F473170

General Info

Members Datasets Scaffolds Average Seq Length
658 537 357 361

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10147777|Ga0105239_101477772
Length 397
Sequence MKFVADDEPVTSESPPEAPAKQKRHHKGERSMLHSMIRTGAVVAGLALXXASAHADPLADAKTFIDKYASKVDKWDGPTASPKIVKGKTIVVLASDMKNGGVLGVTKGIEEAAKAAGWTVRTLDGAGSVSGRTAAFGQAMTLKPDGLVICGFDAVEQKPGMEAAKAAKIPMVSWHAAPVIGPVPEAGVFANVTTDPMAVSTAAANWAFVDAGGKPGVIIFTDSTYEIAIAKAKKMKEVIEALGGKVLEWVDTPIAETSTRMPQLTTSLLQKHGAAWTHSLAINDLYYDFMAPSLSAAGIKGTGAPVNVAAGDGSESAYQRIRSGAYQAVTVAEPLNLQGWQLVDELNRAIAGEKWSGYVSPLHVVTKANVEFDGGPTNTFDPGNGYRDAYKKAWGLQ

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
10 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
11 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
12 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
13 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
14 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
15 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
16 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
17 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
18 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
19 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
20 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
21 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
22 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
23 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
24 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
25 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
26 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
27 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
28 2516143018 Ensifer sp. BR816 Isolate Nodule
29 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
30 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
31 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
32 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
33 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
34 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
35 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
36 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
37 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
38 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
39 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
40 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
41 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
42 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
43 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
44 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
45 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
46 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
47 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
48 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
49 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
50 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
51 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
52 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
53 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
54 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
55 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
56 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
57 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
58 2643221558 Rhizobium sp. Root149 Isolate Unclassified
59 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
60 2643221719 Rhizobium sp. Root274 Isolate Unclassified
61 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
62 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
63 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
64 2718217882 Rhizobium sp. N741 Isolate Nodule
65 2718217927 Rhizobium sp. N324 Isolate Nodule
66 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
67 2718218009 Rhizobium sp. N561 Isolate Nodule
68 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
69 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
70 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
71 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
72 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
73 2718218363 Rhizobium sp. N113 Isolate Nodule
74 2718218365 Rhizobium sp. N731 Isolate Nodule
75 2718218366 Rhizobium sp. N621 Isolate Nodule
76 2718218423 Rhizobium sp. N941 Isolate Nodule
77 2721755514 Rhizobium sp. N6212 Isolate Nodule
78 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
79 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
80 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
81 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
82 2721755809 Rhizobium sp. N541 Isolate Nodule
83 2721755810 Rhizobium sp. N871 Isolate Nodule
84 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
85 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
86 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
87 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
88 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
89 2728369365 Rhizobium sp. N1341 Isolate Nodule
90 2728369397 Rhizobium sp. N1314 Isolate Nodule
91 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
92 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
93 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
94 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
95 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
96 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
97 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
98 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
99 2791355256 Rhizobium sp. M10 Isolate Nodule
100 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
101 2791355260 Rhizobium sp. L9 Isolate Nodule
102 2791355261 Rhizobium sp. J15 Isolate Nodule
103 2791355262 Rhizobium sp. M1 Isolate Nodule
104 2791355263 Rhizobium chutanense C5 Isolate Nodule
105 2791355264 Rhizobium sp. S9 Isolate Nodule
106 2791355265 Rhizobium sp. H4 Isolate Nodule
107 2791355266 Rhizobium sp. L43 Isolate Nodule
108 2791355267 Rhizobium sp. L18 Isolate Nodule
109 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
110 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
111 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
112 2802429633 Rhizobium anhuiense J3 Isolate Nodule
113 2802429634 Rhizobium anhuiense S10 Isolate Nodule
114 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
115 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
116 2802429637 Rhizobium anhuiense C15 Isolate Nodule
117 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
118 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
119 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
120 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
121 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
122 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
123 2838061910 Rhizobium phaseoli L15 Isolate Nodule
124 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
125 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
126 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
127 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
128 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
129 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
130 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
131 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
132 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
133 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
134 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
135 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
136 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
137 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
138 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
139 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
140 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
141 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
142 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
143 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
144 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
145 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
146 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
147 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
148 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
149 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
150 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
151 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
152 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
153 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
154 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
155 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
156 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
157 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
158 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
159 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
160 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
161 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
162 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
163 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
164 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
165 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
166 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
167 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
168 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
169 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
170 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
171 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
172 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
173 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
174 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
175 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
176 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
177 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
178 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
179 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
180 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
181 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
182 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
183 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
184 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
185 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
186 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
187 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
188 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
189 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
190 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
191 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
192 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
193 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
194 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
195 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
196 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
197 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
198 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
199 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
200 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
201 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
202 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
203 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
204 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
205 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
206 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
207 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
208 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
209 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
210 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
211 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
212 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
213 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
214 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
215 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
216 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
217 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
218 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
219 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
220 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
221 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
222 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
223 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
224 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
225 2936381700 Rhizobium chutanense C16 Isolate Unclassified
226 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
227 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
228 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
229 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
230 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
231 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
232 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
233 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
234 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
235 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
236 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
237 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
238 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
239 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
240 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
241 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
242 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
243 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
244 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
245 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
246 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
247 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
248 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
249 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
250 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
251 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
252 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
253 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
254 2996893221 Rhizobium sp. R635 Isolate Nodule
255 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
256 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
257 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
258 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
259 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
260 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
261 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
262 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
263 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
264 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
265 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
266 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
267 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
268 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
269 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
270 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
271 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
272 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
273 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
274 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
275 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
276 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
277 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
278 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
279 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
280 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
281 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
282 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
283 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
284 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
285 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
286 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
287 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
288 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
289 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
290 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
291 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
292 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
293 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
294 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
295 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
296 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
297 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
298 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
299 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
300 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
301 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
302 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
303 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
304 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
305 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
306 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
307 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
308 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
309 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
310 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
311 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
312 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
313 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
314 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
315 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
316 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
317 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
318 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
319 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
320 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
321 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
322 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
323 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
324 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
325 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
326 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
327 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
328 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
329 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
330 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
331 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
337 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
338 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
339 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
340 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
341 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
342 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
343 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
344 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
345 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
346 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
347 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
348 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
349 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
350 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
351 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
353 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
354 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
355 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
356 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
377 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
378 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
379 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
380 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
381 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
382 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
383 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
384 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
385 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
386 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
387 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
388 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
389 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
390 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
391 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
392 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
393 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
394 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
395 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
396 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
397 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
398 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
399 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
400 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
401 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
402 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
403 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
404 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
405 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
406 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
407 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
408 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
409 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
410 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
411 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
412 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
413 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
414 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
415 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
416 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
417 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
418 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
419 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
420 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
421 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
422 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
423 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
424 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
425 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
426 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
427 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
428 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
429 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
430 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
431 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
432 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
433 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
434 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
435 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
436 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
437 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
438 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
439 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
440 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
441 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
442 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
443 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
444 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
445 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
446 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
447 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
448 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
449 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
450 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
451 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
452 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
453 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
454 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
459 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
460 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
461 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
462 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
463 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
464 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
466 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
467 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
468 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
469 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
470 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
471 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
472 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
473 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
474 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
475 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
476 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
477 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
478 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
479 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
480 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
481 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
482 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
483 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
484 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
485 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
497 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
498 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
499 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
500 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
501 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
502 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
503 8005275841 Rhizobium sp. N4311 Isolate Nodule
504 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
505 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
506 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
507 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
508 8005382845 Rhizobium sp. R634 Isolate Nodule
509 8005395548 Rhizobium sp. R339 Isolate Nodule
510 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
511 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
512 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
513 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
514 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
515 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
516 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
517 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
518 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
519 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
520 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
521 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
522 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
523 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
524 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
525 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
526 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
527 8018176218 Rhizobium sp. N122 Isolate Nodule
528 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
529 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
530 8024501048 Rhizobium sp. H4 Isolate Nodule
531 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
532 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
533 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
534 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
535 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
536 8056382006 Rhizobium croatiense 13T Isolate Nodule
537 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.58
Metatranscriptomes 1.67
Isolates 45.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.37
Nodule 37.69
Rhizoplane 0.61
Rhizosphere 35.11
Stem 0
Stem Tuber 0
Unclassified 13.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000018 3300001915 Bacteria 38413
2 JGI24740J21852_10000785 3300001979 Bacteria 13939
3 JGI24740J21852_10001535 3300001979 Bacteria 10621
4 JGI24740J21852_10001862 3300001979 Bacteria 9654
5 JGI25155J39150_1000047 3300002704 Bacteria 80068
6 JGI25156J39149_1000069 3300002705 Bacteria 81255
7 JGI25156J39149_1004127 3300002705 Bacteria 4507
8 JGI25162J39368_1000184 3300002737 Bacteria 67069
9 JGI25154J39366_1000091 3300002738 Bacteria 80948
10 JGI25154J39366_1001228 3300002738 Bacteria 9655
11 JGI25157J39369_1000085 3300002741 Bacteria 81255
12 JGI25151J46595_10000337 3300003187 Bacteria 50281
13 JGI25165J46597_1001365 3300003214 Bacteria 13560
14 JGI25165J46597_1004512 3300003214 Bacteria 2959
15 JGI25153J46596_10002607 3300003215 Bacteria 10314
16 rootH2_10179271 3300003320 Bacteria 2227
17 rootL2_10000436 3300003322 Bacteria 30353
18 rootL2_10103126 3300003322 Bacteria 2624
19 JGI25160J50197_1002870 3300003354 Bacteria 7886
20 Ga0055539_1000081 3300003752 Bacteria 122891
21 Ga0055533_1001328 3300003756 Bacteria 6699
22 Ga0055532_1000048 3300003758 Bacteria 175560
23 Ga0055525_1000353 3300003759 Bacteria 32699
24 Ga0055525_1001152 3300003759 Bacteria 6249
25 Ga0055527_1000345 3300003760 Bacteria 23248
26 Ga0055535_1000035 3300003761 Bacteria 175560
27 Ga0055542_1000830 3300003762 Bacteria 22138
28 Ga0055542_1001465 3300003762 Bacteria 11618
29 Ga0055529_1000411 3300003763 Bacteria 44910
30 Ga0055529_1007355 3300003763 Bacteria 1499
31 Ga0055528_1000684 3300003790 Bacteria 24218
32 Ga0055528_1004817 3300003790 Bacteria 6417
33 Ga0055540_1000066 3300003792 Bacteria 122947
34 Ga0055543_1001035 3300004625 Bacteria 12362
35 Ga0065704_10102170 3300005289 Bacteria 2213
36 Ga0070670_100000942 3300005331 Bacteria 22849
37 Ga0070660_100128363 3300005339 Bacteria 2027
38 Ga0070661_100000330 3300005344 Bacteria 38046
39 Ga0070661_100152858 3300005344 Bacteria 1745
40 Ga0070673_100077351 3300005364 Bacteria 2689
41 Ga0070663_100000110 3300005455 Bacteria 38046
42 Ga0070662_100193059 3300005457 Bacteria 1612
43 Ga0068853_100007569 3300005539 Bacteria 8695
44 Ga0068853_100089710 3300005539 Bacteria 2700
45 Ga0070665_100013801 3300005548 Bacteria 8127
46 Ga0070665_100021986 3300005548 Bacteria 6416
47 Ga0070665_100058148 3300005548 Bacteria 3876
48 Ga0070665_100088024 3300005548 Bacteria 3112
49 Ga0068855_100190036 3300005563 Bacteria 2317
50 Ga0070664_100000261 3300005564 Bacteria 38046
51 Ga0070664_100059851 3300005564 Bacteria 3241
52 Ga0068854_100000170 3300005578 Bacteria 43964
53 Ga0068854_100088322 3300005578 Bacteria 2302
54 Ga0068856_100002101 3300005614 Bacteria 20657
55 Ga0068856_100055320 3300005614 Bacteria 3916
56 Ga0068852_100015333 3300005616 Bacteria 5937
57 Ga0068852_100060472 3300005616 Bacteria 3288
58 Ga0075365_10001142 3300006038 Bacteria 11631
59 Ga0075365_10011074 3300006038 Bacteria 5289
60 Ga0075365_10051188 3300006038 Bacteria 2727
61 Ga0075363_100057745 3300006048 Bacteria 2083
62 Ga0075367_10138780 3300006178 Bacteria 1505
63 Ga0075369_10003358 3300006186 Bacteria 5819
64 Ga0075366_10011243 3300006195 Bacteria 5051
65 Ga0075370_10003011 3300006353 Bacteria 7938
66 Ga0068865_100291171 3300006881 Bacteria 1303
67 Ga0105240_10000214 3300009093 Bacteria 117038
68 Ga0105240_10006510 3300009093 Bacteria 17157
69 Ga0105240_10389744 3300009093 Bacteria 1571
70 Ga0105245_10011711 3300009098 Bacteria 7633
71 Ga0105243_10357059 3300009148 Bacteria 1344
72 Ga0105241_10015771 3300009174 Bacteria 5535
73 Ga0105241_10047575 3300009174 Bacteria 3262
74 Ga0105242_10238471 3300009176 Bacteria 1634
75 Ga0105248_10115954 3300009177 Bacteria 3021
76 Ga0105237_10000166 3300009545 Bacteria 93389
77 Ga0105237_10001263 3300009545 Bacteria 33774
78 Ga0105237_10149483 3300009545 Bacteria 2332
79 Ga0105238_10118318 3300009551 Bacteria 2629
80 Ga0105238_10151369 3300009551 Bacteria 2295
81 Ga0123341_1000005 3300009765 Bacteria 150422
82 Ga0123342_1006034 3300009766 Bacteria 17084
83 Ga0105239_10028999 3300010375 Bacteria 6084
84 Ga0105239_10147777 3300010375 Bacteria 2622
85 Ga0157373_10021751 3300013100 Bacteria 4655
86 Ga0157371_10000089 3300013102 Bacteria 145483
87 Ga0157371_10171824 3300013102 Bacteria 1549
88 Ga0157370_10000002 3300013104 Bacteria 431400
89 Ga0157370_10126241 3300013104 Bacteria 2388
90 Ga0157369_10275461 3300013105 Bacteria 1753
91 Ga0157372_10000149 3300013307 Bacteria 76796
92 Ga0157372_10398631 3300013307 Bacteria 1604
93 Ga0163163_10215421 3300014325 Bacteria 1969
94 Ga0182008_10033468 3300014497 Bacteria 2578
95 Ga0182006_1013057 3300015261 Bacteria 3616
96 Ga0182007_10002152 3300015262 Bacteria 10020
97 Ga0214544_1000018 3300021320 Bacteria 187095
98 Ga0214542_1000081 3300021321 Bacteria 121242
99 Ga0214543_1000042 3300021327 Bacteria 164433
100 Ga0209435_100058 3300025206 Bacteria 81307
101 Ga0209784_100024 3300025224 Bacteria 394613
102 Ga0209784_100287 3300025224 Bacteria 28097
103 Ga0209784_100425 3300025224 Bacteria 18460
104 Ga0209566_100018 3300025225 Bacteria 448638
105 Ga0209566_100328 3300025225 Bacteria 42651
106 Ga0209566_101054 3300025225 Bacteria 11111
107 Ga0209674_100046 3300025226 Bacteria 357920
108 Ga0209674_100314 3300025226 Bacteria 31646
109 Ga0209672_100359 3300025228 Bacteria 28858
110 Ga0209147_100008 3300025229 Bacteria 777096
111 Ga0209563_100039 3300025230 Bacteria 409717
112 Ga0209563_101038 3300025230 Bacteria 8065
113 Ga0209437_100095 3300025233 Bacteria 236997
114 Ga0209258_100013 3300025242 Bacteria 777096
115 Ga0209646_1000027 3300025246 Bacteria 395141
116 Ga0209646_1000178 3300025246 Bacteria 81307
117 Ga0209646_1002104 3300025246 Bacteria 4646
118 Ga0209026_1000208 3300025250 Bacteria 81307
119 Ga0209026_1004229 3300025250 Bacteria 4367
120 Ga0209677_100024 3300025253 Bacteria 406035
121 Ga0209148_1000019 3300025254 Bacteria 748518
122 Ga0209148_1000302 3300025254 Bacteria 70861
123 Ga0209148_1005514 3300025254 Bacteria 2890
124 Ga0209759_1000242 3300025256 Bacteria 81307
125 Ga0209129_1000852 3300025258 Bacteria 19125
126 Ga0209233_1000117 3300025261 Bacteria 236984
127 Ga0209233_1000340 3300025261 Bacteria 45824
128 Ga0209455_1000042 3300025272 Bacteria 419638
129 Ga0209455_1000986 3300025272 Bacteria 14388
130 Ga0209455_1014109 3300025272 Bacteria 1823
131 Ga0209673_1000020 3300025273 Bacteria 430653
132 Ga0209673_1000433 3300025273 Bacteria 72554
133 Ga0209673_1001482 3300025273 Bacteria 21938
134 Ga0209025_1000081 3300025294 Bacteria 265899
135 Ga0209564_1000114 3300025295 Bacteria 209934
136 Ga0209564_1000722 3300025295 Bacteria 47441
137 Ga0209758_1000076 3300025297 Bacteria 270615
138 Ga0209758_1005376 3300025297 Bacteria 9915
139 Ga0209758_1024188 3300025297 Bacteria 2715
140 Ga0209050_1012872 3300025298 Bacteria 3785
141 Ga0209256_1000123 3300025299 Bacteria 165547
142 Ga0207426_1000169 3300025302 Bacteria 164859
143 Ga0209051_1000038 3300025303 Bacteria 320926
144 Ga0209051_1005173 3300025303 Bacteria 7728
145 Ga0209257_1044580 3300025304 Bacteria 1293
146 Ga0207645_10044660 3300025907 Bacteria 2835
147 Ga0207695_10000008 3300025913 Bacteria 1058268
148 Ga0207695_10000373 3300025913 Bacteria 101687
149 Ga0207695_10004530 3300025913 Bacteria 18915
150 Ga0207695_10126396 3300025913 Bacteria 2518
151 Ga0207671_10000536 3300025914 Bacteria 51271
152 Ga0207671_10001225 3300025914 Bacteria 30382
153 Ga0207657_10109869 3300025919 Bacteria 2278
154 Ga0207649_10000075 3300025920 Bacteria 83915
155 Ga0207694_10234967 3300025924 Bacteria 1497
156 Ga0207650_10001752 3300025925 Bacteria 15406
157 Ga0207687_10051101 3300025927 Bacteria 2880
158 Ga0207691_10060866 3300025940 Bacteria 3430
159 Ga0207711_10278389 3300025941 Bacteria 1540
160 Ga0207679_10000004 3300025945 Bacteria 589021
161 Ga0207679_10043879 3300025945 Bacteria 3223
162 Ga0207651_10155239 3300025960 Bacteria 1787
163 Ga0207640_10000084 3300025981 Bacteria 74504
164 Ga0207678_10000012 3300026067 Bacteria 145324
165 Ga0207678_10151365 3300026067 Bacteria 1981
166 Ga0207702_10000020 3300026078 Bacteria 203299
167 Ga0207648_10107896 3300026089 Bacteria 2444
168 Ga0207674_10009955 3300026116 Bacteria 10818
169 Ga0207683_10260514 3300026121 Bacteria 1583
170 Ga0207698_10037111 3300026142 Bacteria 3585
171 Ga0207698_10248745 3300026142 Bacteria 1625
172 Ga0268266_10000167 3300028379 Bacteria 120012
173 Ga0268266_10089203 3300028379 Bacteria 2699
174 Ga0265318_10002153 3300028577 Bacteria 10697
175 Ga0307515_10000136 3300028794 Bacteria 174265
176 Ga0307515_10002668 3300028794 Bacteria 38232
177 Ga0307515_10036732 3300028794 Bacteria 7912
178 Ga0265325_10054699 3300031241 Bacteria 2042
179 Ga0265340_10004901 3300031247 Bacteria 7448
180 Ga0265340_10005139 3300031247 Bacteria 7275
181 Ga0265339_10001383 3300031249 Bacteria 18103
182 Ga0265339_10019694 3300031249 Bacteria 3956
183 Ga0265331_10058767 3300031250 Bacteria 1820
184 Ga0265316_10008989 3300031344 Bacteria 9213
185 Ga0265316_10031416 3300031344 Bacteria 4342
186 Ga0307513_10002190 3300031456 Bacteria 27340
187 Ga0307513_10248585 3300031456 Bacteria 1577
188 Ga0307408_100091613 3300031548 Bacteria 2296
189 Ga0265313_10003934 3300031595 Bacteria 11694
190 Ga0265313_10006531 3300031595 Bacteria 8235
191 Ga0265314_10008301 3300031711 Bacteria 8911
192 Ga0307516_10031728 3300031730 Bacteria 5325
193 Ga0373927_0000602 3300035695 Bacteria 27445
194 Ga0373927_0199921 3300035695 Bacteria 1312
195 Ga0373925_0002089 3300037068 Bacteria 16413
196 Ga0395900_0005053 3300037418 Bacteria 13842
197 Ga0395905_0004737 3300037471 Bacteria 14054
198 Ga0395905_0042537 3300037471 Bacteria 4263
199 Ga0395905_0264447 3300037471 Bacteria 1605
200 Ga0395905_0440241 3300037471 Bacteria 1201
201 Ga0395901_0054907 3300038443 Bacteria 4141
202 Ga0400483_079255 3300039062 Bacteria 3268
203 Ga0400483_091182 3300039062 Bacteria 3150
204 Ga0400483_185055 3300039062 Bacteria 1450
205 Ga0400483_226401 3300039062 Bacteria 8911
206 Ga0400483_229691 3300039062 Bacteria 5361
207 Ga0400483_255747 3300039062 Bacteria 2709
208 Ga0400483_257884 3300039062 Bacteria 13437
209 Ga0400483_270667 3300039062 Bacteria 2942
210 Ga0400483_277886 3300039062 Bacteria 8296
211 Ga0400483_291060 3300039062 Bacteria 8141
212 Ga0436360_0962767 3300039438 Bacteria 1572
213 Ga0436360_1373735 3300039438 Bacteria 4250
214 Ga0436361_0098242 3300039447 Bacteria 12625
215 Ga0436361_0132518 3300039447 Bacteria 5720
216 Ga0436361_0515084 3300039447 Bacteria 15175
217 Ga0436362_0058642 3300039453 Bacteria 1549
218 Ga0436362_0670879 3300039453 Bacteria 2636
219 Ga0436362_0827519 3300039453 Bacteria 1347
220 Ga0439436_0027158 3300041404 Bacteria 1676
221 Ga0439465_0003714 3300041413 Bacteria 4975
222 Ga0451837_1349150 3300041494 Bacteria 2026
223 Ga0451849_0702083 3300041505 Bacteria 1379
224 Ga0439449_0082700 3300042007 Bacteria 1184
225 Ga0451577_0005431 3300042876 Bacteria 13072
226 Ga0451577_0037972 3300042876 Bacteria 4333
227 Ga0466986_0019168 3300044650 Bacteria 4478
228 Ga0466969_0010907 3300044656 Bacteria 4814
229 Ga0466972_0003033 3300044658 Bacteria 8325
230 Ga0466972_0012599 3300044658 Bacteria 4248
231 Ga0466965_0033818 3300044683 Bacteria 2499
232 Ga0466961_0000807 3300044693 Bacteria 19503
233 Ga0466961_0012901 3300044693 Bacteria 5345
234 Ga0453684_0000738 3300044712 Bacteria 114519
235 Ga0453684_0090326 3300044712 Bacteria 3785
236 Ga0453684_0138880 3300044712 Bacteria 2905
237 Ga0453684_0176386 3300044712 Bacteria 2513
238 Ga0466971_0013302 3300044719 Bacteria 3613
239 Ga0466968_0026429 3300044735 Bacteria 2382
240 Ga0466970_0000198 3300044765 Bacteria 29185
241 Ga0466970_0000555 3300044765 Bacteria 18237
242 Ga0466970_0005221 3300044765 Bacteria 6428
243 Ga0466957_0009398 3300044842 Bacteria 5581
244 Ga0466960_0059510 3300044901 Bacteria 1869
245 Ga0466959_0000139 3300045049 Bacteria 47401
246 Ga0451576_0001359 3300045051 Bacteria 42151
247 Ga0451576_0004729 3300045051 Bacteria 17496
248 Ga0451576_0006393 3300045051 Bacteria 14462
249 Ga0451576_0111563 3300045051 Bacteria 2846
250 Ga0466958_0028830 3300045836 Bacteria 3293
251 Ga0466967_0466575 3300045976 Bacteria 1235
252 Ga0495629_0016512 3300046459 Bacteria 5300
253 Ga0495638_0000163 3300046460 Bacteria 103363
254 Ga0495662_0004028 3300046476 Bacteria 7401
255 Ga0495583_0018846 3300046506 Bacteria 3620
256 Ga0495606_0014407 3300046507 Bacteria 6174
257 Ga0495606_0039362 3300046507 Bacteria 3187
258 Ga0495606_0056182 3300046507 Bacteria 2542
259 Ga0495616_0010465 3300046513 Bacteria 5368
260 Ga0495631_0004695 3300046518 Bacteria 7223
261 Ga0495632_0075397 3300046519 Bacteria 1614
262 Ga0495643_0003443 3300046522 Bacteria 11576
263 Ga0495643_0006217 3300046522 Bacteria 7921
264 Ga0495648_0039319 3300046524 Bacteria 3011
265 Ga0495652_0075176 3300046529 Bacteria 2807
266 Ga0495609_0041768 3300046538 Bacteria 2060
267 Ga0495597_0015976 3300046542 Bacteria 3549
268 Ga0495622_0011296 3300046557 Bacteria 4124
269 Ga0495622_0068226 3300046557 Bacteria 1643
270 Ga0495633_0062648 3300046558 Bacteria 1741
271 Ga0495656_0057566 3300046615 Bacteria 1683
272 Ga0495668_0006290 3300046616 Bacteria 7823
273 Ga0495625_0021178 3300046660 Bacteria 5009
274 Ga0495625_0026707 3300046660 Bacteria 4357
275 Ga0495670_0058599 3300046691 Bacteria 1933
276 Ga0495649_0028625 3300046694 Bacteria 3088
277 Ga0495600_0032387 3300046809 Bacteria 3391
278 Ga0495660_0026881 3300046810 Bacteria 3258
279 Ga0495604_0026324 3300047317 Bacteria 4630
280 Ga0495672_0038300 3300047320 Bacteria 2926
281 Ga0495686_0080823 3300047472 Unclassified 1986
282 Ga0496102_0028748 3300048905 Bacteria 4969
283 Ga0496112_0012698 3300048915 Bacteria 7746
284 Ga0496116_0029189 3300048919 Bacteria 3981
285 Ga0496116_0113596 3300048919 Bacteria 1584
286 Ga0496119_0029690 3300048922 Bacteria 3700
287 Ga0496119_0123034 3300048922 Bacteria 1423
288 Ga0496121_0009765 3300048924 Bacteria 10973
289 Ga0496121_0038387 3300048924 Bacteria 4243
290 Ga0496121_0069315 3300048924 Bacteria 2847
291 Ga0496122_0019118 3300048925 Bacteria 6281
292 Ga0496122_0039644 3300048925 Bacteria 3754
293 Ga0496123_0005115 3300048926 Bacteria 13384
294 Ga0496123_0020584 3300048926 Bacteria 5157
295 Ga0496124_0004837 3300048927 Bacteria 15488
296 Ga0496124_0039341 3300048927 Bacteria 4100
297 Ga0496124_0135938 3300048927 Bacteria 1946
298 Ga0496125_0003952 3300048928 Bacteria 17488
299 Ga0496126_0000430 3300048929 Bacteria 84663
300 Ga0496126_0067822 3300048929 Bacteria 3186
301 Ga0496126_0121582 3300048929 Bacteria 2263
302 Ga0496126_0229554 3300048929 Bacteria 1556
303 Ga0495678_036479 3300049459 Bacteria 2006
304 Ga0501032_0013550 3300049569 Bacteria 5796
305 Ga0501034_0060336 3300049571 Bacteria 3810
306 Ga0501034_0151658 3300049571 Unclassified 2293
307 Ga0501038_0150508 3300049574 Unclassified 1898
308 Ga0501038_0193789 3300049574 Bacteria 1634
309 Ga0501047_0234198 3300049581 Unclassified 1688
310 Ga0501067_0001020 3300049583 Bacteria 15053
311 Ga0501070_0181809 3300049586 Unclassified 1730
312 Ga0501073_0023209 3300049589 Bacteria 4458
313 Ga0501073_0148313 3300049589 Bacteria 1625
314 Ga0501074_0133099 3300049590 Unclassified 1778
315 Ga0501080_0046462 3300049742 Bacteria 4042
316 Ga0501080_0075057 3300049742 Unclassified 3145
317 Ga0501083_0084351 3300049744 Unclassified 2104
318 Ga0501083_0231395 3300049744 Bacteria 1204
319 Ga0501035_0045136 3300049822 Bacteria 3965
320 Ga0501044_0074846 3300049823 Bacteria 3439
321 Ga0501044_0080084 3300049823 Bacteria 3308
322 Ga0501044_0205985 3300049823 Unclassified 1923
323 nmdc:mga0yw44_172637_c1 3300050492 Bacteria 1420
324 nmdc:mga0yw44_991_c1 3300050492 Bacteria 10827
325 nmdc:mga06z11_9642_c1 3300050494 Bacteria 4077
326 nmdc:mga07m45_5578_c1 3300050496 Bacteria 6282
327 Ga0495619_0022113 3300053085 Bacteria 4066
328 Ga0500578_0083154 3300053086 Bacteria 2034
329 Ga0500651_0016271 3300053093 Bacteria 4573
330 Ga0500641_0016324 3300053096 Bacteria 2765
331 Ga0500650_0110091 3300053098 Bacteria 1286
332 Ga0500557_001707 3300053105 Bacteria 3730
333 Ga0500569_003134 3300053109 Bacteria 3344
334 Ga0500594_0005428 3300053118 Bacteria 2830
335 Ga0500595_001156 3300053119 Bacteria 14612
336 Ga0500642_0038938 3300053130 Bacteria 2041
337 Ga0500658_0000486 3300053134 Bacteria 16965
338 Ga0500568_0000587 3300053139 Bacteria 26463
339 Ga0500590_000124 3300053148 Bacteria 21215
340 Ga0500616_0001233 3300053153 Bacteria 25673
341 Ga0500616_0003199 3300053153 Bacteria 12737
342 Ga0500636_0000027 3300053177 Bacteria 83029
343 Ga0500636_0000679 3300053177 Bacteria 18258
344 Ga0501084_0354941 3300054114 Unclassified 1238
345 Ga0587070_000574 3300059491 Bacteria 3167
346 Ga0587077_000356 3300059493 Bacteria 3675
347 Ga0587082_008645 3300059504 Bacteria 1426
348 Ga0587083_0000386 3300059505 Bacteria 3734
349 Ga0587106_001676 3300059605 Bacteria 2028
350 Ga0587067_001845 3300059640 Bacteria 2393
351 Ga0587069_003507 3300059642 Bacteria 1699
352 Ga0587072_002568 3300059643 Bacteria 2447
353 Ga0587076_000152 3300059645 Bacteria 4501
354 Ga0587079_004100 3300059647 Bacteria 1955
355 Ga0587107_002062 3300059652 Bacteria 1755
356 Ga0501082_0035572 3300060353 Bacteria 4293
357 Ga0466962_0002483 3300061719 Bacteria 8739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0827519 Ga0436362_0827519_135_1061 292
2 3300045976 Ga0466967_0466575 Ga0466967_0466575_50_979 303
3 3300044683 Ga0466965_0033818 Ga0466965_0033818_290_1264 314
4 iso_pu_bacteria 2871444079 2871451833 319
5 3300042007 Ga0439449_0082700 Ga0439449_0082700_192_1169 323
6 3300005331 Ga0070670_100000942 Ga0070670_1000009424 325
7 3300025925 Ga0207650_10001752 Ga0207650_1000175211 325
8 3300039062 Ga0400483_270667 Ga0400483_270667_1072_2148 326
9 3300039062 Ga0400483_291060 Ga0400483_291060_5995_7035 328
10 3300003790 Ga0055528_1004817 Ga0055528_10048176 329
11 3300003792 Ga0055540_1000066 Ga0055540_1000066109 329
12 3300025273 Ga0209673_1001482 Ga0209673_100148218 329
13 3300025298 Ga0209050_1012872 Ga0209050_10128723 329
14 3300025303 Ga0209051_1000038 Ga0209051_100003846 329
15 3300044712 Ga0453684_0138880 Ga0453684_0138880_1822_2859 329
16 3300009765 Ga0123341_1000005 Ga0123341_100000536 330
17 3300039062 Ga0400483_079255 Ga0400483_079255_174_1211 331
18 iso_pu_bacteria 2838061910 2838066374 333
19 iso_pu_bacteria 2842311132 2842313180 333
20 iso_pu_bacteria 2842447887 2842452515 333
21 3300041505 Ga0451849_0702083 Ga0451849_0702083_136_1233 334
22 3300046507 Ga0495606_0039362 Ga0495606_0039362_603_1700 334
23 3300046513 Ga0495616_0010465 Ga0495616_0010465_3277_4374 334
24 3300046522 Ga0495643_0006217 Ga0495643_0006217_5552_6649 334
25 3300046542 Ga0495597_0015976 Ga0495597_0015976_1772_2869 334
26 3300053086 Ga0500578_0083154 Ga0500578_0083154_474_1571 334
27 3300053134 Ga0500658_0000486 Ga0500658_0000486_10278_11375 334
28 3300053153 Ga0500616_0003199 Ga0500616_0003199_1999_3096 334
29 3300044656 Ga0466969_0010907 Ga0466969_0010907_2097_3104 335
30 3300044658 Ga0466972_0003033 Ga0466972_0003033_649_1656 335
31 3300044693 Ga0466961_0000807 Ga0466961_0000807_10224_11231 335
32 3300044719 Ga0466971_0013302 Ga0466971_0013302_526_1533 335
33 3300044765 Ga0466970_0000555 Ga0466970_0000555_6902_7909 335
34 3300044901 Ga0466960_0059510 Ga0466960_0059510_13_1020 335
35 3300049744 Ga0501083_0231395 Ga0501083_0231395_110_1129 335
36 3300061719 Ga0466962_0002483 Ga0466962_0002483_5504_6511 335
37 3300044693 Ga0466961_0012901 Ga0466961_0012901_765_1877 336
38 3300044842 Ga0466957_0009398 Ga0466957_0009398_4073_5185 336
39 3300045049 Ga0466959_0000139 Ga0466959_0000139_12700_13812 336
40 3300039062 Ga0400483_255747 Ga0400483_255747_846_1883 339
41 3300047320 Ga0495672_0038300 Ga0495672_0038300_408_1511 339
42 3300053139 Ga0500568_0000587 Ga0500568_0000587_626_1729 339
43 3300053153 Ga0500616_0001233 Ga0500616_0001233_23944_25047 339
44 3300039062 Ga0400483_091182 Ga0400483_091182_611_1672 340
45 3300039062 Ga0400483_185055 Ga0400483_185055_307_1347 340
46 3300039062 Ga0400483_277886 Ga0400483_277886_694_1734 340
47 3300046506 Ga0495583_0018846 Ga0495583_0018846_2226_3329 341
48 3300046518 Ga0495631_0004695 Ga0495631_0004695_1053_2156 341
49 3300046538 Ga0495609_0041768 Ga0495609_0041768_602_1705 341
50 3300046558 Ga0495633_0062648 Ga0495633_0062648_209_1306 341
51 3300046615 Ga0495656_0057566 Ga0495656_0057566_228_1325 341
52 3300046616 Ga0495668_0006290 Ga0495668_0006290_3274_4377 341
53 3300046691 Ga0495670_0058599 Ga0495670_0058599_273_1376 341
54 3300046810 Ga0495660_0026881 Ga0495660_0026881_2117_3220 341
55 3300049459 Ga0495678_036479 Ga0495678_036479_193_1296 341
56 3300053098 Ga0500650_0110091 Ga0500650_0110091_98_1201 341
57 3300053105 Ga0500557_001707 Ga0500557_001707_2026_3129 341
58 3300053109 Ga0500569_003134 Ga0500569_003134_590_1693 341
59 3300053118 Ga0500594_0005428 Ga0500594_0005428_1273_2376 341
60 3300005339 Ga0070660_100128363 Ga0070660_1001283633 342
61 3300005344 Ga0070661_100152858 Ga0070661_1001528582 342
62 3300005539 Ga0068853_100089710 Ga0068853_1000897104 342
63 3300005564 Ga0070664_100059851 Ga0070664_1000598513 342
64 3300005578 Ga0068854_100088322 Ga0068854_1000883222 342
65 3300025945 Ga0207679_10043879 Ga0207679_100438795 342
66 3300044765 Ga0466970_0005221 Ga0466970_0005221_2373_3485 342
67 3300045051 Ga0451576_0004729 Ga0451576_0004729_3954_5000 342
68 3300045836 Ga0466958_0028830 Ga0466958_0028830_1915_3027 342
69 3300005616 Ga0068852_100060472 Ga0068852_1000604723 343
70 3300006881 Ga0068865_100291171 Ga0068865_1002911711 343
71 3300013102 Ga0157371_10171824 Ga0157371_101718242 343
72 3300013104 Ga0157370_10126241 Ga0157370_101262412 343
73 3300013307 Ga0157372_10398631 Ga0157372_103986311 343
74 3300014325 Ga0163163_10215421 Ga0163163_102154212 343
75 3300025924 Ga0207694_10234967 Ga0207694_102349671 343
76 3300026142 Ga0207698_10248745 Ga0207698_102487452 343
77 3300046660 Ga0495625_0026707 Ga0495625_0026707_1091_2167 343
78 3300003763 Ga0055529_1007355 Ga0055529_10073551 345
79 3300005364 Ga0070673_100077351 Ga0070673_1000773512 345
80 3300005457 Ga0070662_100193059 Ga0070662_1001930591 345
81 3300005548 Ga0070665_100021986 Ga0070665_1000219867 345
82 3300005548 Ga0070665_100058148 Ga0070665_1000581484 345
83 3300009148 Ga0105243_10357059 Ga0105243_103570591 345
84 3300009545 Ga0105237_10000166 Ga0105237_1000016664 345
85 3300025907 Ga0207645_10044660 Ga0207645_100446603 345
86 3300025914 Ga0207671_10001225 Ga0207671_1000122527 345
87 3300025919 Ga0207657_10109869 Ga0207657_101098692 345
88 3300025960 Ga0207651_10155239 Ga0207651_101552392 345
89 3300026121 Ga0207683_10260514 Ga0207683_102605142 345
90 3300028379 Ga0268266_10000167 Ga0268266_1000016737 345
91 3300041494 Ga0451837_1349150 Ga0451837_1349150_944_1993 346
92 3300046519 Ga0495632_0075397 Ga0495632_0075397_539_1588 346
93 3300048925 Ga0496122_0019118 Ga0496122_0019118_4826_5914 346
94 3300037471 Ga0395905_0264447 Ga0395905_0264447_517_1575 348
95 iso_pu_bacteria 2869234852 2869240394 348
96 iso_pu_bacteria 2874109183 2874110716 348
97 iso_pu_bacteria 2878730984 2878736437 348
98 3300046524 Ga0495648_0039319 Ga0495648_0039319_776_1873 349
99 3300046557 Ga0495622_0068226 Ga0495622_0068226_248_1345 349
100 3300053177 Ga0500636_0000027 Ga0500636_0000027_73057_74118 349
101 3300003187 JGI25151J46595_10000337 JGI25151J46595_1000033720 350
102 3300003215 JGI25153J46596_10002607 JGI25153J46596_100026079 350
103 3300025258 Ga0209129_1000852 Ga0209129_100085216 350
104 3300025294 Ga0209025_1000081 Ga0209025_100008139 350
105 3300025297 Ga0209758_1000076 Ga0209758_100007621 350
106 3300037471 Ga0395905_0004737 Ga0395905_0004737_2909_4006 350
107 3300039447 Ga0436361_0132518 Ga0436361_0132518_3471_4598 350
108 3300039453 Ga0436362_0058642 Ga0436362_0058642_337_1464 350
109 3300026067 Ga0207678_10151365 Ga0207678_101513653 351
110 3300028794 Ga0307515_10002668 Ga0307515_1000266817 351
111 3300031241 Ga0265325_10054699 Ga0265325_100546992 351
112 3300031456 Ga0307513_10248585 Ga0307513_102485852 351
113 3300037471 Ga0395905_0440241 Ga0395905_0440241_47_1171 351
114 3300039438 Ga0436360_1373735 Ga0436360_1373735_2474_3601 351
115 3300039447 Ga0436361_0515084 Ga0436361_0515084_5416_6543 351
116 3300048924 Ga0496121_0009765 Ga0496121_0009765_7021_8133 351
117 3300028794 Ga0307515_10036732 Ga0307515_100367324 352
118 3300039438 Ga0436360_0962767 Ga0436360_0962767_348_1469 352
119 3300039447 Ga0436361_0098242 Ga0436361_0098242_7118_8239 352
120 3300039453 Ga0436362_0670879 Ga0436362_0670879_375_1496 352
121 3300026089 Ga0207648_10107896 Ga0207648_101078962 353
122 3300044712 Ga0453684_0176386 Ga0453684_0176386_1256_2383 353
123 3300045051 Ga0451576_0111563 Ga0451576_0111563_1063_2190 353
124 3300049571 Ga0501034_0060336 Ga0501034_0060336_1466_2599 353
125 3300049574 Ga0501038_0193789 Ga0501038_0193789_22_1155 353
126 3300049822 Ga0501035_0045136 Ga0501035_0045136_2179_3312 353
127 3300049823 Ga0501044_0080084 Ga0501044_0080084_217_1350 353
128 3300053096 Ga0500641_0016324 Ga0500641_0016324_758_1852 353
129 3300053130 Ga0500642_0038938 Ga0500642_0038938_829_1923 353
130 3300003762 Ga0055542_1001465 Ga0055542_100146511 354
131 3300006038 Ga0075365_10051188 Ga0075365_100511883 354
132 3300025254 Ga0209148_1000302 Ga0209148_100030211 354
133 3300025272 Ga0209455_1000986 Ga0209455_100098613 354
134 3300031247 Ga0265340_10004901 Ga0265340_100049014 354
135 3300031247 Ga0265340_10005139 Ga0265340_100051392 354
136 3300031249 Ga0265339_10001383 Ga0265339_1000138312 354
137 3300031344 Ga0265316_10008989 Ga0265316_100089897 354
138 3300031595 Ga0265313_10003934 Ga0265313_100039349 354
139 iso_pu_bacteria 2643221653 2644300717 354
140 iso_pu_bacteria 2643221719 2644658939 354
141 3300039062 Ga0400483_226401 Ga0400483_226401_5230_6324 355
142 3300053093 Ga0500651_0016271 Ga0500651_0016271_2731_3831 355
143 3300053119 Ga0500595_001156 Ga0500595_001156_2899_3999 355
144 iso_pu_bacteria 2510917022 2511136993 355
145 iso_pu_bacteria 2513237104 2513721642 355
146 iso_pu_bacteria 2524023209 2524461547 355
147 iso_pu_bacteria 2582581307 2585272265 355
148 iso_pu_bacteria 2582581308 2585282645 355
149 iso_pu_bacteria 2582581315 2585327799 355
150 iso_pu_bacteria 2585427527 2585536858 355
151 iso_pu_bacteria 2585427530 2585555573 355
152 iso_pu_bacteria 2585427531 2585561671 355
153 iso_pu_bacteria 2585427608 2585899519 355
154 iso_pu_bacteria 2585427609 2585906899 355
155 iso_pu_bacteria 2585428125 2587982320 355
156 iso_pu_bacteria 2615840626 2616310184 355
157 iso_pu_bacteria 2615840698 2616551344 355
158 iso_pu_bacteria 2617270742 2617380895 355
159 iso_pu_bacteria 2667528174 2671114966 355
160 iso_pu_bacteria 2775507266 2778176902 355
161 iso_pu_bacteria 2818991448 2819607472 355
162 iso_pu_bacteria 2818991453 2819643892 355
163 iso_pu_bacteria 2838029111 2838031962 355
164 iso_pu_bacteria 2842298080 2842303127 355
165 iso_pu_bacteria 2842357229 2842361417 355
166 iso_pu_bacteria 2842475841 2842478694 355
167 iso_pu_bacteria 2842502639 2842505987 355
168 iso_pu_bacteria 2842509118 2842513586 355
169 iso_pu_bacteria 2919408235 2919411877 355
170 iso_pu_bacteria 3005416602 3005418097 355
171 iso_pu_bacteria 3005718088 3005718493 355
172 iso_pu_bacteria 8005314921 8005317942 355
173 iso_pu_bacteria 8005484373 8005486139 355
174 iso_pu_bacteria 8005645114 8005650963 355
175 iso_pu_bacteria 8005682033 8005688255 355
176 iso_pu_bacteria 8046767195 8046774468 355
177 3300005289 Ga0065704_10102170 Ga0065704_101021701 356
178 3300035695 Ga0373927_0000602 Ga0373927_0000602_3173_4255 356
179 3300037068 Ga0373925_0002089 Ga0373925_0002089_9836_10918 356
180 3300050494 nmdc:mga06z11_9642_c1 nmdc:mga06z11_9642_c1_1720_2805 356
181 3300050496 nmdc:mga07m45_5578_c1 nmdc:mga07m45_5578_c1_1919_3004 356
182 iso_pu_bacteria 2503198000 2503200916 356
183 iso_pu_bacteria 2509276021 2509390958 356
184 iso_pu_bacteria 2509276033 2509441884 356
185 iso_pu_bacteria 2510065019 2510137481 356
186 iso_pu_bacteria 2510461076 2510893379 356
187 iso_pu_bacteria 2513237084 2513572129 356
188 iso_pu_bacteria 2513237085 2513575961 356
189 iso_pu_bacteria 2513237088 2513595524 356
190 iso_pu_bacteria 2513237090 2513611504 356
191 iso_pu_bacteria 2513237093 2513633605 356
192 iso_pu_bacteria 2513237103 2513712195 356
193 iso_pu_bacteria 2513237144 2513913902 356
194 iso_pu_bacteria 2513237146 2513927859 356
195 iso_pu_bacteria 2513237159 2513999064 356
196 iso_pu_bacteria 2513237162 2514019170 356
197 iso_pu_bacteria 2513237164 2514035304 356
198 iso_pu_bacteria 2515075009 2515109552 356
199 iso_pu_bacteria 2515154113 2515634319 356
200 iso_pu_bacteria 2515154114 2515641802 356
201 iso_pu_bacteria 2515154116 2515658930 356
202 iso_pu_bacteria 2515154134 2515742627 356
203 iso_pu_bacteria 2516143018 2516208053 356
204 iso_pu_bacteria 2516653077 2517042619 356
205 iso_pu_bacteria 2516653085 2517081418 356
206 iso_pu_bacteria 2517093000 2517100199 356
207 iso_pu_bacteria 2517287029 2517411190 356
208 iso_pu_bacteria 2529292951 2530648621 356
209 iso_pu_bacteria 2582581299 2585233652 356
210 iso_pu_bacteria 2582581306 2585269250 356
211 iso_pu_bacteria 2582581865 2585390754 356
212 iso_pu_bacteria 2582581866 2585395044 356
213 iso_pu_bacteria 2585427526 2585526505 356
214 iso_pu_bacteria 2585427528 2585538799 356
215 iso_pu_bacteria 2585427590 2585825069 356
216 iso_pu_bacteria 2585427593 2585836750 356
217 iso_pu_bacteria 2599185170 2599416710 356
218 iso_pu_bacteria 2615840624 2616294331 356
219 iso_pu_bacteria 2643221558 2643814590 356
220 iso_pu_bacteria 2657244999 2657686210 356
221 iso_pu_bacteria 2690316117 2692319500 356
222 iso_pu_bacteria 2718217882 2719184179 356
223 iso_pu_bacteria 2718217927 2719389922 356
224 iso_pu_bacteria 2718217997 2719669522 356
225 iso_pu_bacteria 2718218009 2719729752 356
226 iso_pu_bacteria 2718218199 2720494538 356
227 iso_pu_bacteria 2718218232 2720610874 356
228 iso_pu_bacteria 2718218233 2720616752 356
229 iso_pu_bacteria 2718218235 2720628109 356
230 iso_pu_bacteria 2718218269 2720771689 356
231 iso_pu_bacteria 2718218363 2721144002 356
232 iso_pu_bacteria 2718218365 2721156690 356
233 iso_pu_bacteria 2718218366 2721161377 356
234 iso_pu_bacteria 2718218423 2721403561 356
235 iso_pu_bacteria 2721755514 2722837330 356
236 iso_pu_bacteria 2721755556 2723030952 356
237 iso_pu_bacteria 2721755684 2723563452 356
238 iso_pu_bacteria 2721755685 2723571443 356
239 iso_pu_bacteria 2721755809 2724035137 356
240 iso_pu_bacteria 2721755810 2724040906 356
241 iso_pu_bacteria 2721755819 2724087238 356
242 iso_pu_bacteria 2721755822 2724100949 356
243 iso_pu_bacteria 2721755823 2724108192 356
244 iso_pu_bacteria 2724679232 2725946356 356
245 iso_pu_bacteria 2728369352 2730105418 356
246 iso_pu_bacteria 2728369365 2730162319 356
247 iso_pu_bacteria 2728369397 2730295451 356
248 iso_pu_bacteria 2738541333 2739034221 356
249 iso_pu_bacteria 2751185821 2753459595 356
250 iso_pu_bacteria 2765235942 2766068255 356
251 iso_pu_bacteria 2791355082 2792583755 356
252 iso_pu_bacteria 2791355091 2792623310 356
253 iso_pu_bacteria 2791355092 2792629377 356
254 iso_pu_bacteria 2791355094 2792643736 356
255 iso_pu_bacteria 2791355256 2793295835 356
256 iso_pu_bacteria 2791355259 2793312777 356
257 iso_pu_bacteria 2791355260 2793321907 356
258 iso_pu_bacteria 2791355262 2793334670 356
259 iso_pu_bacteria 2791355263 2793340705 356
260 iso_pu_bacteria 2791355264 2793348628 356
261 iso_pu_bacteria 2791355265 2793354253 356
262 iso_pu_bacteria 2791355266 2793361799 356
263 iso_pu_bacteria 2791355267 2793367316 356
264 iso_pu_bacteria 2802429268 2804755093 356
265 iso_pu_bacteria 2802429605 2805929742 356
266 iso_pu_bacteria 2802429606 2805933090 356
267 iso_pu_bacteria 2802429633 2806043021 356
268 iso_pu_bacteria 2802429634 2806050974 356
269 iso_pu_bacteria 2802429635 2806057858 356
270 iso_pu_bacteria 2802429636 2806065426 356
271 iso_pu_bacteria 2802429637 2806075333 356
272 iso_pu_bacteria 2838016132 2838019587 356
273 iso_pu_bacteria 2838022645 2838028467 356
274 iso_pu_bacteria 2838035591 2838036819 356
275 iso_pu_bacteria 2838068647 2838072456 356
276 iso_pu_bacteria 2838661181 2838662146 356
277 iso_pu_bacteria 2838668709 2838669031 356
278 iso_pu_bacteria 2838680041 2838686106 356
279 iso_pu_bacteria 2838686498 2838688436 356
280 iso_pu_bacteria 2838694306 2838700523 356
281 iso_pu_bacteria 2838701080 2838701309 356
282 iso_pu_bacteria 2838707686 2838713802 356
283 iso_pu_bacteria 2838729681 2838734429 356
284 iso_pu_bacteria 2838742623 2838746888 356
285 iso_pu_bacteria 2841851746 2841852177 356
286 iso_pu_bacteria 2841864319 2841865705 356
287 iso_pu_bacteria 2842077413 2842083045 356
288 iso_pu_bacteria 2842110456 2842111648 356
289 iso_pu_bacteria 2842118031 2842124147 356
290 iso_pu_bacteria 2842146304 2842146626 356
291 iso_pu_bacteria 2842156927 2842158748 356
292 iso_pu_bacteria 2842163707 2842166177 356
293 iso_pu_bacteria 2842180545 2842182362 356
294 iso_pu_bacteria 2842192696 2842193980 356
295 iso_pu_bacteria 2842198810 2842204439 356
296 iso_pu_bacteria 2842217011 2842222499 356
297 iso_pu_bacteria 2842229732 2842234625 356
298 iso_pu_bacteria 2842237096 2842243215 356
299 iso_pu_bacteria 2842243621 2842248358 356
300 iso_pu_bacteria 2842250916 2842251144 356
301 iso_pu_bacteria 2842257432 2842262469 356
302 iso_pu_bacteria 2842271015 2842272614 356
303 iso_pu_bacteria 2842285085 2842289134 356
304 iso_pu_bacteria 2842291075 2842297304 356
305 iso_pu_bacteria 2842304105 2842307945 356
306 iso_pu_bacteria 2842317721 2842319393 356
307 iso_pu_bacteria 2842341865 2842345656 356
308 iso_pu_bacteria 2842363717 2842363950 356
309 iso_pu_bacteria 2842370503 2842376275 356
310 iso_pu_bacteria 2842377471 2842383698 356
311 iso_pu_bacteria 2842384541 2842390837 356
312 iso_pu_bacteria 2842402390 2842407340 356
313 iso_pu_bacteria 2842409023 2842413411 356
314 iso_pu_bacteria 2842415677 2842420054 356
315 iso_pu_bacteria 2842422224 2842426096 356
316 iso_pu_bacteria 2842428310 2842430240 356
317 iso_pu_bacteria 2842441272 2842442808 356
318 iso_pu_bacteria 2842462802 2842464684 356
319 iso_pu_bacteria 2842469257 2842470948 356
320 iso_pu_bacteria 2842489311 2842490742 356
321 iso_pu_bacteria 2842495871 2842498845 356
322 iso_pu_bacteria 2842521101 2842524808 356
323 iso_pu_bacteria 2844454524 2844461512 356
324 iso_pu_bacteria 2847670302 2847674448 356
325 iso_pu_bacteria 2847686936 2847690576 356
326 iso_pu_bacteria 2855872281 2855874901 356
327 iso_pu_bacteria 2856314179 2856317636 356
328 iso_pu_bacteria 2856349417 2856354206 356
329 iso_pu_bacteria 2856356410 2856357340 356
330 iso_pu_bacteria 2857516855 2857520666 356
331 iso_pu_bacteria 2871488783 2871489149 356
332 iso_pu_bacteria 2874102143 2874102704 356
333 iso_pu_bacteria 2878035449 2878038695 356
334 iso_pu_bacteria 2878753008 2878754623 356
335 iso_pu_bacteria 2881845957 2881849455 356
336 iso_pu_bacteria 2882912400 2882914241 356
337 iso_pu_bacteria 2885318864 2885324296 356
338 iso_pu_bacteria 2885342637 2885342759 356
339 iso_pu_bacteria 2885350715 2885356150 356
340 iso_pu_bacteria 2896384573 2896390462 356
341 iso_pu_bacteria 2903492973 2903495836 356
342 iso_pu_bacteria 2906328253 2906333443 356
343 iso_pu_bacteria 2906414383 2906417701 356
344 iso_pu_bacteria 2913295892 2913297039 356
345 iso_pu_bacteria 2922158528 2922163769 356
346 iso_pu_bacteria 2924726620 2924730206 356
347 iso_pu_bacteria 2924784321 2924790346 356
348 iso_pu_bacteria 2933016740 2933021171 356
349 iso_pu_bacteria 2933570622 2933574395 356
350 iso_pu_bacteria 2933586486 2933590854 356
351 iso_pu_bacteria 2935894831 2935900839 356
352 iso_pu_bacteria 2935901341 2935907663 356
353 iso_pu_bacteria 2936367885 2936370806 356
354 iso_pu_bacteria 2936381700 2936382502 356
355 iso_pu_bacteria 2958115193 2958115991 356
356 iso_pu_bacteria 2961127735 2961130509 356
357 iso_pu_bacteria 2961170736 2961171283 356
358 iso_pu_bacteria 2967996073 2967996211 356
359 iso_pu_bacteria 2968003550 2968004447 356
360 iso_pu_bacteria 2968091066 2968091592 356
361 iso_pu_bacteria 2968097103 2968097423 356
362 iso_pu_bacteria 2968128360 2968133437 356
363 iso_pu_bacteria 2970503327 2970503880 356
364 iso_pu_bacteria 2977821940 2977823840 356
365 iso_pu_bacteria 2977828996 2977835371 356
366 iso_pu_bacteria 2977858184 2977859520 356
367 iso_pu_bacteria 2979779861 2979783333 356
368 iso_pu_bacteria 2979808191 2979808513 356
369 iso_pu_bacteria 2996893221 2996894861 356
370 iso_pu_bacteria 3000135777 3000141529 356
371 iso_pu_bacteria 3004334049 3004336422 356
372 iso_pu_bacteria 3005452660 3005458386 356
373 iso_pu_bacteria 639633055 639650987 356
374 iso_pu_bacteria 643692032 643824089 356
375 iso_pu_bacteria 8004374579 8004376203 356
376 iso_pu_bacteria 8004703790 8004704357 356
377 iso_pu_bacteria 8005275841 8005276045 356
378 iso_pu_bacteria 8005282627 8005287282 356
379 iso_pu_bacteria 8005289223 8005289975 356
380 iso_pu_bacteria 8005307578 8005312019 356
381 iso_pu_bacteria 8005430974 8005435678 356
382 iso_pu_bacteria 8005460587 8005466183 356
383 iso_pu_bacteria 8005497431 8005503421 356
384 iso_pu_bacteria 8005556819 8005563311 356
385 iso_pu_bacteria 8005563573 8005564873 356
386 iso_pu_bacteria 8005570704 8005575872 356
387 iso_pu_bacteria 8005619151 8005625724 356
388 iso_pu_bacteria 8005626139 8005631981 356
389 iso_pu_bacteria 8005658619 8005661991 356
390 iso_pu_bacteria 8005668836 8005675299 356
391 iso_pu_bacteria 8005695170 8005695371 356
392 iso_pu_bacteria 8018127388 8018134646 356
393 iso_pu_bacteria 8018163183 8018169735 356
394 iso_pu_bacteria 8018176218 8018180629 356
395 iso_pu_bacteria 8023680758 8023686009 356
396 iso_pu_bacteria 8024486573 8024488886 356
397 iso_pu_bacteria 8024501048 8024507044 356
398 iso_pu_bacteria 8049293176 8049298129 356
399 iso_pu_bacteria 8054558443 8054562362 356
400 iso_pu_bacteria 8055431914 8055433180 356
401 iso_pu_bacteria 8056375014 8056381875 356
402 iso_pu_bacteria 8056382006 8056385392 356
403 iso_pu_bacteria 8057874678 8057876280 356
404 3300001979 JGI24740J21852_10001862 JGI24740J21852_100018629 357
405 3300002704 JGI25155J39150_1000047 JGI25155J39150_100004740 357
406 3300002705 JGI25156J39149_1000069 JGI25156J39149_100006942 357
407 3300002737 JGI25162J39368_1000184 JGI25162J39368_100018453 357
408 3300002738 JGI25154J39366_1000091 JGI25154J39366_100009132 357
409 3300002741 JGI25157J39369_1000085 JGI25157J39369_100008542 357
410 3300003214 JGI25165J46597_1001365 JGI25165J46597_10013654 357
411 3300003214 JGI25165J46597_1004512 JGI25165J46597_10045122 357
412 3300003322 rootL2_10000436 rootL2_100004363 357
413 3300005563 Ga0068855_100190036 Ga0068855_1001900362 357
414 3300005614 Ga0068856_100055320 Ga0068856_1000553202 357
415 3300009093 Ga0105240_10000214 Ga0105240_10000214111 357
416 3300009551 Ga0105238_10151369 Ga0105238_101513692 357
417 3300013105 Ga0157369_10275461 Ga0157369_102754612 357
418 3300015262 Ga0182007_10002152 Ga0182007_1000215210 357
419 3300025206 Ga0209435_100058 Ga0209435_10005833 357
420 3300025233 Ga0209437_100095 Ga0209437_100095211 357
421 3300025246 Ga0209646_1000178 Ga0209646_100017833 357
422 3300025246 Ga0209646_1002104 Ga0209646_10021043 357
423 3300025250 Ga0209026_1000208 Ga0209026_100020833 357
424 3300025256 Ga0209759_1000242 Ga0209759_100024233 357
425 3300025261 Ga0209233_1000117 Ga0209233_1000117211 357
426 3300025261 Ga0209233_1000340 Ga0209233_100034041 357
427 3300025272 Ga0209455_1014109 Ga0209455_10141092 357
428 3300025913 Ga0207695_10000373 Ga0207695_1000037394 357
429 3300025914 Ga0207671_10000536 Ga0207671_1000053636 357
430 3300039062 Ga0400483_257884 Ga0400483_257884_4291_5376 357
431 3300044765 Ga0466970_0000198 Ga0466970_0000198_18455_19549 357
432 3300048905 Ga0496102_0028748 Ga0496102_0028748_3804_4913 357
433 3300048919 Ga0496116_0113596 Ga0496116_0113596_432_1526 357
434 3300048922 Ga0496119_0029690 Ga0496119_0029690_1062_2156 357
435 3300048922 Ga0496119_0123034 Ga0496119_0123034_254_1348 357
436 3300048924 Ga0496121_0038387 Ga0496121_0038387_1437_2546 357
437 3300048925 Ga0496122_0039644 Ga0496122_0039644_2509_3603 357
438 3300048926 Ga0496123_0005115 Ga0496123_0005115_4142_5236 357
439 3300048926 Ga0496123_0020584 Ga0496123_0020584_3225_4319 357
440 3300048927 Ga0496124_0135938 Ga0496124_0135938_612_1706 357
441 3300048929 Ga0496126_0067822 Ga0496126_0067822_1185_2279 357
442 3300048929 Ga0496126_0121582 Ga0496126_0121582_242_1351 357
443 3300059491 Ga0587070_000574 Ga0587070_000574_428_1522 357
444 3300059493 Ga0587077_000356 Ga0587077_000356_2394_3488 357
445 3300059504 Ga0587082_008645 Ga0587082_008645_47_1141 357
446 3300059505 Ga0587083_0000386 Ga0587083_0000386_2310_3404 357
447 3300059605 Ga0587106_001676 Ga0587106_001676_390_1484 357
448 3300059640 Ga0587067_001845 Ga0587067_001845_934_2028 357
449 3300059642 Ga0587069_003507 Ga0587069_003507_216_1310 357
450 3300059643 Ga0587072_002568 Ga0587072_002568_591_1685 357
451 3300059645 Ga0587076_000152 Ga0587076_000152_2824_3918 357
452 3300059647 Ga0587079_004100 Ga0587079_004100_554_1648 357
453 3300059652 Ga0587107_002062 Ga0587107_002062_532_1626 357
454 iso_pu_bacteria 2791355261 2793326847 357
455 iso_pu_bacteria 2989776772 2989780889 357
456 iso_pu_bacteria 2995392953 2995396949 357
457 iso_pu_bacteria 8005382845 8005389329 357
458 iso_pu_bacteria 8005395548 8005396808 357
459 iso_pu_bacteria 8018150411 8018150860 357
460 3300003320 rootH2_10179271 rootH2_101792712 358
461 3300003322 rootL2_10103126 rootL2_101031262 358
462 3300003354 JGI25160J50197_1002870 JGI25160J50197_10028706 358
463 3300003790 Ga0055528_1000684 Ga0055528_10006846 358
464 3300004625 Ga0055543_1001035 Ga0055543_10010359 358
465 3300005539 Ga0068853_100007569 Ga0068853_1000075692 358
466 3300005548 Ga0070665_100088024 Ga0070665_1000880242 358
467 3300005616 Ga0068852_100015333 Ga0068852_1000153334 358
468 3300006038 Ga0075365_10001142 Ga0075365_1000114211 358
469 3300006048 Ga0075363_100057745 Ga0075363_1000577452 358
470 3300006178 Ga0075367_10138780 Ga0075367_101387801 358
471 3300006186 Ga0075369_10003358 Ga0075369_100033584 358
472 3300006195 Ga0075366_10011243 Ga0075366_100112434 358
473 3300006353 Ga0075370_10003011 Ga0075370_100030112 358
474 3300009093 Ga0105240_10006510 Ga0105240_100065106 358
475 3300009093 Ga0105240_10389744 Ga0105240_103897441 358
476 3300009098 Ga0105245_10011711 Ga0105245_100117112 358
477 3300009174 Ga0105241_10015771 Ga0105241_100157715 358
478 3300009176 Ga0105242_10238471 Ga0105242_102384712 358
479 3300009177 Ga0105248_10115954 Ga0105248_101159542 358
480 3300009545 Ga0105237_10001263 Ga0105237_100012636 358
481 3300009545 Ga0105237_10149483 Ga0105237_101494832 358
482 3300009551 Ga0105238_10118318 Ga0105238_101183182 358
483 3300009766 Ga0123342_1006034 Ga0123342_10060348 358
484 3300010375 Ga0105239_10028999 Ga0105239_100289995 358
485 3300014497 Ga0182008_10033468 Ga0182008_100334682 358
486 3300021320 Ga0214544_1000018 Ga0214544_1000018140 358
487 3300021321 Ga0214542_1000081 Ga0214542_1000081109 358
488 3300021327 Ga0214543_1000042 Ga0214543_1000042152 358
489 3300025273 Ga0209673_1000020 Ga0209673_1000020255 358
490 3300025273 Ga0209673_1000433 Ga0209673_100043324 358
491 3300025295 Ga0209564_1000114 Ga0209564_100011437 358
492 3300025295 Ga0209564_1000722 Ga0209564_100072231 358
493 3300025297 Ga0209758_1005376 Ga0209758_10053769 358
494 3300025297 Ga0209758_1024188 Ga0209758_10241882 358
495 3300025299 Ga0209256_1000123 Ga0209256_1000123145 358
496 3300025302 Ga0207426_1000169 Ga0207426_1000169116 358
497 3300025303 Ga0209051_1005173 Ga0209051_10051733 358
498 3300025304 Ga0209257_1044580 Ga0209257_10445801 358
499 3300025913 Ga0207695_10000008 Ga0207695_10000008387 358
500 3300025913 Ga0207695_10126396 Ga0207695_101263962 358
501 3300025927 Ga0207687_10051101 Ga0207687_100511012 358
502 3300025940 Ga0207691_10060866 Ga0207691_100608662 358
503 3300025941 Ga0207711_10278389 Ga0207711_102783891 358
504 3300026142 Ga0207698_10037111 Ga0207698_100371113 358
505 3300028379 Ga0268266_10089203 Ga0268266_100892033 358
506 3300028794 Ga0307515_10000136 Ga0307515_100001368 358
507 3300031456 Ga0307513_10002190 Ga0307513_1000219012 358
508 3300031548 Ga0307408_100091613 Ga0307408_1000916132 358
509 3300031730 Ga0307516_10031728 Ga0307516_100317283 358
510 3300037471 Ga0395905_0042537 Ga0395905_0042537_617_1714 358
511 3300038443 Ga0395901_0054907 Ga0395901_0054907_377_1474 358
512 3300041404 Ga0439436_0027158 Ga0439436_0027158_247_1347 358
513 3300041413 Ga0439465_0003714 Ga0439465_0003714_595_1695 358
514 3300046459 Ga0495629_0016512 Ga0495629_0016512_270_1373 358
515 3300046460 Ga0495638_0000163 Ga0495638_0000163_101621_102724 358
516 3300046476 Ga0495662_0004028 Ga0495662_0004028_2449_3552 358
517 3300046507 Ga0495606_0056182 Ga0495606_0056182_257_1360 358
518 3300046522 Ga0495643_0003443 Ga0495643_0003443_1434_2534 358
519 3300046529 Ga0495652_0075176 Ga0495652_0075176_1286_2389 358
520 3300046557 Ga0495622_0011296 Ga0495622_0011296_2456_3559 358
521 3300046660 Ga0495625_0021178 Ga0495625_0021178_3028_4128 358
522 3300046694 Ga0495649_0028625 Ga0495649_0028625_830_1930 358
523 3300046809 Ga0495600_0032387 Ga0495600_0032387_535_1638 358
524 3300047317 Ga0495604_0026324 Ga0495604_0026324_3093_4196 358
525 3300048915 Ga0496112_0012698 Ga0496112_0012698_2223_3320 358
526 3300048919 Ga0496116_0029189 Ga0496116_0029189_1575_2672 358
527 3300048924 Ga0496121_0069315 Ga0496121_0069315_398_1501 358
528 3300048927 Ga0496124_0004837 Ga0496124_0004837_4266_5369 358
529 3300048927 Ga0496124_0039341 Ga0496124_0039341_2483_3580 358
530 3300048929 Ga0496126_0000430 Ga0496126_0000430_20319_21416 358
531 3300048929 Ga0496126_0229554 Ga0496126_0229554_406_1518 358
532 3300050492 nmdc:mga0yw44_991_c1 nmdc:mga0yw44_991_c1_2199_3296 358
533 3300053085 Ga0495619_0022113 Ga0495619_0022113_2135_3238 358
534 3300053148 Ga0500590_000124 Ga0500590_000124_16292_17389 358
535 3300001979 JGI24740J21852_10000785 JGI24740J21852_100007856 359
536 3300047472 Ga0495686_0080823 Ga0495686_0080823_125_1219 359
537 3300053177 Ga0500636_0000679 Ga0500636_0000679_5853_6953 359
538 iso_pu_bacteria 2510065059 2510317078 359
539 iso_pu_bacteria 2513237305 2514418154 359
540 iso_pu_bacteria 2721755686 2723573563 359
541 iso_pu_bacteria 2869169390 2869175151 359
542 iso_pu_bacteria 2871481445 2871482900 359
543 iso_pu_bacteria 2874116593 2874119753 359
544 iso_pu_bacteria 2874168670 2874169147 359
545 iso_pu_bacteria 2876386047 2876388022 359
546 iso_pu_bacteria 2876420981 2876427741 359
547 iso_pu_bacteria 2882632389 2882640227 359
548 iso_pu_bacteria 2906401398 2906401993 359
549 iso_pu_bacteria 2924741084 2924744078 359
550 iso_pu_bacteria 2937861824 2937866816 359
551 iso_pu_bacteria 2937980651 2937986632 359
552 iso_pu_bacteria 2958108152 2958111992 359
553 iso_pu_bacteria 2961183825 2961186104 359
554 iso_pu_bacteria 2970510686 2970517034 359
555 iso_pu_bacteria 2970532167 2970535879 359
556 iso_pu_bacteria 2970627176 2970628777 359
557 iso_pu_bacteria 2977851361 2977856651 359
558 iso_pu_bacteria 2977864932 2977868555 359
559 iso_pu_bacteria 2977907340 2977909777 359
560 iso_pu_bacteria 2979764755 2979769918 359
561 iso_pu_bacteria 2979772303 2979774182 359
562 iso_pu_bacteria 3004232784 3004236083 359
563 iso_pu_bacteria 3004248173 3004249085 359
564 iso_pu_bacteria 8004727605 8004728652 359
565 3300010375 Ga0105239_10147777 Ga0105239_101477772 360
566 3300035695 Ga0373927_0199921 Ga0373927_0199921_149_1258 360
567 3300044658 Ga0466972_0012599 Ga0466972_0012599_1935_3053 360
568 3300044735 Ga0466968_0026429 Ga0466968_0026429_695_1813 360
569 3300049589 Ga0501073_0148313 Ga0501073_0148313_385_1482 360
570 3300049742 Ga0501080_0046462 Ga0501080_0046462_2719_3816 360
571 3300049823 Ga0501044_0074846 Ga0501044_0074846_284_1381 360
572 3300039062 Ga0400483_229691 Ga0400483_229691_1431_2537 361
573 3300044712 Ga0453684_0000738 Ga0453684_0000738_73400_74491 361
574 3300025230 Ga0209563_101038 Ga0209563_1010386 362
575 3300046507 Ga0495606_0014407 Ga0495606_0014407_728_1864 362
576 3300005548 Ga0070665_100013801 Ga0070665_1000138013 365
577 3300006038 Ga0075365_10011074 Ga0075365_100110745 365
578 3300028577 Ga0265318_10002153 Ga0265318_1000215312 365
579 3300031249 Ga0265339_10019694 Ga0265339_100196944 365
580 3300031250 Ga0265331_10058767 Ga0265331_100587672 365
581 3300031344 Ga0265316_10031416 Ga0265316_100314161 365
582 3300031595 Ga0265313_10006531 Ga0265313_100065316 365
583 3300031711 Ga0265314_10008301 Ga0265314_100083013 365
584 3300042876 Ga0451577_0005431 Ga0451577_0005431_10051_11202 365
585 3300042876 Ga0451577_0037972 Ga0451577_0037972_1394_2572 365
586 3300044712 Ga0453684_0090326 Ga0453684_0090326_70_1245 365
587 3300045051 Ga0451576_0006393 Ga0451576_0006393_4453_5604 365
588 3300049569 Ga0501032_0013550 Ga0501032_0013550_206_1339 365
589 3300049571 Ga0501034_0151658 Ga0501034_0151658_730_1863 365
590 3300049574 Ga0501038_0150508 Ga0501038_0150508_429_1562 365
591 3300049581 Ga0501047_0234198 Ga0501047_0234198_332_1465 365
592 3300049583 Ga0501067_0001020 Ga0501067_0001020_13870_15003 365
593 3300049586 Ga0501070_0181809 Ga0501070_0181809_487_1620 365
594 3300049589 Ga0501073_0023209 Ga0501073_0023209_1872_3005 365
595 3300049590 Ga0501074_0133099 Ga0501074_0133099_218_1351 365
596 3300049742 Ga0501080_0075057 Ga0501080_0075057_588_1721 365
597 3300049744 Ga0501083_0084351 Ga0501083_0084351_79_1212 365
598 3300049823 Ga0501044_0205985 Ga0501044_0205985_107_1240 365
599 3300050492 nmdc:mga0yw44_172637_c1 nmdc:mga0yw44_172637_c1_25_1158 365
600 3300054114 Ga0501084_0354941 Ga0501084_0354941_11_1144 365
601 3300060353 Ga0501082_0035572 Ga0501082_0035572_519_1652 365
602 iso_pu_bacteria 2599185178 2599444619 368
603 iso_pu_bacteria 2900577576 2900580008 368
604 3300045051 Ga0451576_0001359 Ga0451576_0001359_10834_11985 369
605 iso_pu_bacteria 2508501125 2509132310 370
606 iso_pu_bacteria 2513237151 2513958986 370
607 3300001915 JGI24741J21665_1000018 JGI24741J21665_100001813 372
608 3300001979 JGI24740J21852_10001535 JGI24740J21852_100015353 372
609 3300002705 JGI25156J39149_1004127 JGI25156J39149_10041273 372
610 3300002738 JGI25154J39366_1001228 JGI25154J39366_10012284 372
611 3300003752 Ga0055539_1000081 Ga0055539_1000081111 372
612 3300003756 Ga0055533_1001328 Ga0055533_10013283 372
613 3300003758 Ga0055532_1000048 Ga0055532_100004827 372
614 3300003759 Ga0055525_1000353 Ga0055525_100035329 372
615 3300003759 Ga0055525_1001152 Ga0055525_10011525 372
616 3300003760 Ga0055527_1000345 Ga0055527_100034516 372
617 3300003761 Ga0055535_1000035 Ga0055535_100003527 372
618 3300003762 Ga0055542_1000830 Ga0055542_10008302 372
619 3300003763 Ga0055529_1000411 Ga0055529_100041116 372
620 3300005344 Ga0070661_100000330 Ga0070661_10000033016 372
621 3300005455 Ga0070663_100000110 Ga0070663_10000011016 372
622 3300005564 Ga0070664_100000261 Ga0070664_10000026116 372
623 3300005578 Ga0068854_100000170 Ga0068854_10000017016 372
624 3300005614 Ga0068856_100002101 Ga0068856_10000210113 372
625 3300009174 Ga0105241_10047575 Ga0105241_100475752 372
626 3300013100 Ga0157373_10021751 Ga0157373_100217514 372
627 3300013102 Ga0157371_10000089 Ga0157371_10000089113 372
628 3300013104 Ga0157370_10000002 Ga0157370_10000002357 372
629 3300013307 Ga0157372_10000149 Ga0157372_1000014912 372
630 3300015261 Ga0182006_1013057 Ga0182006_10130573 372
631 3300025224 Ga0209784_100024 Ga0209784_100024332 372
632 3300025224 Ga0209784_100287 Ga0209784_10028714 372
633 3300025224 Ga0209784_100425 Ga0209784_10042510 372
634 3300025225 Ga0209566_100018 Ga0209566_100018332 372
635 3300025225 Ga0209566_100328 Ga0209566_1003288 372
636 3300025225 Ga0209566_101054 Ga0209566_1010547 372
637 3300025226 Ga0209674_100046 Ga0209674_10004631 372
638 3300025226 Ga0209674_100314 Ga0209674_10031422 372
639 3300025228 Ga0209672_100359 Ga0209672_1003592 372
640 3300025229 Ga0209147_100008 Ga0209147_10000847 372
641 3300025230 Ga0209563_100039 Ga0209563_10003931 372
642 3300025242 Ga0209258_100013 Ga0209258_10001347 372
643 3300025246 Ga0209646_1000027 Ga0209646_1000027194 372
644 3300025250 Ga0209026_1004229 Ga0209026_10042292 372
645 3300025253 Ga0209677_100024 Ga0209677_10002429 372
646 3300025254 Ga0209148_1000019 Ga0209148_1000019288 372
647 3300025254 Ga0209148_1005514 Ga0209148_10055142 372
648 3300025272 Ga0209455_1000042 Ga0209455_100004247 372
649 3300025913 Ga0207695_10004530 Ga0207695_1000453017 372
650 3300025920 Ga0207649_10000075 Ga0207649_1000007541 372
651 3300025945 Ga0207679_10000004 Ga0207679_10000004524 372
652 3300025981 Ga0207640_10000084 Ga0207640_1000008426 372
653 3300026067 Ga0207678_10000012 Ga0207678_10000012114 372
654 3300026078 Ga0207702_10000020 Ga0207702_10000020167 372
655 3300026116 Ga0207674_10009955 Ga0207674_100099554 372
656 3300037418 Ga0395900_0005053 Ga0395900_0005053_1459_2604 372
657 3300044650 Ga0466986_0019168 Ga0466986_0019168_1036_2154 372
658 3300048928 Ga0496125_0003952 Ga0496125_0003952_14438_15583 372

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

90

354

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qsq-assembly2.cif.gz_B permutated n-terminal lobe of the ribose binding protein from thermotoga maritima 0.8981 65 150
7pu4-assembly2.cif.gz_C crystal structure of the dimer rbp-n and rbp-trunc from thermotoga maritima ribose binding protein 0.8975 65 151
5dte-assembly4.cif.gz_D crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose 0.8807 65 346
4zjp-assembly1.cif.gz_A structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose 0.8736 63 342
7qsp-assembly1.cif.gz_B permutated c-terminal lobe of the ribose binding protein from thermotoga maritima 0.8735 191 285
ID Description Score Start End Superfamily
1dbpA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9136 171 309 3.40.50.2300
5ibqA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9099 172 346 3.40.50.2300
2x7xB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9014 174 285 3.40.50.2300
af_P39265_27_132_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.898 68 150 3.40.50.2300
1gudA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8935 171 342 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0S4X7D1-F1-model_v4 Putative signal peptide protein 0.9698 281 372
AF-A0A6H1K3J4-F1-model_v4 Substrate-binding domain-containing protein 0.9679 35 372 GO:0030246
GO:0030313
AF-A0A0S4X7D1-F1-model_v4 Putative signal peptide protein 0.9596 281 372
AF-A0A486XDB0-F1-model_v4 Uncharacterized protein 0.9433 240 371
AF-A0A387GVH1-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9404 29 372 GO:0030246
GO:0042597

Feature Viewer

pLDDT pTM Quality
88.26 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map