639 | 3300054114 | Bacteria | 2679 |
| 613 | Ga0501082_0019471 | 3300060353 | Bacteria | 5851 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039438 | Ga0436360_0521760 | Ga0436360_0521760_15_473 | 150 |
| 2 | 3300037418 | Ga0395900_0003560 | Ga0395900_0003560_101_595 | 161 |
| 3 | 3300037471 | Ga0395905_0026642 | Ga0395905_0026642_3901_4395 | 161 |
| 4 | iso_pu_bacteria | 2911138879 | 2911139432 | 162 |
| 5 | 3300031731 | Ga0307405_10334898 | Ga0307405_103348982 | 163 |
| 6 | 3300032002 | Ga0307416_100761670 | Ga0307416_1007616702 | 163 |
| 7 | 3300005295 | Ga0065707_10307730 | Ga0065707_103077301 | 164 |
| 8 | 3300005331 | Ga0070670_100122434 | Ga0070670_1001224342 | 164 |
| 9 | 3300005354 | Ga0070675_100409438 | Ga0070675_1004094381 | 164 |
| 10 | 3300005367 | Ga0070667_100403941 | Ga0070667_1004039412 | 164 |
| 11 | 3300005563 | Ga0068855_100732372 | Ga0068855_1007323722 | 164 |
| 12 | 3300005564 | Ga0070664_100720267 | Ga0070664_1007202671 | 164 |
| 13 | 3300005618 | Ga0068864_101244522 | Ga0068864_1012445221 | 164 |
| 14 | 3300005841 | Ga0068863_100273556 | Ga0068863_1002735562 | 164 |
| 15 | 3300005842 | Ga0068858_100573778 | Ga0068858_1005737781 | 164 |
| 16 | 3300005844 | Ga0068862_100025278 | Ga0068862_1000252782 | 164 |
| 17 | 3300009177 | Ga0105248_10185208 | Ga0105248_101852083 | 164 |
| 18 | 3300014326 | Ga0157380_12372905 | Ga0157380_123729051 | 164 |
| 19 | 3300025925 | Ga0207650_10296549 | Ga0207650_102965492 | 164 |
| 20 | 3300025941 | Ga0207711_10165234 | Ga0207711_101652342 | 164 |
| 21 | 3300025986 | Ga0207658_10484093 | Ga0207658_104840931 | 164 |
| 22 | 3300026088 | Ga0207641_10191868 | Ga0207641_101918682 | 164 |
| 23 | 3300026118 | Ga0207675_100345761 | Ga0207675_1003457612 | 164 |
| 24 | 3300031727 | Ga0316576_10631419 | Ga0316576_106314191 | 164 |
| 25 | 3300050511 | nmdc:mga08y16_658569_c1 | nmdc:mga08y16_658569_c1_357_860 | 164 |
| 26 | 3300013104 | Ga0157370_10016557 | Ga0157370_100165575 | 165 |
| 27 | 3300013104 | Ga0157370_10339973 | Ga0157370_103399731 | 165 |
| 28 | 3300025911 | Ga0207654_10003591 | Ga0207654_100035912 | 165 |
| 29 | 3300049571 | Ga0501034_0003141 | Ga0501034_0003141_3193_3690 | 165 |
| 30 | 3300049571 | Ga0501034_0184804 | Ga0501034_0184804_1286_1783 | 165 |
| 31 | 3300049571 | Ga0501034_0308524 | Ga0501034_0308524_755_1252 | 165 |
| 32 | 3300049572 | Ga0501036_0050271 | Ga0501036_0050271_1355_1852 | 165 |
| 33 | 3300049573 | Ga0501037_0027307 | Ga0501037_0027307_718_1215 | 165 |
| 34 | 3300049573 | Ga0501037_0164402 | Ga0501037_0164402_965_1462 | 165 |
| 35 | 3300049574 | Ga0501038_0083910 | Ga0501038_0083910_1454_1951 | 165 |
| 36 | 3300049575 | Ga0501039_0285648 | Ga0501039_0285648_73_570 | 165 |
| 37 | 3300049581 | Ga0501047_0000530 | Ga0501047_0000530_25363_25860 | 165 |
| 38 | 3300049581 | Ga0501047_0001922 | Ga0501047_0001922_14657_15154 | 165 |
| 39 | 3300049583 | Ga0501067_0000246 | Ga0501067_0000246_27010_27507 | 165 |
| 40 | 3300049584 | Ga0501068_0100438 | Ga0501068_0100438_79_576 | 165 |
| 41 | 3300049585 | Ga0501069_0001146 | Ga0501069_0001146_1681_2178 | 165 |
| 42 | 3300049586 | Ga0501070_0003602 | Ga0501070_0003602_2597_3094 | 165 |
| 43 | 3300049586 | Ga0501070_0010276 | Ga0501070_0010276_266_763 | 165 |
| 44 | 3300049588 | Ga0501072_0000311 | Ga0501072_0000311_13728_14225 | 165 |
| 45 | 3300049589 | Ga0501073_0011567 | Ga0501073_0011567_3223_3720 | 165 |
| 46 | 3300049589 | Ga0501073_0174141 | Ga0501073_0174141_738_1235 | 165 |
| 47 | 3300049590 | Ga0501074_0003929 | Ga0501074_0003929_872_1369 | 165 |
| 48 | 3300049590 | Ga0501074_0024799 | Ga0501074_0024799_257_754 | 165 |
| 49 | 3300049741 | Ga0501079_0002396 | Ga0501079_0002396_11910_12407 | 165 |
| 50 | 3300049742 | Ga0501080_0007973 | Ga0501080_0007973_883_1380 | 165 |
| 51 | 3300049742 | Ga0501080_0008098 | Ga0501080_0008098_3193_3690 | 165 |
| 52 | 3300049742 | Ga0501080_0088508 | Ga0501080_0088508_266_763 | 165 |
| 53 | 3300049744 | Ga0501083_0000540 | Ga0501083_0000540_13467_13964 | 165 |
| 54 | 3300049822 | Ga0501035_0204255 | Ga0501035_0204255_1014_1511 | 165 |
| 55 | 3300049822 | Ga0501035_0563007 | Ga0501035_0563007_419_916 | 165 |
| 56 | 3300049823 | Ga0501044_0002948 | Ga0501044_0002948_2734_3231 | 165 |
| 57 | 3300049823 | Ga0501044_0418440 | Ga0501044_0418440_477_974 | 165 |
| 58 | 3300054114 | Ga0501084_0083639 | Ga0501084_0083639_1821_2318 | 165 |
| 59 | 3300013306 | Ga0163162_10000642 | Ga0163162_1000064213 | 166 |
| 60 | 3300014326 | Ga0157380_11095325 | Ga0157380_110953252 | 166 |
| 61 | iso_pu_bacteria | 2576861471 | 2578456812 | 166 |
| 62 | iso_pu_bacteria | 2643221579 | 2643906573 | 166 |
| 63 | iso_pu_bacteria | 2643221581 | 2643913913 | 166 |
| 64 | iso_pu_bacteria | 2643221593 | 2643973641 | 166 |
| 65 | iso_pu_bacteria | 2747842428 | 2747951098 | 166 |
| 66 | iso_pu_bacteria | 2747842501 | 2748017605 | 166 |
| 67 | iso_pu_bacteria | 2765235840 | 2765580691 | 166 |
| 68 | iso_pu_bacteria | 2816332141 | 2816518300 | 166 |
| 69 | iso_pu_bacteria | 2818991457 | 2819661498 | 166 |
| 70 | iso_pu_bacteria | 2842391507 | 2842395060 | 166 |
| 71 | iso_pu_bacteria | 2842757796 | 2842760701 | 166 |
| 72 | iso_pu_bacteria | 2842780639 | 2842782451 | 166 |
| 73 | iso_pu_bacteria | 2852649853 | 2852651972 | 166 |
| 74 | iso_pu_bacteria | 2852684882 | 2852687390 | 166 |
| 75 | iso_pu_bacteria | 2857442823 | 2857444328 | 166 |
| 76 | iso_pu_bacteria | 2874220319 | 2874223353 | 166 |
| 77 | iso_pu_bacteria | 2895498888 | 2895502864 | 166 |
| 78 | iso_pu_bacteria | 2895511927 | 2895512906 | 166 |
| 79 | iso_pu_bacteria | 2895522137 | 2895522914 | 166 |
| 80 | iso_pu_bacteria | 2895525241 | 2895525313 | 166 |
| 81 | iso_pu_bacteria | 2919089067 | 2919092425 | 166 |
| 82 | iso_pu_bacteria | 2919130084 | 2919130799 | 166 |
| 83 | iso_pu_bacteria | 2919134579 | 2919137141 | 166 |
| 84 | iso_pu_bacteria | 2923516293 | 2923516380 | 166 |
| 85 | iso_pu_bacteria | 2928496128 | 2928499956 | 166 |
| 86 | iso_pu_bacteria | 2929195423 | 2929196026 | 166 |
| 87 | iso_pu_bacteria | 2931380184 | 2931383227 | 166 |
| 88 | iso_pu_bacteria | 2937610967 | 2937614177 | 166 |
| 89 | iso_pu_bacteria | 2939589442 | 2939589981 | 166 |
| 90 | iso_pu_bacteria | 2939622612 | 2939624362 | 166 |
| 91 | iso_pu_bacteria | 2939626828 | 2939629301 | 166 |
| 92 | iso_pu_bacteria | 2941475908 | 2941478606 | 166 |
| 93 | iso_pu_bacteria | 2941489479 | 2941491195 | 166 |
| 94 | iso_pu_bacteria | 2961047084 | 2961050117 | 166 |
| 95 | iso_pu_bacteria | 2961064222 | 2961064741 | 166 |
| 96 | iso_pu_bacteria | 2974307012 | 2974307419 | 166 |
| 97 | iso_pu_bacteria | 2977247770 | 2977248166 | 166 |
| 98 | iso_pu_bacteria | 2984514374 | 2984517378 | 166 |
| 99 | iso_pu_bacteria | 2987605356 | 2987609040 | 166 |
| 100 | iso_pu_bacteria | 2995948881 | 2995953720 | 166 |
| 101 | iso_pu_bacteria | 8003014200 | 8003017773 | 166 |
| 102 | iso_pu_bacteria | 8021622325 | 8021625963 | 166 |
| 103 | iso_pu_bacteria | 8021648035 | 8021652077 | 166 |
| 104 | 3300001976 | JGI24752J21851_1016343 | JGI24752J21851_10163432 | 167 |
| 105 | 3300001979 | JGI24740J21852_10002686 | JGI24740J21852_100026865 | 167 |
| 106 | 3300002705 | JGI25156J39149_1018662 | JGI25156J39149_10186622 | 167 |
| 107 | 3300002738 | JGI25154J39366_1000483 | JGI25154J39366_100048312 | 167 |
| 108 | 3300003752 | Ga0055539_1012272 | Ga0055539_10122722 | 167 |
| 109 | 3300003756 | Ga0055533_1001999 | Ga0055533_10019992 | 167 |
| 110 | 3300003762 | Ga0055542_1000850 | Ga0055542_10008505 | 167 |
| 111 | 3300003762 | Ga0055542_1001034 | Ga0055542_10010348 | 167 |
| 112 | 3300003841 | Ga0055541_1001734 | Ga0055541_10017341 | 167 |
| 113 | 3300005327 | Ga0070658_10032518 | Ga0070658_100325183 | 167 |
| 114 | 3300005327 | Ga0070658_10689494 | Ga0070658_106894942 | 167 |
| 115 | 3300005330 | Ga0070690_100119218 | Ga0070690_1001192182 | 167 |
| 116 | 3300005333 | Ga0070677_10092205 | Ga0070677_100922051 | 167 |
| 117 | 3300005334 | Ga0068869_100244161 | Ga0068869_1002441612 | 167 |
| 118 | 3300005334 | Ga0068869_100593831 | Ga0068869_1005938311 | 167 |
| 119 | 3300005336 | Ga0070680_100020213 | Ga0070680_1000202131 | 167 |
| 120 | 3300005337 | Ga0070682_100023544 | Ga0070682_1000235443 | 167 |
| 121 | 3300005341 | Ga0070691_10119784 | Ga0070691_101197842 | 167 |
| 122 | 3300005343 | Ga0070687_100101169 | Ga0070687_1001011692 | 167 |
| 123 | 3300005353 | Ga0070669_100041021 | Ga0070669_1000410213 | 167 |
| 124 | 3300005356 | Ga0070674_100138049 | Ga0070674_1001380491 | 167 |
| 125 | 3300005366 | Ga0070659_100028080 | Ga0070659_1000280804 | 167 |
| 126 | 3300005438 | Ga0070701_10022043 | Ga0070701_100220432 | 167 |
| 127 | 3300005438 | Ga0070701_10050921 | Ga0070701_100509212 | 167 |
| 128 | 3300005438 | Ga0070701_10303542 | Ga0070701_103035421 | 167 |
| 129 | 3300005439 | Ga0070711_100324028 | Ga0070711_1003240282 | 167 |
| 130 | 3300005441 | Ga0070700_100037530 | Ga0070700_1000375302 | 167 |
| 131 | 3300005444 | Ga0070694_100131986 | Ga0070694_1001319862 | 167 |
| 132 | 3300005445 | Ga0070708_100158696 | Ga0070708_1001586962 | 167 |
| 133 | 3300005457 | Ga0070662_100240935 | Ga0070662_1002409352 | 167 |
| 134 | 3300005459 | Ga0068867_100028324 | Ga0068867_1000283243 | 167 |
| 135 | 3300005459 | Ga0068867_100046885 | Ga0068867_1000468852 | 167 |
| 136 | 3300005466 | Ga0070685_10085766 | Ga0070685_100857663 | 167 |
| 137 | 3300005539 | Ga0068853_100667983 | Ga0068853_1006679831 | 167 |
| 138 | 3300005545 | Ga0070695_100451825 | Ga0070695_1004518251 | 167 |
| 139 | 3300005547 | Ga0070693_100200953 | Ga0070693_1002009532 | 167 |
| 140 | 3300005548 | Ga0070665_100014027 | Ga0070665_1000140275 | 167 |
| 141 | 3300005564 | Ga0070664_100076347 | Ga0070664_1000763473 | 167 |
| 142 | 3300005578 | Ga0068854_100230445 | Ga0068854_1002304452 | 167 |
| 143 | 3300005615 | Ga0070702_100005549 | Ga0070702_1000055495 | 167 |
| 144 | 3300005617 | Ga0068859_100023611 | Ga0068859_1000236113 | 167 |
| 145 | 3300005617 | Ga0068859_100414821 | Ga0068859_1004148211 | 167 |
| 146 | 3300005618 | Ga0068864_100631335 | Ga0068864_1006313352 | 167 |
| 147 | 3300005718 | Ga0068866_10289966 | Ga0068866_102899661 | 167 |
| 148 | 3300005719 | Ga0068861_100001173 | Ga0068861_1000011735 | 167 |
| 149 | 3300005719 | Ga0068861_100098454 | Ga0068861_1000984542 | 167 |
| 150 | 3300005719 | Ga0068861_100209909 | Ga0068861_1002099091 | 167 |
| 151 | 3300005719 | Ga0068861_100500364 | Ga0068861_1005003642 | 167 |
| 152 | 3300005841 | Ga0068863_100029167 | Ga0068863_1000291673 | 167 |
| 153 | 3300005842 | Ga0068858_100095371 | Ga0068858_1000953713 | 167 |
| 154 | 3300005843 | Ga0068860_100023622 | Ga0068860_1000236222 | 167 |
| 155 | 3300005844 | Ga0068862_100006827 | Ga0068862_1000068273 | 167 |
| 156 | 3300005844 | Ga0068862_100012896 | Ga0068862_1000128966 | 167 |
| 157 | 3300006237 | Ga0097621_100075208 | Ga0097621_1000752082 | 167 |
| 158 | 3300006847 | Ga0075431_100090831 | Ga0075431_1000908312 | 167 |
| 159 | 3300006871 | Ga0075434_100956998 | Ga0075434_1009569981 | 167 |
| 160 | 3300006881 | Ga0068865_100017043 | Ga0068865_1000170432 | 167 |
| 161 | 3300006931 | Ga0097620_100023611 | Ga0097620_1000236115 | 167 |
| 162 | 3300006931 | Ga0097620_100414822 | Ga0097620_1004148222 | 167 |
| 163 | 3300007076 | Ga0075435_100313412 | Ga0075435_1003134122 | 167 |
| 164 | 3300009094 | Ga0111539_10011289 | Ga0111539_100112894 | 167 |
| 165 | 3300009147 | Ga0114129_12097022 | Ga0114129_120970221 | 167 |
| 166 | 3300009148 | Ga0105243_10169492 | Ga0105243_101694922 | 167 |
| 167 | 3300009176 | Ga0105242_10127277 | Ga0105242_101272771 | 167 |
| 168 | 3300009553 | Ga0105249_10023801 | Ga0105249_100238015 | 167 |
| 169 | 3300013297 | Ga0157378_10673416 | Ga0157378_106734162 | 167 |
| 170 | 3300013306 | Ga0163162_10196509 | Ga0163162_101965093 | 167 |
| 171 | 3300013307 | Ga0157372_10492274 | Ga0157372_104922741 | 167 |
| 172 | 3300013308 | Ga0157375_11045002 | Ga0157375_110450021 | 167 |
| 173 | 3300014326 | Ga0157380_10147002 | Ga0157380_101470022 | 167 |
| 174 | 3300014326 | Ga0157380_10360227 | Ga0157380_103602272 | 167 |
| 175 | 3300014326 | Ga0157380_10712528 | Ga0157380_107125282 | 167 |
| 176 | 3300014326 | Ga0157380_10807638 | Ga0157380_108076382 | 167 |
| 177 | 3300014326 | Ga0157380_11298025 | Ga0157380_112980251 | 167 |
| 178 | 3300025224 | Ga0209784_100452 | Ga0209784_1004522 | 167 |
| 179 | 3300025225 | Ga0209566_100858 | Ga0209566_1008589 | 167 |
| 180 | 3300025226 | Ga0209674_100076 | Ga0209674_100076125 | 167 |
| 181 | 3300025230 | Ga0209563_101746 | Ga0209563_1017463 | 167 |
| 182 | 3300025246 | Ga0209646_1000043 | Ga0209646_100004399 | 167 |
| 183 | 3300025254 | Ga0209148_1000162 | Ga0209148_100016238 | 167 |
| 184 | 3300025256 | Ga0209759_1007897 | Ga0209759_10078972 | 167 |
| 185 | 3300025899 | Ga0207642_10011268 | Ga0207642_100112682 | 167 |
| 186 | 3300025907 | Ga0207645_10001976 | Ga0207645_100019767 | 167 |
| 187 | 3300025915 | Ga0207693_10848888 | Ga0207693_108488882 | 167 |
| 188 | 3300025917 | Ga0207660_10629718 | Ga0207660_106297182 | 167 |
| 189 | 3300025918 | Ga0207662_10096692 | Ga0207662_100966922 | 167 |
| 190 | 3300025923 | Ga0207681_10020993 | Ga0207681_100209932 | 167 |
| 191 | 3300025925 | Ga0207650_10086120 | Ga0207650_100861203 | 167 |
| 192 | 3300025933 | Ga0207706_10003669 | Ga0207706_1000366910 | 167 |
| 193 | 3300025934 | Ga0207686_10162912 | Ga0207686_101629122 | 167 |
| 194 | 3300025936 | Ga0207670_10012308 | Ga0207670_100123082 | 167 |
| 195 | 3300025938 | Ga0207704_10042105 | Ga0207704_100421052 | 167 |
| 196 | 3300025942 | Ga0207689_10236613 | Ga0207689_102366132 | 167 |
| 197 | 3300025942 | Ga0207689_10301321 | Ga0207689_103013212 | 167 |
| 198 | 3300025945 | Ga0207679_10066842 | Ga0207679_100668422 | 167 |
| 199 | 3300025972 | Ga0207668_10011240 | Ga0207668_100112405 | 167 |
| 200 | 3300026035 | Ga0207703_10076136 | Ga0207703_100761363 | 167 |
| 201 | 3300026067 | Ga0207678_10274595 | Ga0207678_102745952 | 167 |
| 202 | 3300026075 | Ga0207708_10013436 | Ga0207708_100134365 | 167 |
| 203 | 3300026075 | Ga0207708_10054745 | Ga0207708_100547452 | 167 |
| 204 | 3300026075 | Ga0207708_10216298 | Ga0207708_102162981 | 167 |
| 205 | 3300026078 | Ga0207702_10055987 | Ga0207702_100559874 | 167 |
| 206 | 3300026088 | Ga0207641_10068777 | Ga0207641_100687772 | 167 |
| 207 | 3300026088 | Ga0207641_10480033 | Ga0207641_104800332 | 167 |
| 208 | 3300026089 | Ga0207648_10002185 | Ga0207648_1000218515 | 167 |
| 209 | 3300026089 | Ga0207648_10087273 | Ga0207648_100872733 | 167 |
| 210 | 3300026089 | Ga0207648_11137401 | Ga0207648_111374011 | 167 |
| 211 | 3300026095 | Ga0207676_10553283 | Ga0207676_105532831 | 167 |
| 212 | 3300026118 | Ga0207675_100001664 | Ga0207675_10000166418 | 167 |
| 213 | 3300026118 | Ga0207675_100002324 | Ga0207675_10000232417 | 167 |
| 214 | 3300026118 | Ga0207675_100004583 | Ga0207675_1000045838 | 167 |
| 215 | 3300026118 | Ga0207675_100021836 | Ga0207675_1000218362 | 167 |
| 216 | 3300027552 | Ga0209982_1020368 | Ga0209982_10203681 | 167 |
| 217 | 3300027665 | Ga0209983_1003270 | Ga0209983_10032702 | 167 |
| 218 | 3300027682 | Ga0209971_1003097 | Ga0209971_10030973 | 167 |
| 219 | 3300027717 | Ga0209998_10002149 | Ga0209998_100021494 | 167 |
| 220 | 3300027876 | Ga0209974_10013115 | Ga0209974_100131152 | 167 |
| 221 | 3300027907 | Ga0207428_10591594 | Ga0207428_105915942 | 167 |
| 222 | 3300028379 | Ga0268266_10008586 | Ga0268266_100085865 | 167 |
| 223 | 3300028380 | Ga0268265_10013033 | Ga0268265_100130335 | 167 |
| 224 | 3300028381 | Ga0268264_10076290 | Ga0268264_100762901 | 167 |
| 225 | 3300028381 | Ga0268264_10211888 | Ga0268264_102118882 | 167 |
| 226 | 3300031247 | Ga0265340_10020325 | Ga0265340_100203254 | 167 |
| 227 | 3300031548 | Ga0307408_100336657 | Ga0307408_1003366572 | 167 |
| 228 | 3300031595 | Ga0265313_10053216 | Ga0265313_100532162 | 167 |
| 229 | 3300031731 | Ga0307405_10208711 | Ga0307405_102087112 | 167 |
| 230 | 3300031824 | Ga0307413_10014349 | Ga0307413_100143492 | 167 |
| 231 | 3300031824 | Ga0307413_10138231 | Ga0307413_101382312 | 167 |
| 232 | 3300031852 | Ga0307410_10024677 | Ga0307410_100246772 | 167 |
| 233 | 3300031901 | Ga0307406_10046763 | Ga0307406_100467633 | 167 |
| 234 | 3300031903 | Ga0307407_10087701 | Ga0307407_100877012 | 167 |
| 235 | 3300031995 | Ga0307409_100028513 | Ga0307409_1000285133 | 167 |
| 236 | 3300032002 | Ga0307416_100257492 | Ga0307416_1002574922 | 167 |
| 237 | 3300032002 | Ga0307416_100360964 | Ga0307416_1003609641 | 167 |
| 238 | 3300032005 | Ga0307411_10017098 | Ga0307411_100170984 | 167 |
| 239 | 3300032126 | Ga0307415_100010718 | Ga0307415_1000107185 | 167 |
| 240 | 3300035398 | Ga0316574_0055569 | Ga0316574_0055569_567_1109 | 167 |
| 241 | 3300037471 | Ga0395905_0002540 | Ga0395905_0002540_3915_4427 | 167 |
| 242 | 3300038735 | Ga0400485_20806 | Ga0400485_20806_3988_4521 | 167 |
| 243 | 3300038742 | Ga0400486_26303 | Ga0400486_26303_2605_3138 | 167 |
| 244 | 3300039062 | Ga0400483_059047 | Ga0400483_059047_123_656 | 167 |
| 245 | 3300039093 | Ga0400489_95599 | Ga0400489_95599_294_827 | 167 |
| 246 | 3300039110 | Ga0400487_59073 | Ga0400487_59073_2945_3478 | 167 |
| 247 | 3300041460 | Ga0451802_0157001 | Ga0451802_0157001_38_577 | 167 |
| 248 | 3300041491 | Ga0451833_0862655 | Ga0451833_0862655_92_604 | 167 |
| 249 | 3300042006 | Ga0439432_048759 | Ga0439432_048759_491_1000 | 167 |
| 250 | 3300042007 | Ga0439449_0007148 | Ga0439449_0007148_3713_4222 | 167 |
| 251 | 3300042131 | Ga0450894_046905 | Ga0450894_046905_52_591 | 167 |
| 252 | 3300042439 | Ga0439464_0050872 | Ga0439464_0050872_518_1057 | 167 |
| 253 | 3300042993 | Ga0439440_0010694 | Ga0439440_0010694_992_1504 | 167 |
| 254 | 3300042993 | Ga0439440_0032406 | Ga0439440_0032406_85_624 | 167 |
| 255 | 3300044684 | Ga0466966_0124048 | Ga0466966_0124048_570_1112 | 167 |
| 256 | 3300046457 | Ga0495590_0002699 | Ga0495590_0002699_4972_5511 | 167 |
| 257 | 3300046460 | Ga0495638_0026208 | Ga0495638_0026208_1102_1719 | 167 |
| 258 | 3300046460 | Ga0495638_0087513 | Ga0495638_0087513_1155_1694 | 167 |
| 259 | 3300046517 | Ga0495630_0325491 | Ga0495630_0325491_463_1005 | 167 |
| 260 | 3300046519 | Ga0495632_0063089 | Ga0495632_0063089_16_555 | 167 |
| 261 | 3300046519 | Ga0495632_0122409 | Ga0495632_0122409_630_1169 | 167 |
| 262 | 3300046530 | Ga0495654_0304575 | Ga0495654_0304575_98_637 | 167 |
| 263 | 3300046535 | Ga0495586_0050033 | Ga0495586_0050033_1366_1908 | 167 |
| 264 | 3300046660 | Ga0495625_0058494 | Ga0495625_0058494_196_735 | 167 |
| 265 | 3300046683 | Ga0495658_0014564 | Ga0495658_0014564_1647_2189 | 167 |
| 266 | 3300046694 | Ga0495649_0286783 | Ga0495649_0286783_277_816 | 167 |
| 267 | 3300047472 | Ga0495686_0339575 | Ga0495686_0339575_85_624 | 167 |
| 268 | 3300048903 | Ga0496100_0793735 | Ga0496100_0793735_11_550 | 167 |
| 269 | 3300049586 | Ga0501070_0976115 | Ga0501070_0976115_87_626 | 167 |
| 270 | 3300050496 | nmdc:mga07m45_423425_c1 | nmdc:mga07m45_423425_c1_42_578 | 167 |
| 271 | 3300050509 | nmdc:mga0qj67_667589_c1 | nmdc:mga0qj67_667589_c1_232_777 | 167 |
| 272 | 3300050510 | nmdc:mga06r32_755050_c1 | nmdc:mga06r32_755050_c1_338_883 | 167 |
| 273 | 3300050511 | nmdc:mga08y16_581492_c1 | nmdc:mga08y16_581492_c1_483_1028 | 167 |
| 274 | 3300053088 | Ga0500644_0025886 | Ga0500644_0025886_103_642 | 167 |
| 275 | 3300053161 | Ga0500634_0061963 | Ga0500634_0061963_552_1100 | 167 |
| 276 | 3300053727 | Ga0500611_081125 | Ga0500611_081125_152_691 | 167 |
| 277 | 3300060353 | Ga0501082_0019471 | Ga0501082_0019471_5093_5596 | 167 |
| 278 | 3300030731 | Ga0316177_1011446 | Ga0316177_10114464 | 169 |
| 279 | 3300030733 | Ga0314311_1144405 | Ga0314311_11444052 | 169 |
| 280 | 3300031824 | Ga0307413_10671430 | Ga0307413_106714302 | 169 |
| 281 | 3300032002 | Ga0307416_100027413 | Ga0307416_1000274135 | 169 |
| 282 | 3300041404 | Ga0439436_0049564 | Ga0439436_0049564_494_1003 | 169 |
| 283 | 3300042145 | Ga0450906_018587 | Ga0450906_018587_642_1151 | 169 |
| 284 | 3300047318 | Ga0495636_0004551 | Ga0495636_0004551_488_1003 | 169 |
| 285 | 3300047447 | Ga0495685_002200 | Ga0495685_002200_2771_3286 | 169 |
| 286 | 3300049686 | Ga0501257_009998 | Ga0501257_009998_235_750 | 169 |
| 287 | 2162886007 | SwRhRL2b_contig_1124246 | SwRhRL2b_0470.00007510 | 170 |
| 288 | 2162886007 | SwRhRL2b_contig_1325465 | SwRhRL2b_0682.00003550 | 170 |
| 289 | 3300002773 | JGI25152J39213_1000612 | JGI25152J39213_10006128 | 170 |
| 290 | 3300002774 | JGI25150J39212_1000741 | JGI25150J39212_10007415 | 170 |
| 291 | 3300002987 | JGI25159J45721_1049662 | JGI25159J45721_10496621 | 170 |
| 292 | 3300003187 | JGI25151J46595_10000016 | JGI25151J46595_1000001685 | 170 |
| 293 | 3300003187 | JGI25151J46595_10001145 | JGI25151J46595_1000114512 | 170 |
| 294 | 3300003187 | JGI25151J46595_10067410 | JGI25151J46595_100674101 | 170 |
| 295 | 3300003215 | JGI25153J46596_10000801 | JGI25153J46596_1000080112 | 170 |
| 296 | 3300003320 | rootH2_10032978 | rootH2_100329787 | 170 |
| 297 | 3300003323 | rootH1_10049495 | rootH1_100494952 | 170 |
| 298 | 3300003771 | Ga0055526_1000003 | Ga0055526_1000003225 | 170 |
| 299 | 3300003771 | Ga0055526_1000247 | Ga0055526_10002478 | 170 |
| 300 | 3300003771 | Ga0055526_1017155 | Ga0055526_10171553 | 170 |
| 301 | 3300003773 | Ga0055537_1000055 | Ga0055537_100005512 | 170 |
| 302 | 3300003773 | Ga0055537_1000614 | Ga0055537_10006147 | 170 |
| 303 | 3300003775 | Ga0055524_1000002 | Ga0055524_1000002142 | 170 |
| 304 | 3300003775 | Ga0055524_1010266 | Ga0055524_10102664 | 170 |
| 305 | 3300003775 | Ga0055524_1012482 | Ga0055524_10124823 | 170 |
| 306 | 3300003781 | Ga0055536_1000983 | Ga0055536_10009837 | 170 |
| 307 | 3300003781 | Ga0055536_1013870 | Ga0055536_10138701 | 170 |
| 308 | 3300003781 | Ga0055536_1013874 | Ga0055536_10138741 | 170 |
| 309 | 3300003781 | Ga0055536_1048315 | Ga0055536_10483151 | 170 |
| 310 | 3300003784 | Ga0055534_1000062 | Ga0055534_100006212 | 170 |
| 311 | 3300003784 | Ga0055534_1000599 | Ga0055534_100059914 | 170 |
| 312 | 3300003790 | Ga0055528_1000001 | Ga0055528_1000001142 | 170 |
| 313 | 3300003790 | Ga0055528_1000407 | Ga0055528_100040719 | 170 |
| 314 | 3300003791 | Ga0055530_10001944 | Ga0055530_100019441 | 170 |
| 315 | 3300003791 | Ga0055530_10001946 | Ga0055530_100019461 | 170 |
| 316 | 3300003791 | Ga0055530_10004373 | Ga0055530_100043736 | 170 |
| 317 | 3300003794 | Ga0055531_10014111 | Ga0055531_100141112 | 170 |
| 318 | 3300003794 | Ga0055531_10018514 | Ga0055531_100185141 | 170 |
| 319 | 3300003794 | Ga0055531_10018523 | Ga0055531_100185231 | 170 |
| 320 | 3300003794 | Ga0055531_10027564 | Ga0055531_100275641 | 170 |
| 321 | 3300003794 | Ga0055531_10028782 | Ga0055531_100287821 | 170 |
| 322 | 3300003856 | Ga0058692_1000004 | Ga0058692_100000413 | 170 |
| 323 | 3300003856 | Ga0058692_1000078 | Ga0058692_100007846 | 170 |
| 324 | 3300005289 | Ga0065704_10000512 | Ga0065704_1000051217 | 170 |
| 325 | 3300005289 | Ga0065704_10095357 | Ga0065704_100953572 | 170 |
| 326 | 3300005289 | Ga0065704_10101678 | Ga0065704_101016781 | 170 |
| 327 | 3300005331 | Ga0070670_100005119 | Ga0070670_10000511910 | 170 |
| 328 | 3300005336 | Ga0070680_100309086 | Ga0070680_1003090862 | 170 |
| 329 | 3300005347 | Ga0070668_100033588 | Ga0070668_1000335884 | 170 |
| 330 | 3300005347 | Ga0070668_100455252 | Ga0070668_1004552522 | 170 |
| 331 | 3300005353 | Ga0070669_100105619 | Ga0070669_1001056192 | 170 |
| 332 | 3300005353 | Ga0070669_100435435 | Ga0070669_1004354351 | 170 |
| 333 | 3300005356 | Ga0070674_100145557 | Ga0070674_1001455573 | 170 |
| 334 | 3300005367 | Ga0070667_100132112 | Ga0070667_1001321122 | 170 |
| 335 | 3300005456 | Ga0070678_100003261 | Ga0070678_1000032617 | 170 |
| 336 | 3300005459 | Ga0068867_100029282 | Ga0068867_1000292823 | 170 |
| 337 | 3300005543 | Ga0070672_100019487 | Ga0070672_1000194874 | 170 |
| 338 | 3300005547 | Ga0070693_100667432 | Ga0070693_1006674321 | 170 |
| 339 | 3300005548 | Ga0070665_100013456 | Ga0070665_1000134562 | 170 |
| 340 | 3300005548 | Ga0070665_100030222 | Ga0070665_1000302223 | 170 |
| 341 | 3300005548 | Ga0070665_100779820 | Ga0070665_1007798202 | 170 |
| 342 | 3300005564 | Ga0070664_100445157 | Ga0070664_1004451572 | 170 |
| 343 | 3300005840 | Ga0068870_10132417 | Ga0068870_101324172 | 170 |
| 344 | 3300005844 | Ga0068862_100350459 | Ga0068862_1003504592 | 170 |
| 345 | 3300005985 | Ga0081539_10042689 | Ga0081539_100426893 | 170 |
| 346 | 3300006038 | Ga0075365_10180726 | Ga0075365_101807262 | 170 |
| 347 | 3300006051 | Ga0075364_10000016 | Ga0075364_100000167 | 170 |
| 348 | 3300006051 | Ga0075364_10055728 | Ga0075364_100557282 | 170 |
| 349 | 3300006051 | Ga0075364_10160562 | Ga0075364_101605622 | 170 |
| 350 | 3300006051 | Ga0075364_10334134 | Ga0075364_103341342 | 170 |
| 351 | 3300006051 | Ga0075364_10367567 | Ga0075364_103675672 | 170 |
| 352 | 3300006353 | Ga0075370_10214862 | Ga0075370_102148621 | 170 |
| 353 | 3300009011 | Ga0105251_10002543 | Ga0105251_100025437 | 170 |
| 354 | 3300009011 | Ga0105251_10005401 | Ga0105251_100054012 | 170 |
| 355 | 3300009036 | Ga0105244_10088545 | Ga0105244_100885452 | 170 |
| 356 | 3300009036 | Ga0105244_10150248 | Ga0105244_101502482 | 170 |
| 357 | 3300009098 | Ga0105245_10405214 | Ga0105245_104052142 | 170 |
| 358 | 3300009148 | Ga0105243_10003403 | Ga0105243_100034039 | 170 |
| 359 | 3300009148 | Ga0105243_10247437 | Ga0105243_102474371 | 170 |
| 360 | 3300009148 | Ga0105243_10571796 | Ga0105243_105717962 | 170 |
| 361 | 3300013100 | Ga0157373_10057320 | Ga0157373_100573202 | 170 |
| 362 | 3300013100 | Ga0157373_10175020 | Ga0157373_101750201 | 170 |
| 363 | 3300013102 | Ga0157371_10000509 | Ga0157371_1000050913 | 170 |
| 364 | 3300013102 | Ga0157371_10482928 | Ga0157371_104829282 | 170 |
| 365 | 3300013104 | Ga0157370_10011813 | Ga0157370_100118132 | 170 |
| 366 | 3300013105 | Ga0157369_10098068 | Ga0157369_100980683 | 170 |
| 367 | 3300013307 | Ga0157372_10481003 | Ga0157372_104810032 | 170 |
| 368 | 3300014326 | Ga0157380_10187258 | Ga0157380_101872581 | 170 |
| 369 | 3300014326 | Ga0157380_12229879 | Ga0157380_122298791 | 170 |
| 370 | 3300014497 | Ga0182008_10001256 | Ga0182008_1000125614 | 170 |
| 371 | 3300014497 | Ga0182008_10002712 | Ga0182008_100027126 | 170 |
| 372 | 3300015261 | Ga0182006_1010651 | Ga0182006_10106514 | 170 |
| 373 | 3300015261 | Ga0182006_1018341 | Ga0182006_10183413 | 170 |
| 374 | 3300015261 | Ga0182006_1045768 | Ga0182006_10457682 | 170 |
| 375 | 3300015261 | Ga0182006_1060170 | Ga0182006_10601701 | 170 |
| 376 | 3300015262 | Ga0182007_10000142 | Ga0182007_1000014231 | 170 |
| 377 | 3300015265 | Ga0182005_1000456 | Ga0182005_100045613 | 170 |
| 378 | 3300015265 | Ga0182005_1002506 | Ga0182005_10025067 | 170 |
| 379 | 3300015689 | Ga0183360_10003 | Ga0183360_10003420 | 170 |
| 380 | 3300017792 | Ga0163161_10001916 | Ga0163161_100019167 | 170 |
| 381 | 3300017792 | Ga0163161_10042753 | Ga0163161_100427533 | 170 |
| 382 | 3300017792 | Ga0163161_10050069 | Ga0163161_100500693 | 170 |
| 383 | 3300017792 | Ga0163161_10730226 | Ga0163161_107302261 | 170 |
| 384 | 3300017792 | Ga0163161_10998746 | Ga0163161_109987462 | 170 |
| 385 | 3300021361 | Ga0213872_10034666 | Ga0213872_100346663 | 170 |
| 386 | 3300021441 | Ga0213871_10001874 | Ga0213871_100018743 | 170 |
| 387 | 3300022467 | Ga0224712_10126973 | Ga0224712_101269732 | 170 |
| 388 | 3300025245 | Ga0207425_1000074 | Ga0207425_100007495 | 170 |
| 389 | 3300025245 | Ga0207425_1011909 | Ga0207425_10119092 | 170 |
| 390 | 3300025245 | Ga0207425_1023126 | Ga0207425_10231262 | 170 |
| 391 | 3300025245 | Ga0207425_1027643 | Ga0207425_10276431 | 170 |
| 392 | 3300025258 | Ga0209129_1000150 | Ga0209129_100015095 | 170 |
| 393 | 3300025263 | Ga0209565_1000002 | Ga0209565_1000002438 | 170 |
| 394 | 3300025263 | Ga0209565_1000050 | Ga0209565_100005081 | 170 |
| 395 | 3300025273 | Ga0209673_1000002 | Ga0209673_1000002438 | 170 |
| 396 | 3300025273 | Ga0209673_1000199 | Ga0209673_100019980 | 170 |
| 397 | 3300025273 | Ga0209673_1014118 | Ga0209673_10141183 | 170 |
| 398 | 3300025284 | Ga0209130_1004188 | Ga0209130_10041884 | 170 |
| 399 | 3300025284 | Ga0209130_1012708 | Ga0209130_10127083 | 170 |
| 400 | 3300025291 | Ga0209675_1000002 | Ga0209675_1000002438 | 170 |
| 401 | 3300025291 | Ga0209675_1000007 | Ga0209675_1000007407 | 170 |
| 402 | 3300025292 | Ga0209676_1000018 | Ga0209676_1000018162 | 170 |
| 403 | 3300025292 | Ga0209676_1000052 | Ga0209676_1000052321 | 170 |
| 404 | 3300025292 | Ga0209676_1000168 | Ga0209676_1000168108 | 170 |
| 405 | 3300025292 | Ga0209676_1002246 | Ga0209676_100224613 | 170 |
| 406 | 3300025292 | Ga0209676_1002770 | Ga0209676_10027702 | 170 |
| 407 | 3300025292 | Ga0209676_1012232 | Ga0209676_10122322 | 170 |
| 408 | 3300025292 | Ga0209676_1068063 | Ga0209676_10680632 | 170 |
| 409 | 3300025294 | Ga0209025_1000006 | Ga0209025_1000006919 | 170 |
| 410 | 3300025294 | Ga0209025_1000048 | Ga0209025_100004895 | 170 |
| 411 | 3300025294 | Ga0209025_1006331 | Ga0209025_10063316 | 170 |
| 412 | 3300025294 | Ga0209025_1007416 | Ga0209025_10074163 | 170 |
| 413 | 3300025294 | Ga0209025_1122811 | Ga0209025_11228111 | 170 |
| 414 | 3300025295 | Ga0209564_1000004 | Ga0209564_1000004439 | 170 |
| 415 | 3300025295 | Ga0209564_1000061 | Ga0209564_1000061180 | 170 |
| 416 | 3300025295 | Ga0209564_1007457 | Ga0209564_10074573 | 170 |
| 417 | 3300025297 | Ga0209758_1000056 | Ga0209758_100005695 | 170 |
| 418 | 3300025297 | Ga0209758_1012351 | Ga0209758_10123512 | 170 |
| 419 | 3300025297 | Ga0209758_1031408 | Ga0209758_10314083 | 170 |
| 420 | 3300025297 | Ga0209758_1070105 | Ga0209758_10701052 | 170 |
| 421 | 3300025298 | Ga0209050_1000382 | Ga0209050_100038270 | 170 |
| 422 | 3300025298 | Ga0209050_1000424 | Ga0209050_100042467 | 170 |
| 423 | 3300025298 | Ga0209050_1001351 | Ga0209050_10013515 | 170 |
| 424 | 3300025298 | Ga0209050_1008173 | Ga0209050_10081736 | 170 |
| 425 | 3300025298 | Ga0209050_1049812 | Ga0209050_10498121 | 170 |
| 426 | 3300025299 | Ga0209256_1000004 | Ga0209256_1000004439 | 170 |
| 427 | 3300025299 | Ga0209256_1001917 | Ga0209256_100191711 | 170 |
| 428 | 3300025299 | Ga0209256_1004346 | Ga0209256_10043466 | 170 |
| 429 | 3300025299 | Ga0209256_1004359 | Ga0209256_10043593 | 170 |
| 430 | 3300025303 | Ga0209051_1001153 | Ga0209051_100115322 | 170 |
| 431 | 3300025303 | Ga0209051_1009442 | Ga0209051_10094422 | 170 |
| 432 | 3300025304 | Ga0209257_1000035 | Ga0209257_1000035162 | 170 |
| 433 | 3300025304 | Ga0209257_1000046 | Ga0209257_1000046397 | 170 |
| 434 | 3300025304 | Ga0209257_1000147 | Ga0209257_100014727 | 170 |
| 435 | 3300025304 | Ga0209257_1000261 | Ga0209257_100026178 | 170 |
| 436 | 3300025304 | Ga0209257_1002362 | Ga0209257_100236213 | 170 |
| 437 | 3300025304 | Ga0209257_1007745 | Ga0209257_10077453 | 170 |
| 438 | 3300025304 | Ga0209257_1013698 | Ga0209257_10136984 | 170 |
| 439 | 3300025304 | Ga0209257_1028235 | Ga0209257_10282352 | 170 |
| 440 | 3300025728 | Ga0207655_1056203 | Ga0207655_10562032 | 170 |
| 441 | 3300025728 | Ga0207655_1065998 | Ga0207655_10659982 | 170 |
| 442 | 3300025735 | Ga0207713_1002835 | Ga0207713_10028353 | 170 |
| 443 | 3300025735 | Ga0207713_1010568 | Ga0207713_10105682 | 170 |
| 444 | 3300025903 | Ga0207680_10618985 | Ga0207680_106189852 | 170 |
| 445 | 3300025909 | Ga0207705_10060700 | Ga0207705_100607003 | 170 |
| 446 | 3300025917 | Ga0207660_10492294 | Ga0207660_104922942 | 170 |
| 447 | 3300025919 | Ga0207657_10029127 | Ga0207657_100291275 | 170 |
| 448 | 3300025921 | Ga0207652_10357870 | Ga0207652_103578702 | 170 |
| 449 | 3300025923 | Ga0207681_10065932 | Ga0207681_100659322 | 170 |
| 450 | 3300025925 | Ga0207650_10002184 | Ga0207650_100021845 | 170 |
| 451 | 3300025927 | Ga0207687_10322955 | Ga0207687_103229552 | 170 |
| 452 | 3300025932 | Ga0207690_10472844 | Ga0207690_104728442 | 170 |
| 453 | 3300025933 | Ga0207706_10410077 | Ga0207706_104100771 | 170 |
| 454 | 3300025935 | Ga0207709_10000528 | Ga0207709_1000052814 | 170 |
| 455 | 3300025935 | Ga0207709_10003695 | Ga0207709_100036952 | 170 |
| 456 | 3300025937 | Ga0207669_10009378 | Ga0207669_100093782 | 170 |
| 457 | 3300025940 | Ga0207691_10001458 | Ga0207691_100014586 | 170 |
| 458 | 3300025945 | Ga0207679_10265781 | Ga0207679_102657811 | 170 |
| 459 | 3300025972 | Ga0207668_10024806 | Ga0207668_100248062 | 170 |
| 460 | 3300025972 | Ga0207668_10309289 | Ga0207668_103092892 | 170 |
| 461 | 3300025972 | Ga0207668_10432999 | Ga0207668_104329992 | 170 |
| 462 | 3300026041 | Ga0207639_11072175 | Ga0207639_110721751 | 170 |
| 463 | 3300026088 | Ga0207641_10332546 | Ga0207641_103325462 | 170 |
| 464 | 3300026089 | Ga0207648_10021900 | Ga0207648_100219003 | 170 |
| 465 | 3300026121 | Ga0207683_10008928 | Ga0207683_100089287 | 170 |
| 466 | 3300027312 | Ga0209371_1000018 | Ga0209371_1000018379 | 170 |
| 467 | 3300027312 | Ga0209371_1000025 | Ga0209371_1000025273 | 170 |
| 468 | 3300028379 | Ga0268266_10421701 | Ga0268266_104217012 | 170 |
| 469 | 3300028379 | Ga0268266_10517271 | Ga0268266_105172711 | 170 |
| 470 | 3300028380 | Ga0268265_10503311 | Ga0268265_105033112 | 170 |
| 471 | 3300030500 | Ga0268256_1000016 | Ga0268256_1000016379 | 170 |
| 472 | 3300030500 | Ga0268256_1000027 | Ga0268256_1000027273 | 170 |
| 473 | 3300030732 | Ga0316176_1127381 | Ga0316176_11273813 | 170 |
| 474 | 3300030742 | Ga0316183_1126505 | Ga0316183_11265053 | 170 |
| 475 | 3300030744 | Ga0316181_1013001 | Ga0316181_10130011 | 170 |
| 476 | 3300031456 | Ga0307513_10000429 | Ga0307513_1000042924 | 170 |
| 477 | 3300031456 | Ga0307513_10269691 | Ga0307513_102696912 | 170 |
| 478 | 3300031731 | Ga0307405_10209171 | Ga0307405_102091712 | 170 |
| 479 | 3300031824 | Ga0307413_10000988 | Ga0307413_100009882 | 170 |
| 480 | 3300031824 | Ga0307413_10437716 | Ga0307413_104377162 | 170 |
| 481 | 3300031911 | Ga0307412_10005903 | Ga0307412_100059031 | 170 |
| 482 | 3300031911 | Ga0307412_10200107 | Ga0307412_102001072 | 170 |
| 483 | 3300031911 | Ga0307412_10210209 | Ga0307412_102102092 | 170 |
| 484 | 3300031911 | Ga0307412_10328376 | Ga0307412_103283762 | 170 |
| 485 | 3300031995 | Ga0307409_101231822 | Ga0307409_1012318221 | 170 |
| 486 | 3300032002 | Ga0307416_100213906 | Ga0307416_1002139062 | 170 |
| 487 | 3300032004 | Ga0307414_10013082 | Ga0307414_100130825 | 170 |
| 488 | 3300032004 | Ga0307414_10014535 | Ga0307414_100145355 | 170 |
| 489 | 3300032004 | Ga0307414_10023786 | Ga0307414_100237862 | 170 |
| 490 | 3300032004 | Ga0307414_10024265 | Ga0307414_100242652 | 170 |
| 491 | 3300032004 | Ga0307414_10042335 | Ga0307414_100423353 | 170 |
| 492 | 3300032004 | Ga0307414_10093508 | Ga0307414_100935082 | 170 |
| 493 | 3300032004 | Ga0307414_10110862 | Ga0307414_101108622 | 170 |
| 494 | 3300032004 | Ga0307414_10129121 | Ga0307414_101291212 | 170 |
| 495 | 3300032004 | Ga0307414_10231284 | Ga0307414_102312842 | 170 |
| 496 | 3300032004 | Ga0307414_10276667 | Ga0307414_102766671 | 170 |
| 497 | 3300032004 | Ga0307414_10516957 | Ga0307414_105169572 | 170 |
| 498 | 3300032004 | Ga0307414_10661998 | Ga0307414_106619981 | 170 |
| 499 | 3300032005 | Ga0307411_10295281 | Ga0307411_102952812 | 170 |
| 500 | 3300032126 | Ga0307415_100851999 | Ga0307415_1008519991 | 170 |
| 501 | 3300037853 | Ga0436364_0679110 | Ga0436364_0679110_159_689 | 170 |
| 502 | 3300038705 | Ga0237819_02706 | Ga0237819_02706_1493_2005 | 170 |
| 503 | 3300039438 | Ga0436360_0303389 | Ga0436360_0303389_3999_4529 | 170 |
| 504 | 3300039438 | Ga0436360_0941386 | Ga0436360_0941386_410_934 | 170 |
| 505 | 3300039447 | Ga0436361_0524379 | Ga0436361_0524379_772_1302 | 170 |
| 506 | 3300039450 | Ga0436363_0422774 | Ga0436363_0422774_55_585 | 170 |
| 507 | 3300039450 | Ga0436363_1434014 | Ga0436363_1434014_695_1225 | 170 |
| 508 | 3300039453 | Ga0436362_0256845 | Ga0436362_0256845_197_727 | 170 |
| 509 | 3300039453 | Ga0436362_0872713 | Ga0436362_0872713_1992_2522 | 170 |
| 510 | 3300041404 | Ga0439436_0019829 | Ga0439436_0019829_754_1269 | 170 |
| 511 | 3300041404 | Ga0439436_0031686 | Ga0439436_0031686_401_922 | 170 |
| 512 | 3300041407 | Ga0439447_000492 | Ga0439447_000492_7620_8132 | 170 |
| 513 | 3300041413 | Ga0439465_0000375 | Ga0439465_0000375_11929_12450 | 170 |
| 514 | 3300041413 | Ga0439465_0000617 | Ga0439465_0000617_2885_3400 | 170 |
| 515 | 3300041413 | Ga0439465_0014660 | Ga0439465_0014660_657_1172 | 170 |
| 516 | 3300041413 | Ga0439465_0056714 | Ga0439465_0056714_407_922 | 170 |
| 517 | 3300041443 | Ga0451789_0970999 | Ga0451789_0970999_379_900 | 170 |
| 518 | 3300041451 | Ga0451791_1017899 | Ga0451791_1017899_329_850 | 170 |
| 519 | 3300041452 | Ga0451793_1242350 | Ga0451793_1242350_434_946 | 170 |
| 520 | 3300041452 | Ga0451793_1699778 | Ga0451793_1699778_1212_1733 | 170 |
| 521 | 3300041453 | Ga0451797_1448458 | Ga0451797_1448458_2456_2977 | 170 |
| 522 | 3300041459 | Ga0451800_0326087 | Ga0451800_0326087_1536_2048 | 170 |
| 523 | 3300041460 | Ga0451802_0874384 | Ga0451802_0874384_262_783 | 170 |
| 524 | 3300041462 | Ga0451806_205037 | Ga0451806_205037_625_1137 | 170 |
| 525 | 3300041463 | Ga0451804_0675874 | Ga0451804_0675874_449_961 | 170 |
| 526 | 3300041486 | Ga0451807_1218172 | Ga0451807_1218172_732_1244 | 170 |
| 527 | 3300041494 | Ga0451837_1270090 | Ga0451837_1270090_147_668 | 170 |
| 528 | 3300041496 | Ga0451839_0227527 | Ga0451839_0227527_166_678 | 170 |
| 529 | 3300041509 | Ga0451843_0025158 | Ga0451843_0025158_286_798 | 170 |
| 530 | 3300041997 | Ga0439431_0007467 | Ga0439431_0007467_292_813 | 170 |
| 531 | 3300041997 | Ga0439431_0034730 | Ga0439431_0034730_320_832 | 170 |
| 532 | 3300041999 | Ga0439433_0006452 | Ga0439433_0006452_430_945 | 170 |
| 533 | 3300041999 | Ga0439433_0017301 | Ga0439433_0017301_162_683 | 170 |
| 534 | 3300042004 | Ga0439445_0000472 | Ga0439445_0000472_5275_5787 | 170 |
| 535 | 3300042006 | Ga0439432_005050 | Ga0439432_005050_1630_2142 | 170 |
| 536 | 3300042007 | Ga0439449_0000016 | Ga0439449_0000016_29378_29893 | 170 |
| 537 | 3300042007 | Ga0439449_0012977 | Ga0439449_0012977_1307_1822 | 170 |
| 538 | 3300042007 | Ga0439449_0033248 | Ga0439449_0033248_627_1142 | 170 |
| 539 | 3300042007 | Ga0439449_0043301 | Ga0439449_0043301_371_892 | 170 |
| 540 | 3300042115 | Ga0450911_001075 | Ga0450911_001075_160_672 | 170 |
| 541 | 3300042156 | Ga0439446_0082606 | Ga0439446_0082606_428_949 | 170 |
| 542 | 3300046453 | Ga0495627_012925 | Ga0495627_012925_1952_2464 | 170 |
| 543 | 3300046460 | Ga0495638_0002077 | Ga0495638_0002077_5395_5907 | 170 |
| 544 | 3300046460 | Ga0495638_0018520 | Ga0495638_0018520_465_977 | 170 |
| 545 | 3300046460 | Ga0495638_0060323 | Ga0495638_0060323_360_881 | 170 |
| 546 | 3300046474 | Ga0495605_0154667 | Ga0495605_0154667_219_782 | 170 |
| 547 | 3300046501 | Ga0495607_0006816 | Ga0495607_0006816_415_978 | 170 |
| 548 | 3300046512 | Ga0495610_0003143 | Ga0495610_0003143_5223_5735 | 170 |
| 549 | 3300046512 | Ga0495610_0052050 | Ga0495610_0052050_454_966 | 170 |
| 550 | 3300046513 | Ga0495616_0033813 | Ga0495616_0033813_1420_1932 | 170 |
| 551 | 3300046513 | Ga0495616_0070639 | Ga0495616_0070639_321_842 | 170 |
| 552 | 3300046518 | Ga0495631_0001419 | Ga0495631_0001419_224_787 | 170 |
| 553 | 3300046522 | Ga0495643_0001536 | Ga0495643_0001536_5353_5865 | 170 |
| 554 | 3300046522 | Ga0495643_0070612 | Ga0495643_0070612_544_1065 | 170 |
| 555 | 3300046524 | Ga0495648_0314218 | Ga0495648_0314218_134_655 | 170 |
| 556 | 3300046525 | Ga0495663_0003689 | Ga0495663_0003689_311_832 | 170 |
| 557 | 3300046525 | Ga0495663_0016003 | Ga0495663_0016003_376_888 | 170 |
| 558 | 3300046525 | Ga0495663_0021410 | Ga0495663_0021410_1199_1711 | 170 |
| 559 | 3300046525 | Ga0495663_0083384 | Ga0495663_0083384_416_928 | 170 |
| 560 | 3300046525 | Ga0495663_0090594 | Ga0495663_0090594_238_753 | 170 |
| 561 | 3300046537 | Ga0495598_0002739 | Ga0495598_0002739_2260_2778 | 170 |
| 562 | 3300046558 | Ga0495633_0001972 | Ga0495633_0001972_8126_8638 | 170 |
| 563 | 3300046558 | Ga0495633_0011609 | Ga0495633_0011609_3898_4410 | 170 |
| 564 | 3300046558 | Ga0495633_0089362 | Ga0495633_0089362_422_934 | 170 |
| 565 | 3300046558 | Ga0495633_0095109 | Ga0495633_0095109_117_629 | 170 |
| 566 | 3300046615 | Ga0495656_0002680 | Ga0495656_0002680_880_1395 | 170 |
| 567 | 3300046616 | Ga0495668_0000951 | Ga0495668_0000951_6463_6975 | 170 |
| 568 | 3300046660 | Ga0495625_0106805 | Ga0495625_0106805_714_1226 | 170 |
| 569 | 3300046691 | Ga0495670_0028250 | Ga0495670_0028250_384_899 | 170 |
| 570 | 3300046692 | Ga0495671_0002955 | Ga0495671_0002955_4336_4857 | 170 |
| 571 | 3300046810 | Ga0495660_0002707 | Ga0495660_0002707_5368_5880 | 170 |
| 572 | 3300047318 | Ga0495636_0019822 | Ga0495636_0019822_1214_1729 | 170 |
| 573 | 3300047320 | Ga0495672_0001653 | Ga0495672_0001653_6285_6797 | 170 |
| 574 | 3300047320 | Ga0495672_0078637 | Ga0495672_0078637_1043_1555 | 170 |
| 575 | 3300047470 | Ga0495681_0034282 | Ga0495681_0034282_748_1311 | 170 |
| 576 | 3300047472 | Ga0495686_0002109 | Ga0495686_0002109_13744_14256 | 170 |
| 577 | 3300048904 | Ga0496101_0141005 | Ga0496101_0141005_747_1268 | 170 |
| 578 | 3300048905 | Ga0496102_0641756 | Ga0496102_0641756_332_850 | 170 |
| 579 | 3300048908 | Ga0496105_0046263 | Ga0496105_0046263_2589_3101 | 170 |
| 580 | 3300048912 | Ga0496109_0216750 | Ga0496109_0216750_25_543 | 170 |
| 581 | 3300048912 | Ga0496109_0386696 | Ga0496109_0386696_530_1048 | 170 |
| 582 | 3300048912 | Ga0496109_1025904 | Ga0496109_1025904_122_643 | 170 |
| 583 | 3300048916 | Ga0496113_0203922 | Ga0496113_0203922_491_1003 | 170 |
| 584 | 3300048917 | Ga0496114_0006644 | Ga0496114_0006644_2272_2784 | 170 |
| 585 | 3300048919 | Ga0496116_0004127 | Ga0496116_0004127_5454_5966 | 170 |
| 586 | 3300048919 | Ga0496116_0038194 | Ga0496116_0038194_2340_2852 | 170 |
| 587 | 3300048920 | Ga0496117_0001057 | Ga0496117_0001057_11095_11607 | 170 |
| 588 | 3300048920 | Ga0496117_0003169 | Ga0496117_0003169_13740_14252 | 170 |
| 589 | 3300048920 | Ga0496117_0003395 | Ga0496117_0003395_5337_5849 | 170 |
| 590 | 3300048920 | Ga0496117_0059763 | Ga0496117_0059763_1332_1844 | 170 |
| 591 | 3300048920 | Ga0496117_0103856 | Ga0496117_0103856_334_846 | 170 |
| 592 | 3300048921 | Ga0496118_0000661 | Ga0496118_0000661_42107_42619 | 170 |
| 593 | 3300048921 | Ga0496118_0003383 | Ga0496118_0003383_4607_5119 | 170 |
| 594 | 3300048921 | Ga0496118_0007411 | Ga0496118_0007411_6015_6527 | 170 |
| 595 | 3300048921 | Ga0496118_0011181 | Ga0496118_0011181_6210_6722 | 170 |
| 596 | 3300048921 | Ga0496118_0146826 | Ga0496118_0146826_360_872 | 170 |
| 597 | 3300048922 | Ga0496119_0000192 | Ga0496119_0000192_6494_7006 | 170 |
| 598 | 3300048922 | Ga0496119_0002158 | Ga0496119_0002158_5773_6285 | 170 |
| 599 | 3300048922 | Ga0496119_0004988 | Ga0496119_0004988_12346_12858 | 170 |
| 600 | 3300048923 | Ga0496120_0001184 | Ga0496120_0001184_5794_6306 | 170 |
| 601 | 3300048923 | Ga0496120_0002178 | Ga0496120_0002178_6555_7067 | 170 |
| 602 | 3300048924 | Ga0496121_0002087 | Ga0496121_0002087_9038_9550 | 170 |
| 603 | 3300048924 | Ga0496121_0005214 | Ga0496121_0005214_11062_11574 | 170 |
| 604 | 3300048924 | Ga0496121_0036564 | Ga0496121_0036564_2492_3004 | 170 |
| 605 | 3300048924 | Ga0496121_0132836 | Ga0496121_0132836_334_846 | 170 |
| 606 | 3300048925 | Ga0496122_0001623 | Ga0496122_0001623_28805_29317 | 170 |
| 607 | 3300048925 | Ga0496122_0002776 | Ga0496122_0002776_5667_6182 | 170 |
| 608 | 3300048925 | Ga0496122_0004567 | Ga0496122_0004567_13838_14359 | 170 |
| 609 | 3300048925 | Ga0496122_0006518 | Ga0496122_0006518_10610_11122 | 170 |
| 610 | 3300048925 | Ga0496122_0011939 | Ga0496122_0011939_8086_8598 | 170 |
| 611 | 3300048925 | Ga0496122_0018455 | Ga0496122_0018455_1838_2350 | 170 |
| 612 | 3300048925 | Ga0496122_0048968 | Ga0496122_0048968_387_899 | 170 |
| 613 | 3300048926 | Ga0496123_0001282 | Ga0496123_0001282_5804_6316 | 170 |
| 614 | 3300048926 | Ga0496123_0002342 | Ga0496123_0002342_17980_18495 | 170 |
| 615 | 3300048926 | Ga0496123_0003872 | Ga0496123_0003872_10040_10561 | 170 |
| 616 | 3300048926 | Ga0496123_0017574 | Ga0496123_0017574_4889_5401 | 170 |
| 617 | 3300048926 | Ga0496123_0036629 | Ga0496123_0036629_296_817 | 170 |
| 618 | 3300048926 | Ga0496123_0039932 | Ga0496123_0039932_2345_2857 | 170 |
| 619 | 3300048926 | Ga0496123_0141990 | Ga0496123_0141990_727_1239 | 170 |
| 620 | 3300048926 | Ga0496123_0144176 | Ga0496123_0144176_154_666 | 170 |
| 621 | 3300048927 | Ga0496124_0000006 | Ga0496124_0000006_498970_499533 | 170 |
| 622 | 3300048927 | Ga0496124_0002117 | Ga0496124_0002117_12720_13232 | 170 |
| 623 | 3300048927 | Ga0496124_0002767 | Ga0496124_0002767_15964_16476 | 170 |
| 624 | 3300048927 | Ga0496124_0004759 | Ga0496124_0004759_5233_5745 | 170 |
| 625 | 3300048927 | Ga0496124_0006154 | Ga0496124_0006154_12428_12940 | 170 |
| 626 | 3300048927 | Ga0496124_0008856 | Ga0496124_0008856_174_686 | 170 |
| 627 | 3300048927 | Ga0496124_0016163 | Ga0496124_0016163_862_1374 | 170 |
| 628 | 3300048927 | Ga0496124_0019984 | Ga0496124_0019984_5471_5983 | 170 |
| 629 | 3300048928 | Ga0496125_0005651 | Ga0496125_0005651_13230_13742 | 170 |
| 630 | 3300048928 | Ga0496125_0017000 | Ga0496125_0017000_6320_6832 | 170 |
| 631 | 3300048928 | Ga0496125_0033097 | Ga0496125_0033097_1504_2016 | 170 |
| 632 | 3300048928 | Ga0496125_0036821 | Ga0496125_0036821_3064_3576 | 170 |
| 633 | 3300048928 | Ga0496125_0100131 | Ga0496125_0100131_955_1467 | 170 |
| 634 | 3300048928 | Ga0496125_0172361 | Ga0496125_0172361_697_1209 | 170 |
| 635 | 3300048929 | Ga0496126_0005622 | Ga0496126_0005622_13619_14131 | 170 |
| 636 | 3300048929 | Ga0496126_0008005 | Ga0496126_0008005_379_891 | 170 |
| 637 | 3300048929 | Ga0496126_0234937 | Ga0496126_0234937_906_1418 | 170 |
| 638 | 3300049162 | Ga0501307_026680 | Ga0501307_026680_55_576 | 170 |
| 639 | 3300049568 | Ga0501031_0212793 | Ga0501031_0212793_438_950 | 170 |
| 640 | 3300049569 | Ga0501032_0067090 | Ga0501032_0067090_1163_1675 | 170 |
| 641 | 3300049570 | Ga0501033_0097370 | Ga0501033_0097370_227_739 | 170 |
| 642 | 3300049571 | Ga0501034_0000192 | Ga0501034_0000192_18464_18976 | 170 |
| 643 | 3300049571 | Ga0501034_0008435 | Ga0501034_0008435_4956_5471 | 170 |
| 644 | 3300049571 | Ga0501034_0204364 | Ga0501034_0204364_1180_1692 | 170 |
| 645 | 3300049571 | Ga0501034_1054239 | Ga0501034_1054239_98_610 | 170 |
| 646 | 3300049572 | Ga0501036_0199942 | Ga0501036_0199942_722_1234 | 170 |
| 647 | 3300049574 | Ga0501038_0062095 | Ga0501038_0062095_199_711 | 170 |
| 648 | 3300049574 | Ga0501038_0365905 | Ga0501038_0365905_356_868 | 170 |
| 649 | 3300049575 | Ga0501039_0160997 | Ga0501039_0160997_662_1174 | 170 |
| 650 | 3300049579 | Ga0501043_0151626 | Ga0501043_0151626_482_994 | 170 |
| 651 | 3300049581 | Ga0501047_0181848 | Ga0501047_0181848_1234_1746 | 170 |
| 652 | 3300049822 | Ga0501035_0033403 | Ga0501035_0033403_1696_2208 | 170 |
| 653 | 3300049823 | Ga0501044_0102705 | Ga0501044_0102705_217_729 | 170 |
| 654 | 3300049824 | Ga0501045_0155248 | Ga0501045_0155248_1178_1693 | 170 |
| 655 | 3300050491 | nmdc:mga00v17_1192_c1 | nmdc:mga00v17_1192_c1_5625_6137 | 170 |
| 656 | 3300053161 | Ga0500634_0000139 | Ga0500634_0000139_19475_19987 | 170 |
| 657 | 3300053734 | Ga0500565_000076 | Ga0500565_000076_56_568 | 170 |
| 658 | iso_pu_bacteria | 8021626552 | 8021627299 | 170 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3k6l-assembly1.cif.gz_A | the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 | 0.9833 | 2 | 167 |
| 5j46-assembly1.cif.gz_A | crystal structure of a peptide deformylase from burkholderia multivorans | 0.9772 | 1 | 167 |
| 3fwx-assembly2.cif.gz_B | the crystal structure of the peptide deformylase from vibrio cholerae o1 biovar el tor str. n16961 | 0.9736 | 3 | 167 |
| 3k6l-assembly3.cif.gz_C | the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 | 0.9731 | 3 | 162 |
| 3k6l-assembly1.cif.gz_A | the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 | 0.9715 | 2 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9598 | 1 | 152 | 3.90.45.10 |
| 1ws1A00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9567 | 1 | 148 | 3.90.45.10 |
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9534 | 1 | 152 | 3.90.45.10 |
| 4je6A00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9505 | 2 | 148 | 3.90.45.10 |
| 5mtdB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9477 | 6 | 145 | 3.90.45.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q8PG20-F1-model_v4 | Peptide deformylase 2 (PDF 2) (EC 3.5.1.88) (Polypeptide deformylase 2) | 1.001 | 1 | 170 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A2S7F0R2-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 1.001 | 1 | 170 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A840JW24-F1-model_v4 | deleted | 1 | 1 | 170 |
|
| AF-A0A0R0AA41-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9994 | 1 | 170 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A856YA22-F1-model_v4 | deleted | 0.9984 | 2 | 170 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar