F472910

General Info

Members Datasets Scaffolds Average Seq Length
655 369 499 285

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100026661|Ga0068856_1000266615
Length 324
Sequence MADTVHGLYVCGRRVAAFKIDAPATGDSGALSCGRLEFVTDETLWPAPAKLNLFLHVTGRRPDGYHELQTVFQLIDLCDTIAISVRSDGRIERPDGPEGVDPESDLTVRAARALQQATGCTRLGATLRVRKRIPMGGGLGGGSSDAASVLLGLNDVWGCGLSIDALAKLGLPLGADVPVFVRGSSAWGEGVGENLQPLELPEVWYVVIHPGVHVGTKDVFQSPELTRNSPIITMRAFRESGGRNDCEPVVRGRFPAVAEALDWLGQFAPARLTGTGSCIFAPCATAIDAERIAARVPDRWTSYVARGLNTSPVHELLRTRSRSG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
8 2547132181 Kosakonia sacchari SP1 Isolate Stem
9 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
10 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
11 2561511199 Enterobacter sp. R4-368 Isolate Nodule
12 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
13 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
14 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
15 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
16 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
17 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
18 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
19 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
20 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
21 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
22 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
23 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
24 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
25 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
26 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
27 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
28 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
29 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
30 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
31 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
32 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
33 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
34 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
35 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
36 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
37 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
38 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
39 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
40 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
41 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
42 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
43 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
44 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
45 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
46 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
47 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
48 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
49 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
50 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
51 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
52 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
53 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
54 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
55 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
56 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
57 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
58 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
59 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
60 2636415599 Klebsiella variicola DX120E Isolate Unclassified
61 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
62 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
63 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
64 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
65 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
66 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
67 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
68 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
69 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
70 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
71 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
72 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
73 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
74 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
75 2751185917 Enterobacter sp. HK169 Isolate Unclassified
76 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
77 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
78 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
79 2775507074 Klebsiella sp. D5A Isolate Unclassified
80 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
81 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
82 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
83 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
84 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
85 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
86 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
87 2821118458 Enterobacter asburiae 609 Isolate Unclassified
88 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
89 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
90 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
91 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
92 2847085930 Erwinia persicina B64 Isolate Bulb
93 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
94 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
95 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
96 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
97 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
98 2865014394 Pantoea sp. R-71966 Isolate Unclassified
99 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
100 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
101 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
102 2876601092 Pantoea endophytica 596 Isolate Unclassified
103 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
104 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
105 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
106 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
107 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
108 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
109 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
110 2904504865 Serratia marcescens 1822 Isolate Unclassified
111 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
112 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
113 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
114 2919150387 Rahnella aceris 1817 Isolate Unclassified
115 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
116 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
117 2927143783 Rahnella sp. 2050 Isolate Unclassified
118 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
119 2932406140 Serratia sp. 2723 Isolate Rhizosphere
120 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
121 2937539931 Pantoea sp. LS15 Isolate Unclassified
122 2937967321 Serratia sp. YC16 Isolate Unclassified
123 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
124 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
125 2939577877 Serratia sp. 509 Isolate Rhizosphere
126 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
127 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
128 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
129 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
130 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
131 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
132 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
133 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
134 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
135 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
136 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
137 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
138 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
139 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
140 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
141 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
142 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
143 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
144 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
145 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
146 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
147 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
148 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
149 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
150 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
151 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
152 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
153 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
154 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
155 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
156 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
157 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
158 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
159 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
160 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
161 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
162 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
163 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
164 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
165 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
166 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
167 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
168 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
169 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
170 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
171 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
172 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
173 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
174 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
175 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
176 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
177 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
178 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
179 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
180 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
181 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
182 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
183 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
184 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
185 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
186 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
187 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
188 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
189 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
190 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
191 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
192 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
193 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
194 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
195 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
196 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
197 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
198 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
199 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
200 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
201 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
202 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
203 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
204 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
205 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
206 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
207 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
208 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
209 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
210 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
211 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
212 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
217 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
218 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
219 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
221 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
222 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
243 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
249 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
250 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
251 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
252 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
253 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
254 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
255 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
256 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
257 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
258 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
259 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
260 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
261 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
264 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
265 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
266 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
267 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
268 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
271 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
272 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
273 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
274 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
275 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
276 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
277 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
278 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
279 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
280 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
281 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
282 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
283 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
284 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
285 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
286 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
287 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
288 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
289 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
290 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
291 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
292 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
293 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
294 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
295 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
296 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
297 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
298 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
299 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
300 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
301 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
302 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
303 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
304 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
305 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
306 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
307 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
308 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
309 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
310 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
311 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
312 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
313 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
314 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
326 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
329 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
330 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
331 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
334 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
335 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
344 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
345 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
348 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
349 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
350 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
351 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
352 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
353 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
354 640753048 Serratia proteamaculans 568 Isolate Endosphere
355 8004592986 Serratia sp. S119 Isolate Unclassified
356 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
357 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
358 8018221730 Enterobacter sp. CM29 Isolate Unclassified
359 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
360 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
361 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
362 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
363 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
364 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
365 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
366 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
367 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
368 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
369 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.42
Metatranscriptomes 0.76
Isolates 23.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0.15
Endosphere 5.95
Nodule 2.29
Rhizoplane 10.53
Rhizosphere 57.56
Stem 0.15
Stem Tuber 0.92
Unclassified 21.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_542835 2162886007 Bacteria 923
2 SwRhRL2b_contig_848545 2162886007 Bacteria 7867
3 JGI24739J22299_10006022 3300001989 Bacteria 4591
4 JGI25162J39368_1000092 3300002737 Bacteria 100905
5 JGI25162J39368_1002339 3300002737 Bacteria 7538
6 JGI25163J39215_1000013 3300002771 Bacteria 86331
7 JGI25164J39214_1000071 3300002772 Bacteria 100905
8 JGI25152J39213_1000454 3300002773 Bacteria 23949
9 rootH2_10014261 3300003320 Bacteria 29701
10 rootL2_10197286 3300003322 Bacteria 1866
11 Ga0055538_1000064 3300003751 Bacteria 100905
12 Ga0055539_1000098 3300003752 Bacteria 100905
13 Ga0055533_1000108 3300003756 Bacteria 100905
14 Ga0055525_1000141 3300003759 Bacteria 100905
15 Ga0055541_1000065 3300003841 Bacteria 100905
16 Ga0058692_1000167 3300003856 Bacteria 40623
17 Ga0058692_1000217 3300003856 Bacteria 33952
18 Ga0058692_1002986 3300003856 Bacteria 5427
19 Ga0058692_1003434 3300003856 Bacteria 4885
20 Ga0058692_1009267 3300003856 Bacteria 2492
21 Ga0065703_1021070 3300005272 Bacteria 1411
22 Ga0065704_10000167 3300005289 Bacteria 10817
23 Ga0065704_10003176 3300005289 Bacteria 6789
24 Ga0065704_10085610 3300005289 Bacteria 3204
25 Ga0065704_10087825 3300005289 Bacteria 2991
26 Ga0070670_100055343 3300005331 Bacteria 3405
27 Ga0068869_100263826 3300005334 Bacteria 1379
28 Ga0070666_10108476 3300005335 Bacteria 1918
29 Ga0070668_100002531 3300005347 Bacteria 13458
30 Ga0070659_100046019 3300005366 Bacteria 3420
31 Ga0070701_10048002 3300005438 Bacteria 2201
32 Ga0070662_100139338 3300005457 Bacteria 1878
33 Ga0070681_10007227 3300005458 Bacteria 10834
34 Ga0070681_10015251 3300005458 Bacteria 7645
35 Ga0070681_10024175 3300005458 Bacteria 6117
36 Ga0070679_100047930 3300005530 Bacteria 4258
37 Ga0070679_100259664 3300005530 Bacteria 1692
38 Ga0070684_100231092 3300005535 Bacteria 1689
39 Ga0070665_100015617 3300005548 Bacteria 7627
40 Ga0070665_100068231 3300005548 Bacteria 3566
41 Ga0070665_100398798 3300005548 Bacteria 1383
42 Ga0068855_100139989 3300005563 Bacteria 2759
43 Ga0068857_100000865 3300005577 Bacteria 22751
44 Ga0068856_100016673 3300005614 Bacteria 7115
45 Ga0068856_100026661 3300005614 Bacteria 5635
46 Ga0068852_100435453 3300005616 Bacteria 1295
47 Ga0068859_100204074 3300005617 Bacteria 2062
48 Ga0068851_10097585 3300005834 Bacteria 1555
49 Ga0068870_10139582 3300005840 Bacteria 1417
50 Ga0068858_100019150 3300005842 Bacteria 6403
51 Ga0068860_100000951 3300005843 Bacteria 32020
52 Ga0068860_100631785 3300005843 Bacteria 1078
53 Ga0068862_100014522 3300005844 Bacteria 6537
54 Ga0075364_10008188 3300006051 Bacteria 6240
55 Ga0075364_10029706 3300006051 Bacteria 3506
56 Ga0075364_10062802 3300006051 Bacteria 2438
57 Ga0075364_10278320 3300006051 Bacteria 1138
58 Ga0075366_10010900 3300006195 Bacteria 5114
59 Ga0075430_100014711 3300006846 Bacteria 6667
60 Ga0097620_100204074 3300006931 Bacteria 2062
61 Ga0079104_1000062 3300006946 Bacteria 160162
62 Ga0079104_1000102 3300006946 Bacteria 124752
63 Ga0079104_1000442 3300006946 Bacteria 47153
64 Ga0079104_1000785 3300006946 Bacteria 26978
65 Ga0079104_1003208 3300006946 Bacteria 7881
66 Ga0079104_1004228 3300006946 Bacteria 6244
67 Ga0079104_1009787 3300006946 Bacteria 3220
68 Ga0099795_10000059 3300007788 Bacteria 20271
69 Ga0105251_10000667 3300009011 Bacteria 31648
70 Ga0105251_10001860 3300009011 Bacteria 17339
71 Ga0105251_10006802 3300009011 Bacteria 7211
72 Ga0105251_10018191 3300009011 Bacteria 3743
73 Ga0105251_10021828 3300009011 Bacteria 3335
74 Ga0105251_10021898 3300009011 Bacteria 3329
75 Ga0105251_10026428 3300009011 Bacteria 2956
76 Ga0105251_10044536 3300009011 Bacteria 2143
77 Ga0105251_10062078 3300009011 Bacteria 1756
78 Ga0105251_10123217 3300009011 Bacteria 1177
79 Ga0105244_10000047 3300009036 Bacteria 142097
80 Ga0105244_10000055 3300009036 Bacteria 130164
81 Ga0105244_10000127 3300009036 Bacteria 77802
82 Ga0105244_10001756 3300009036 Bacteria 17033
83 Ga0105244_10002459 3300009036 Bacteria 13950
84 Ga0105244_10003444 3300009036 Bacteria 11278
85 Ga0105244_10003488 3300009036 Bacteria 11181
86 Ga0105244_10012662 3300009036 Bacteria 4974
87 Ga0105244_10022544 3300009036 Bacteria 3466
88 Ga0105244_10060617 3300009036 Bacteria 1906
89 Ga0105244_10121228 3300009036 Bacteria 1266
90 Ga0105250_10000001 3300009092 Bacteria 617357
91 Ga0105250_10000272 3300009092 Bacteria 41925
92 Ga0105250_10000335 3300009092 Bacteria 36201
93 Ga0105250_10001080 3300009092 Bacteria 15441
94 Ga0105250_10001809 3300009092 Bacteria 11205
95 Ga0105250_10001985 3300009092 Bacteria 10597
96 Ga0105250_10002848 3300009092 Bacteria 8472
97 Ga0105250_10014729 3300009092 Bacteria 3207
98 Ga0105240_10001993 3300009093 Bacteria 33735
99 Ga0105240_10018455 3300009093 Bacteria 9366
100 Ga0105240_10110911 3300009093 Bacteria 3319
101 Ga0105240_10131561 3300009093 Unclassified 3000
102 Ga0105247_10000087 3300009101 Bacteria 99467
103 Ga0105241_10000002 3300009174 Bacteria 869480
104 Ga0105238_10163701 3300009551 Bacteria 2200
105 Ga0105238_10653175 3300009551 Bacteria 1062
106 Ga0099796_10000075 3300010159 Bacteria 17080
107 Ga0105239_10222071 3300010375 Bacteria 2119
108 Ga0105246_10033625 3300011119 Bacteria 3410
109 Ga0157373_10003760 3300013100 Bacteria 11478
110 Ga0157373_10083039 3300013100 Bacteria 2258
111 Ga0157373_10101427 3300013100 Bacteria 2025
112 Ga0157373_10114286 3300013100 Bacteria 1898
113 Ga0157371_10000008 3300013102 Bacteria 393028
114 Ga0157371_10000758 3300013102 Bacteria 37304
115 Ga0157371_10001887 3300013102 Bacteria 20969
116 Ga0157371_10060191 3300013102 Bacteria 2693
117 Ga0157371_10062545 3300013102 Bacteria 2638
118 Ga0157371_10167544 3300013102 Bacteria 1569
119 Ga0157370_10003676 3300013104 Bacteria 17919
120 Ga0157370_10004202 3300013104 Bacteria 16655
121 Ga0157370_10012645 3300013104 Bacteria 8743
122 Ga0157370_10635881 3300013104 Bacteria 976
123 Ga0157369_10116837 3300013105 Bacteria 2832
124 Ga0157374_10016457 3300013296 Bacteria 6501
125 Ga0157374_10267828 3300013296 Bacteria 1684
126 Ga0163162_10014126 3300013306 Bacteria 7805
127 Ga0163162_10284070 3300013306 Bacteria 1787
128 Ga0157372_10005933 3300013307 Bacteria 12988
129 Ga0157372_10009240 3300013307 Bacteria 10484
130 Ga0157372_10033176 3300013307 Bacteria 5668
131 Ga0157372_10108799 3300013307 Bacteria 3173
132 Ga0157372_10108812 3300013307 Bacteria 3173
133 Ga0157372_10125386 3300013307 Bacteria 2952
134 Ga0163163_10307657 3300014325 Bacteria 1637
135 Ga0182008_10004239 3300014497 Bacteria 8409
136 Ga0157379_10048145 3300014968 Bacteria 3805
137 Ga0182006_1000184 3300015261 Bacteria 64807
138 Ga0182006_1008695 3300015261 Bacteria 4596
139 Ga0183366_1001 3300015679 Bacteria 2743932
140 Ga0183370_1001 3300015680 Bacteria 2743932
141 Ga0183369_1001 3300015685 Bacteria 2743932
142 Ga0183368_1001 3300015687 Bacteria 2743932
143 Ga0163161_10000001 3300017792 Bacteria 2041488
144 Ga0163161_10006009 3300017792 Bacteria 8413
145 Ga0213876_10000030 3300021384 Bacteria 216610
146 Ga0209760_100078 3300025207 Bacteria 77832
147 Ga0209784_100001 3300025224 Bacteria 3600592
148 Ga0209566_100001 3300025225 Bacteria 3600765
149 Ga0209674_100002 3300025226 Bacteria 3600592
150 Ga0209563_100002 3300025230 Bacteria 2045675
151 Ga0207427_100020 3300025231 Bacteria 507515
152 Ga0209437_100001 3300025233 Bacteria 2045675
153 Ga0209437_100109 3300025233 Bacteria 217031
154 Ga0209437_100111 3300025233 Bacteria 214944
155 Ga0207425_1029429 3300025245 Bacteria 1107
156 Ga0209677_100002 3300025253 Bacteria 2045675
157 Ga0209129_1000004 3300025258 Bacteria 884499
158 Ga0209233_1005096 3300025261 Bacteria 4395
159 Ga0207696_1000001 3300025711 Bacteria 2579611
160 Ga0207696_1000015 3300025711 Bacteria 507848
161 Ga0207696_1000030 3300025711 Bacteria 395961
162 Ga0207696_1000062 3300025711 Bacteria 239603
163 Ga0207696_1000374 3300025711 Bacteria 44017
164 Ga0207696_1001131 3300025711 Bacteria 15448
165 Ga0207696_1001422 3300025711 Bacteria 13034
166 Ga0207696_1001979 3300025711 Bacteria 10396
167 Ga0207696_1002045 3300025711 Bacteria 10185
168 Ga0207696_1029004 3300025711 Bacteria 1693
169 Ga0207655_1000001 3300025728 Bacteria 1866413
170 Ga0207655_1000002 3300025728 Bacteria 1148694
171 Ga0207655_1000004 3300025728 Bacteria 1021221
172 Ga0207655_1000007 3300025728 Bacteria 773492
173 Ga0207655_1000037 3300025728 Bacteria 354473
174 Ga0207655_1000282 3300025728 Bacteria 77810
175 Ga0207655_1000676 3300025728 Bacteria 39882
176 Ga0207655_1000912 3300025728 Bacteria 30754
177 Ga0207655_1002246 3300025728 Bacteria 15981
178 Ga0207655_1004997 3300025728 Bacteria 9188
179 Ga0207655_1015997 3300025728 Bacteria 4133
180 Ga0207655_1043237 3300025728 Bacteria 1908
181 Ga0207713_1000001 3300025735 Bacteria 2295391
182 Ga0207713_1000004 3300025735 Bacteria 702781
183 Ga0207713_1000015 3300025735 Bacteria 424741
184 Ga0207713_1000027 3300025735 Bacteria 312621
185 Ga0207713_1000090 3300025735 Bacteria 151060
186 Ga0207713_1000291 3300025735 Bacteria 57789
187 Ga0207713_1006607 3300025735 Bacteria 7038
188 Ga0207713_1050525 3300025735 Bacteria 1659
189 Ga0207713_1057488 3300025735 Bacteria 1503
190 Ga0207710_10000344 3300025900 Bacteria 33974
191 Ga0207680_10182084 3300025903 Bacteria 1421
192 Ga0207654_10000005 3300025911 Bacteria 869492
193 Ga0207707_10011827 3300025912 Bacteria 7589
194 Ga0207707_10029567 3300025912 Bacteria 4792
195 Ga0207695_10012746 3300025913 Bacteria 10064
196 Ga0207695_10156883 3300025913 Unclassified 2210
197 Ga0207695_10286940 3300025913 Bacteria 1539
198 Ga0207660_10034275 3300025917 Bacteria 3517
199 Ga0207657_10241927 3300025919 Bacteria 1440
200 Ga0207652_10020034 3300025921 Bacteria 5508
201 Ga0207652_10041975 3300025921 Bacteria 3891
202 Ga0207650_10119934 3300025925 Bacteria 2046
203 Ga0207706_10207501 3300025933 Bacteria 1718
204 Ga0207661_10038253 3300025944 Bacteria 3759
205 Ga0207679_10246845 3300025945 Bacteria 1515
206 Ga0207667_10025330 3300025949 Bacteria 6495
207 Ga0207703_10002611 3300026035 Bacteria 15550
208 Ga0207703_10099395 3300026035 Bacteria 2463
209 Ga0207678_10024116 3300026067 Bacteria 5315
210 Ga0207702_10023653 3300026078 Bacteria 5096
211 Ga0207702_10230536 3300026078 Bacteria 1731
212 Ga0207674_10001989 3300026116 Bacteria 25903
213 Ga0209281_1000001 3300027111 Bacteria 1933496
214 Ga0209281_1000004 3300027111 Bacteria 1253949
215 Ga0209281_1000006 3300027111 Bacteria 1170244
216 Ga0209281_1000012 3300027111 Bacteria 684886
217 Ga0209281_1000027 3300027111 Bacteria 463409
218 Ga0209281_1000124 3300027111 Bacteria 202831
219 Ga0209281_1006374 3300027111 Bacteria 3092
220 Ga0209371_1000001 3300027312 Bacteria 2771503
221 Ga0209371_1000002 3300027312 Bacteria 1551985
222 Ga0209371_1000039 3300027312 Bacteria 350081
223 Ga0209371_1000057 3300027312 Bacteria 238850
224 Ga0209371_1000288 3300027312 Bacteria 57378
225 Ga0209371_1001114 3300027312 Bacteria 19870
226 Ga0209371_1001645 3300027312 Bacteria 14395
227 Ga0209371_1001780 3300027312 Bacteria 13512
228 Ga0209371_1001825 3300027312 Bacteria 13229
229 Ga0209371_1004474 3300027312 Bacteria 6054
230 Ga0209371_1007806 3300027312 Bacteria 3656
231 Ga0209371_1008259 3300027312 Bacteria 3493
232 Ga0209179_1000026 3300027512 Bacteria 36140
233 Ga0268266_10002057 3300028379 Bacteria 22308
234 Ga0268266_10002406 3300028379 Bacteria 20172
235 Ga0268266_10009479 3300028379 Bacteria 8567
236 Ga0268266_10066531 3300028379 Bacteria 3117
237 Ga0268265_10012475 3300028380 Bacteria 5759
238 Ga0268264_10000102 3300028381 Bacteria 222526
239 Ga0265334_10006437 3300028573 Bacteria 5057
240 Ga0265338_10019172 3300028800 Bacteria 7280
241 Ga0268256_1000001 3300030500 Bacteria 2771065
242 Ga0268256_1000002 3300030500 Bacteria 1535763
243 Ga0268256_1000033 3300030500 Bacteria 420973
244 Ga0268256_1000051 3300030500 Bacteria 283626
245 Ga0268256_1000084 3300030500 Bacteria 164658
246 Ga0268256_1000135 3300030500 Bacteria 101750
247 Ga0268256_1000368 3300030500 Bacteria 42777
248 Ga0268256_1001525 3300030500 Bacteria 13691
249 Ga0268256_1001593 3300030500 Bacteria 13220
250 Ga0268256_1002291 3300030500 Bacteria 9923
251 Ga0268256_1003662 3300030500 Bacteria 6791
252 Ga0268256_1003922 3300030500 Bacteria 6445
253 Ga0268256_1017476 3300030500 Bacteria 2018
254 Ga0268256_1027021 3300030500 Bacteria 1434
255 Ga0307511_10084427 3300030521 Bacteria 2204
256 Ga0265340_10085820 3300031247 Bacteria 1477
257 Ga0316575_10010894 3300031665 Bacteria 3354
258 Ga0316579_10092713 3300031691 Bacteria 1443
259 Ga0316576_10037840 3300031727 Bacteria 3456
260 Ga0316578_10020328 3300031728 Bacteria 3667
261 Ga0316578_10109693 3300031728 Bacteria 1657
262 Ga0316577_10008365 3300031733 Bacteria 5545
263 Ga0316577_10029911 3300031733 Bacteria 3039
264 Ga0316577_10094155 3300031733 Bacteria 1677
265 Ga0307415_100059794 3300032126 Bacteria 2630
266 Ga0316583_10002747 3300032133 Bacteria 6157
267 Ga0316585_10002083 3300032137 Bacteria 5369
268 Ga0316593_10000211 3300032168 Bacteria 9238
269 Ga0316593_10001109 3300032168 Bacteria 5678
270 Ga0316593_10006671 3300032168 Bacteria 3132
271 Ga0316593_10008684 3300032168 Bacteria 2843
272 Ga0316596_1000773 3300033541 Bacteria 5873
273 Ga0316574_0095050 3300035398 Bacteria 1904
274 Ga0316582_0005671 3300036647 Bacteria 6462
275 Ga0316582_0017857 3300036647 Bacteria 4113
276 Ga0316582_0018996 3300036647 Bacteria 4014
277 Ga0316582_0054504 3300036647 Bacteria 2546
278 Ga0316584_0000909 3300036712 Bacteria 16880
279 Ga0316584_0126861 3300036712 Bacteria 1905
280 Ga0316584_0230945 3300036712 Bacteria 1356
281 Ga0316581_0000050 3300037588 Bacteria 13380
282 Ga0400483_147287 3300039062 Bacteria 14126
283 Ga0400487_52377 3300039110 Bacteria 1604
284 Ga0436365_0368505 3300039437 Bacteria 454216
285 Ga0439438_000001 3300041405 Bacteria 1263568
286 Ga0439438_001496 3300041405 Bacteria 10302
287 Ga0439438_002615 3300041405 Bacteria 7607
288 Ga0439447_008194 3300041407 Bacteria 3253
289 Ga0439466_0000023 3300041411 Bacteria 84850
290 Ga0451853_3424606 3300041512 Bacteria 3784
291 Ga0439432_002553 3300042006 Bacteria 6867
292 Ga0439432_019921 3300042006 Bacteria 2232
293 Ga0439452_000001 3300042010 Bacteria 1725439
294 Ga0439452_000002 3300042010 Bacteria 1377577
295 Ga0439452_000016 3300042010 Bacteria 338131
296 Ga0439452_000025 3300042010 Bacteria 228862
297 Ga0439452_000304 3300042010 Bacteria 31635
298 Ga0439452_024005 3300042010 Bacteria 1563
299 Ga0450902_022908 3300042137 Bacteria 1036
300 Ga0450907_000118 3300042146 Bacteria 30301
301 Ga0439464_0000724 3300042439 Bacteria 7168
302 Ga0439464_0041724 3300042439 Bacteria 1309
303 Ga0450893_0007986 3300042532 Bacteria 1722
304 Ga0466969_0013717 3300044656 Bacteria 4266
305 Ga0466981_0000012 3300044669 Bacteria 130373
306 Ga0466966_0069076 3300044684 Bacteria 2217
307 Ga0466966_0094379 3300044684 Bacteria 1854
308 Ga0466964_0153961 3300044706 Bacteria 1068
309 Ga0453684_0029404 3300044712 Bacteria 7801
310 Ga0466971_0028344 3300044719 Bacteria 2505
311 Ga0466970_0228499 3300044765 Bacteria 1039
312 Ga0466957_0019452 3300044842 Bacteria 3994
313 Ga0466959_0044357 3300045049 Bacteria 3277
314 Ga0466959_0142387 3300045049 Bacteria 1693
315 Ga0495627_000093 3300046453 Bacteria 108767
316 Ga0495591_000007 3300046458 Bacteria 366385
317 Ga0495591_000077 3300046458 Bacteria 109433
318 Ga0495591_000757 3300046458 Bacteria 23325
319 Ga0495591_009014 3300046458 Bacteria 4014
320 Ga0495638_0000959 3300046460 Bacteria 29262
321 Ga0495650_0000005 3300046471 Bacteria 766553
322 Ga0495650_0000043 3300046471 Bacteria 357197
323 Ga0495650_0000187 3300046471 Bacteria 136554
324 Ga0495650_0063737 3300046471 Bacteria 1468
325 Ga0495584_0009851 3300046491 Bacteria 4914
326 Ga0495596_0005615 3300046500 Bacteria 5896
327 Ga0495607_0015819 3300046501 Bacteria 4881
328 Ga0495606_0002101 3300046507 Bacteria 24242
329 Ga0495606_0222947 3300046507 Bacteria 1061
330 Ga0495616_0016000 3300046513 Bacteria 4158
331 Ga0495620_0016261 3300046515 Bacteria 3740
332 Ga0495631_0050839 3300046518 Bacteria 1812
333 Ga0495643_0051948 3300046522 Bacteria 2203
334 Ga0495648_0001781 3300046524 Bacteria 20722
335 Ga0495648_0040166 3300046524 Bacteria 2969
336 Ga0495654_0000007 3300046530 Bacteria 403529
337 Ga0495654_0000376 3300046530 Bacteria 38544
338 Ga0495654_0002148 3300046530 Bacteria 12870
339 Ga0495654_0002498 3300046530 Bacteria 11817
340 Ga0495654_0019576 3300046530 Bacteria 3540
341 Ga0495597_0001308 3300046542 Bacteria 18264
342 Ga0495625_0001638 3300046660 Bacteria 26305
343 Ga0495588_0001947 3300046674 Bacteria 8807
344 Ga0495671_0148199 3300046692 Bacteria 1142
345 Ga0495649_0010372 3300046694 Bacteria 5501
346 Ga0495589_0000004 3300046794 Bacteria 439891
347 Ga0495589_0012640 3300046794 Bacteria 4367
348 Ga0495660_0000014 3300046810 Bacteria 337328
349 Ga0495660_0000139 3300046810 Bacteria 79059
350 Ga0495672_0000002 3300047320 Bacteria 740116
351 Ga0495672_0000020 3300047320 Bacteria 432845
352 Ga0495672_0000043 3300047320 Bacteria 266893
353 Ga0495687_054687 3300047443 Bacteria 1674
354 Ga0495679_000018 3300047446 Bacteria 239433
355 Ga0495679_003750 3300047446 Bacteria 7229
356 Ga0495679_004074 3300047446 Bacteria 6850
357 Ga0495673_0000007 3300047469 Bacteria 796722
358 Ga0495673_0000154 3300047469 Bacteria 121127
359 Ga0495681_0019893 3300047470 Bacteria 3653
360 Ga0496100_0024435 3300048903 Bacteria 3686
361 Ga0496100_0147885 3300048903 Bacteria 1672
362 Ga0496101_0000093 3300048904 Bacteria 95734
363 Ga0496101_0025692 3300048904 Bacteria 4088
364 Ga0496101_0525622 3300048904 Bacteria 935
365 Ga0496102_0018142 3300048905 Bacteria 6175
366 Ga0496102_0023716 3300048905 Bacteria 5452
367 Ga0496102_0326614 3300048905 Bacteria 1445
368 Ga0496103_0082744 3300048906 Bacteria 2020
369 Ga0496104_0003627 3300048907 Bacteria 13337
370 Ga0496105_0012333 3300048908 Bacteria 6767
371 Ga0496105_0065021 3300048908 Bacteria 3010
372 Ga0496105_0392223 3300048908 Bacteria 1103
373 Ga0496110_0314454 3300048913 Bacteria 1426
374 Ga0496116_0000001 3300048919 Bacteria 1501681
375 Ga0496116_0000268 3300048919 Bacteria 90912
376 Ga0496116_0000288 3300048919 Bacteria 85510
377 Ga0496116_0000442 3300048919 Bacteria 57847
378 Ga0496116_0003134 3300048919 Bacteria 16585
379 Ga0496116_0010425 3300048919 Bacteria 7786
380 Ga0496116_0016895 3300048919 Bacteria 5691
381 Ga0496116_0162717 3300048919 Bacteria 1222
382 Ga0496116_0163362 3300048919 Bacteria 1218
383 Ga0496116_0168766 3300048919 Bacteria 1188
384 Ga0496117_0000004 3300048920 Bacteria 877131
385 Ga0496117_0000165 3300048920 Bacteria 139029
386 Ga0496117_0000229 3300048920 Bacteria 105861
387 Ga0496117_0000388 3300048920 Bacteria 75480
388 Ga0496117_0006086 3300048920 Bacteria 12366
389 Ga0496117_0012199 3300048920 Bacteria 7603
390 Ga0496117_0017385 3300048920 Bacteria 6005
391 Ga0496117_0043123 3300048920 Bacteria 3284
392 Ga0496117_0051346 3300048920 Bacteria 2915
393 Ga0496117_0066525 3300048920 Bacteria 2444
394 Ga0496117_0103637 3300048920 Bacteria 1792
395 Ga0496117_0164553 3300048920 Bacteria 1295
396 Ga0496117_0182968 3300048920 Bacteria 1202
397 Ga0496118_0000016 3300048921 Bacteria 549586
398 Ga0496118_0000939 3300048921 Bacteria 45490
399 Ga0496118_0007670 3300048921 Bacteria 11350
400 Ga0496118_0012712 3300048921 Bacteria 8048
401 Ga0496118_0016051 3300048921 Bacteria 6894
402 Ga0496118_0017135 3300048921 Bacteria 6610
403 Ga0496118_0027780 3300048921 Bacteria 4779
404 Ga0496118_0028086 3300048921 Bacteria 4746
405 Ga0496118_0030212 3300048921 Bacteria 4526
406 Ga0496119_0000001 3300048922 Bacteria 789520
407 Ga0496119_0000064 3300048922 Bacteria 167571
408 Ga0496119_0000257 3300048922 Bacteria 75463
409 Ga0496119_0009019 3300048922 Bacteria 8653
410 Ga0496119_0010830 3300048922 Bacteria 7630
411 Ga0496119_0013513 3300048922 Bacteria 6494
412 Ga0496119_0063035 3300048922 Bacteria 2206
413 Ga0496119_0084668 3300048922 Bacteria 1817
414 Ga0496119_0165533 3300048922 Bacteria 1171
415 Ga0496120_0000067 3300048923 Bacteria 167571
416 Ga0496120_0000076 3300048923 Bacteria 163121
417 Ga0496120_0000116 3300048923 Bacteria 135302
418 Ga0496120_0000259 3300048923 Bacteria 88551
419 Ga0496120_0000444 3300048923 Bacteria 65596
420 Ga0496120_0001787 3300048923 Bacteria 24170
421 Ga0496120_0006275 3300048923 Bacteria 9168
422 Ga0496120_0028604 3300048923 Bacteria 3413
423 Ga0496120_0032733 3300048923 Bacteria 3131
424 Ga0496120_0073741 3300048923 Bacteria 1866
425 Ga0496121_0001180 3300048924 Bacteria 45697
426 Ga0496121_0005456 3300048924 Bacteria 16289
427 Ga0496121_0021701 3300048924 Bacteria 6276
428 Ga0496121_0032495 3300048924 Unclassified 4742
429 Ga0496121_0102372 3300048924 Bacteria 2206
430 Ga0496122_0000005 3300048925 Bacteria 630659
431 Ga0496122_0000562 3300048925 Bacteria 75980
432 Ga0496122_0001175 3300048925 Bacteria 44756
433 Ga0496122_0001559 3300048925 Bacteria 36262
434 Ga0496122_0006111 3300048925 Bacteria 14019
435 Ga0496122_0010865 3300048925 Bacteria 9321
436 Ga0496122_0032841 3300048925 Bacteria 4281
437 Ga0496122_0047055 3300048925 Bacteria 3333
438 Ga0496122_0125541 3300048925 Bacteria 1643
439 Ga0496122_0143595 3300048925 Bacteria 1488
440 Ga0496122_0144042 3300048925 Bacteria 1484
441 Ga0496123_0000008 3300048926 Bacteria 630628
442 Ga0496123_0000014 3300048926 Bacteria 433465
443 Ga0496123_0000422 3300048926 Bacteria 76364
444 Ga0496123_0000677 3300048926 Bacteria 56286
445 Ga0496123_0008937 3300048926 Bacteria 9111
446 Ga0496123_0026925 3300048926 Bacteria 4294
447 Ga0496123_0033461 3300048926 Bacteria 3698
448 Ga0496123_0038308 3300048926 Bacteria 3371
449 Ga0496123_0096773 3300048926 Bacteria 1731
450 Ga0496123_0111799 3300048926 Bacteria 1559
451 Ga0496123_0142377 3300048926 Bacteria 1308
452 Ga0496124_0000021 3300048927 Bacteria 432123
453 Ga0496124_0000059 3300048927 Bacteria 241949
454 Ga0496124_0000066 3300048927 Bacteria 222815
455 Ga0496124_0000107 3300048927 Bacteria 168020
456 Ga0496124_0000357 3300048927 Bacteria 83170
457 Ga0496124_0001151 3300048927 Bacteria 41493
458 Ga0496124_0037327 3300048927 Bacteria 4226
459 Ga0496124_0048823 3300048927 Bacteria 3613
460 Ga0496124_0403840 3300048927 Bacteria 947
461 Ga0496125_0000009 3300048928 Bacteria 677678
462 Ga0496125_0000033 3300048928 Bacteria 351850
463 Ga0496125_0000353 3300048928 Bacteria 86674
464 Ga0496125_0001151 3300048928 Bacteria 40080
465 Ga0496125_0114519 3300048928 Bacteria 1942
466 Ga0496125_0133928 3300048928 Bacteria 1737
467 Ga0496126_0000741 3300048929 Bacteria 59105
468 Ga0496126_0003074 3300048929 Bacteria 21591
469 Ga0496126_0039508 3300048929 Bacteria 4377
470 Ga0496126_0045562 3300048929 Bacteria 4030
471 Ga0496126_0098808 3300048929 Bacteria 2557
472 Ga0496126_0235630 3300048929 Bacteria 1531
473 Ga0495678_000182 3300049459 Bacteria 72657
474 Ga0495682_0000001 3300049460 Bacteria 1559116
475 Ga0501037_0006739 3300049573 Bacteria 8403
476 Ga0501037_0009752 3300049573 Bacteria 7050
477 Ga0501038_0013218 3300049574 Bacteria 7529
478 Ga0501043_0364627 3300049579 Bacteria 1096
479 Ga0501046_0047090 3300049580 Bacteria 3419
480 Ga0501069_0021653 3300049585 Bacteria 3492
481 Ga0501070_0030487 3300049586 Bacteria 4520
482 Ga0501070_0061352 3300049586 Bacteria 3115
483 Ga0501070_0107851 3300049586 Bacteria 2301
484 Ga0501074_0001806 3300049590 Bacteria 14649
485 Ga0501075_0298473 3300049591 Bacteria 1227
486 Ga0501080_0107516 3300049742 Bacteria 2585
487 nmdc:mga00v17_242931_c1 3300050491 Bacteria 1168
488 nmdc:mga00v17_43741_c1 3300050491 Bacteria 2698
489 nmdc:mga00v17_83259_c1 3300050491 Bacteria 2001
490 nmdc:mga0k408_29306_c1 3300050493 Bacteria 3132
491 nmdc:mga0qj67_80035_c1 3300050509 Bacteria 2617
492 Ga0500583_0070231 3300053092 Bacteria 1673
493 Ga0500572_012742 3300053111 Bacteria 2067
494 Ga0500595_019081 3300053119 Bacteria 2494
495 Ga0500621_000003 3300053126 Bacteria 596975
496 Ga0500655_020676 3300053133 Bacteria 1231
497 Ga0500637_0053811 3300053178 Bacteria 2298
498 Ga0466962_0060957 3300061719 Bacteria 1801
499 Ga0466962_0089817 3300061719 Bacteria 1471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0006739 Ga0501037_0006739_7514_8290 243
2 3300049590 Ga0501074_0001806 Ga0501074_0001806_7116_7892 243
3 3300049742 Ga0501080_0107516 Ga0501080_0107516_1303_2079 243
4 3300030521 Ga0307511_10084427 Ga0307511_100844272 248
5 3300044684 Ga0466966_0094379 Ga0466966_0094379_813_1622 252
6 3300044719 Ga0466971_0028344 Ga0466971_0028344_907_1716 252
7 3300044765 Ga0466970_0228499 Ga0466970_0228499_114_923 252
8 3300044842 Ga0466957_0019452 Ga0466957_0019452_105_914 252
9 3300061719 Ga0466962_0089817 Ga0466962_0089817_478_1287 252
10 3300044706 Ga0466964_0153961 Ga0466964_0153961_218_1027 255
11 3300045049 Ga0466959_0142387 Ga0466959_0142387_460_1269 255
12 3300005458 Ga0070681_10007227 Ga0070681_100072273 256
13 3300025912 Ga0207707_10011827 Ga0207707_100118276 256
14 3300007788 Ga0099795_10000059 Ga0099795_1000005913 257
15 3300010159 Ga0099796_10000075 Ga0099796_1000007513 257
16 3300027512 Ga0209179_1000026 Ga0209179_100002614 257
17 3300032168 Ga0316593_10001109 Ga0316593_100011095 259
18 3300049586 Ga0501070_0107851 Ga0501070_0107851_1223_2047 259
19 3300032126 Ga0307415_100059794 Ga0307415_1000597943 261
20 3300005458 Ga0070681_10024175 Ga0070681_100241755 262
21 3300005530 Ga0070679_100047930 Ga0070679_1000479305 262
22 3300006846 Ga0075430_100014711 Ga0075430_1000147117 262
23 3300025921 Ga0207652_10041975 Ga0207652_100419754 262
24 3300035398 Ga0316574_0095050 Ga0316574_0095050_832_1707 262
25 3300050509 nmdc:mga0qj67_80035_c1 nmdc:mga0qj67_80035_c1_1313_2167 262
26 3300009093 Ga0105240_10131561 Ga0105240_101315613 263
27 3300025913 Ga0207695_10156883 Ga0207695_101568832 263
28 3300044656 Ga0466969_0013717 Ga0466969_0013717_688_1590 263
29 3300044684 Ga0466966_0069076 Ga0466966_0069076_906_1808 263
30 3300045049 Ga0466959_0044357 Ga0466959_0044357_478_1380 263
31 3300049573 Ga0501037_0009752 Ga0501037_0009752_6069_6920 264
32 3300049580 Ga0501046_0047090 Ga0501046_0047090_1059_1910 264
33 3300049585 Ga0501069_0021653 Ga0501069_0021653_1543_2394 264
34 3300049586 Ga0501070_0061352 Ga0501070_0061352_1396_2247 264
35 3300049591 Ga0501075_0298473 Ga0501075_0298473_147_998 264
36 3300005614 Ga0068856_100016673 Ga0068856_1000166733 266
37 3300026035 Ga0207703_10099395 Ga0207703_100993952 266
38 3300026078 Ga0207702_10023653 Ga0207702_100236534 266
39 3300031691 Ga0316579_10092713 Ga0316579_100927132 266
40 3300031728 Ga0316578_10109693 Ga0316578_101096931 266
41 3300031733 Ga0316577_10008365 Ga0316577_100083655 266
42 3300031733 Ga0316577_10094155 Ga0316577_100941551 266
43 3300032168 Ga0316593_10000211 Ga0316593_100002116 266
44 3300036647 Ga0316582_0005671 Ga0316582_0005671_2824_3702 266
45 3300036647 Ga0316582_0018996 Ga0316582_0018996_2723_3604 266
46 3300036647 Ga0316582_0054504 Ga0316582_0054504_591_1499 266
47 3300036712 Ga0316584_0000909 Ga0316584_0000909_9141_10022 266
48 3300031665 Ga0316575_10010894 Ga0316575_100108943 267
49 3300031728 Ga0316578_10020328 Ga0316578_100203283 267
50 3300031733 Ga0316577_10029911 Ga0316577_100299114 267
51 3300032137 Ga0316585_10002083 Ga0316585_100020835 267
52 3300032168 Ga0316593_10008684 Ga0316593_100086843 267
53 3300039110 Ga0400487_52377 Ga0400487_52377_288_1127 267
54 3300049574 Ga0501038_0013218 Ga0501038_0013218_143_994 267
55 3300033541 Ga0316596_1000773 Ga0316596_10007732 268
56 3300036712 Ga0316584_0230945 Ga0316584_0230945_379_1215 268
57 3300044712 Ga0453684_0029404 Ga0453684_0029404_4311_5180 268
58 3300005458 Ga0070681_10015251 Ga0070681_100152513 269
59 3300005530 Ga0070679_100259664 Ga0070679_1002596641 269
60 3300009551 Ga0105238_10163701 Ga0105238_101637012 269
61 3300025912 Ga0207707_10029567 Ga0207707_100295673 269
62 3300025917 Ga0207660_10034275 Ga0207660_100342753 269
63 3300025921 Ga0207652_10020034 Ga0207652_100200343 269
64 3300025944 Ga0207661_10038253 Ga0207661_100382531 269
65 3300061719 Ga0466962_0060957 Ga0466962_0060957_160_1083 269
66 3300005563 Ga0068855_100139989 Ga0068855_1001399892 270
67 3300005843 Ga0068860_100631785 Ga0068860_1006317851 270
68 3300009093 Ga0105240_10001993 Ga0105240_1000199322 270
69 3300013296 Ga0157374_10267828 Ga0157374_102678282 270
70 3300025913 Ga0207695_10012746 Ga0207695_100127467 270
71 3300025949 Ga0207667_10025330 Ga0207667_100253305 270
72 3300028379 Ga0268266_10066531 Ga0268266_100665312 270
73 3300028800 Ga0265338_10019172 Ga0265338_100191722 270
74 3300032168 Ga0316593_10006671 Ga0316593_100066712 270
75 3300036647 Ga0316582_0017857 Ga0316582_0017857_486_1364 270
76 3300036712 Ga0316584_0126861 Ga0316584_0126861_485_1363 270
77 3300037588 Ga0316581_0000050 Ga0316581_0000050_8700_9578 270
78 3300009093 Ga0105240_10018455 Ga0105240_100184557 271
79 3300039062 Ga0400483_147287 Ga0400483_147287_3769_4662 271
80 3300005331 Ga0070670_100055343 Ga0070670_1000553433 272
81 3300005840 Ga0068870_10139582 Ga0068870_101395822 272
82 3300025925 Ga0207650_10119934 Ga0207650_101199343 272
83 3300025945 Ga0207679_10246845 Ga0207679_102468452 272
84 3300047470 Ga0495681_0019893 Ga0495681_0019893_90_950 272
85 3300003322 rootL2_10197286 rootL2_101972861 273
86 3300005842 Ga0068858_100019150 Ga0068858_1000191502 273
87 3300005844 Ga0068862_100014522 Ga0068862_1000145223 273
88 3300009036 Ga0105244_10022544 Ga0105244_100225442 273
89 3300009551 Ga0105238_10653175 Ga0105238_106531752 273
90 3300013296 Ga0157374_10016457 Ga0157374_100164573 273
91 3300014325 Ga0163163_10307657 Ga0163163_103076573 273
92 3300026035 Ga0207703_10002611 Ga0207703_100026119 273
93 3300028379 Ga0268266_10002057 Ga0268266_1000205716 273
94 3300028380 Ga0268265_10012475 Ga0268265_100124753 273
95 3300031727 Ga0316576_10037840 Ga0316576_100378402 273
96 3300046507 Ga0495606_0222947 Ga0495606_0222947_145_1002 273
97 3300047443 Ga0495687_054687 Ga0495687_054687_458_1315 273
98 3300048905 Ga0496102_0018142 Ga0496102_0018142_2624_3481 273
99 3300048906 Ga0496103_0082744 Ga0496103_0082744_888_1745 273
100 3300048919 Ga0496116_0016895 Ga0496116_0016895_4612_5469 273
101 3300048919 Ga0496116_0162717 Ga0496116_0162717_195_1049 273
102 3300048920 Ga0496117_0000229 Ga0496117_0000229_42030_42887 273
103 3300048921 Ga0496118_0000016 Ga0496118_0000016_435697_436554 273
104 3300048924 Ga0496121_0032495 Ga0496121_0032495_19_876 273
105 3300048926 Ga0496123_0008937 Ga0496123_0008937_2613_3467 273
106 3300048928 Ga0496125_0000353 Ga0496125_0000353_15851_16708 273
107 3300048929 Ga0496126_0045562 Ga0496126_0045562_182_1039 273
108 3300053092 Ga0500583_0070231 Ga0500583_0070231_721_1578 273
109 3300053111 Ga0500572_012742 Ga0500572_012742_1137_2003 273
110 3300053178 Ga0500637_0053811 Ga0500637_0053811_35_907 273
111 3300005334 Ga0068869_100263826 Ga0068869_1002638261 274
112 3300005335 Ga0070666_10108476 Ga0070666_101084762 274
113 3300005438 Ga0070701_10048002 Ga0070701_100480022 274
114 3300005535 Ga0070684_100231092 Ga0070684_1002310923 274
115 3300005548 Ga0070665_100068231 Ga0070665_1000682313 274
116 3300005616 Ga0068852_100435453 Ga0068852_1004354532 274
117 3300005617 Ga0068859_100204074 Ga0068859_1002040743 274
118 3300005843 Ga0068860_100000951 Ga0068860_10000095126 274
119 3300006931 Ga0097620_100204074 Ga0097620_1002040741 274
120 3300009093 Ga0105240_10110911 Ga0105240_101109113 274
121 3300010375 Ga0105239_10222071 Ga0105239_102220712 274
122 3300013306 Ga0163162_10284070 Ga0163162_102840702 274
123 3300014968 Ga0157379_10048145 Ga0157379_100481453 274
124 3300025903 Ga0207680_10182084 Ga0207680_101820842 274
125 3300025913 Ga0207695_10286940 Ga0207695_102869402 274
126 3300025919 Ga0207657_10241927 Ga0207657_102419272 274
127 3300026067 Ga0207678_10024116 Ga0207678_100241165 274
128 3300026078 Ga0207702_10230536 Ga0207702_102305362 274
129 3300028379 Ga0268266_10009479 Ga0268266_100094793 274
130 3300028381 Ga0268264_10000102 Ga0268264_10000102206 274
131 3300032133 Ga0316583_10002747 Ga0316583_100027476 274
132 3300049586 Ga0501070_0030487 Ga0501070_0030487_3229_4110 274
133 3300009092 Ga0105250_10014729 Ga0105250_100147293 275
134 3300027111 Ga0209281_1006374 Ga0209281_10063743 275
135 3300041405 Ga0439438_002615 Ga0439438_002615_5645_6514 275
136 iso_pu_bacteria 2971820967 2971823101 275
137 3300005548 Ga0070665_100398798 Ga0070665_1003987983 276
138 3300028573 Ga0265334_10006437 Ga0265334_100064375 276
139 3300031247 Ga0265340_10085820 Ga0265340_100858202 276
140 3300042137 Ga0450902_022908 Ga0450902_022908_43_912 276
141 3300048903 Ga0496100_0147885 Ga0496100_0147885_248_1117 276
142 3300048904 Ga0496101_0025692 Ga0496101_0025692_2328_3197 276
143 3300053119 Ga0500595_019081 Ga0500595_019081_64_942 276
144 3300053133 Ga0500655_020676 Ga0500655_020676_237_1157 276
145 3300005614 Ga0068856_100026661 Ga0068856_1000266615 277
146 3300009092 Ga0105250_10000001 Ga0105250_10000001276 277
147 3300025711 Ga0207696_1000015 Ga0207696_1000015453 277
148 3300049579 Ga0501043_0364627 Ga0501043_0364627_72_938 277
149 iso_pu_bacteria 2711768156 2712469974 277
150 iso_pu_bacteria 2919688452 2919691809 277
151 iso_pu_bacteria 2554235234 2555257336 279
152 iso_pu_bacteria 2599185169 2599408818 279
153 iso_pu_bacteria 2600255254 2601522668 279
154 iso_pu_bacteria 2600255255 2601527695 279
155 iso_pu_bacteria 2600255280 2601614526 279
156 iso_pu_bacteria 2600255281 2601619246 279
157 iso_pu_bacteria 2600255287 2601642140 279
158 iso_pu_bacteria 2600255288 2601646996 279
159 iso_pu_bacteria 2600255289 2601652673 279
160 iso_pu_bacteria 2600255290 2601657999 279
161 iso_pu_bacteria 2600255291 2601661962 279
162 iso_pu_bacteria 2600255298 2601694920 279
163 iso_pu_bacteria 2600255299 2601701883 279
164 iso_pu_bacteria 2600255300 2601706520 279
165 iso_pu_bacteria 2600255301 2601710824 279
166 iso_pu_bacteria 2600255302 2601715838 279
167 iso_pu_bacteria 2600255303 2601719947 279
168 iso_pu_bacteria 2600255304 2601726244 279
169 iso_pu_bacteria 2600255305 2601730785 279
170 iso_pu_bacteria 2600255306 2601735800 279
171 iso_pu_bacteria 2600255307 2601741066 279
172 iso_pu_bacteria 2600255309 2601750997 279
173 iso_pu_bacteria 2600255392 2602018250 279
174 iso_pu_bacteria 2602042052 2603661642 279
175 iso_pu_bacteria 2602042053 2603664599 279
176 iso_pu_bacteria 2602042103 2603838177 279
177 iso_pu_bacteria 2602042104 2603843255 279
178 iso_pu_bacteria 2602042105 2603848328 279
179 iso_pu_bacteria 2602042106 2603853401 279
180 iso_pu_bacteria 2602042110 2603871454 279
181 iso_pu_bacteria 2602042111 2603876376 279
182 iso_pu_bacteria 2603880178 2606048646 279
183 iso_pu_bacteria 2603880184 2606069029 279
184 iso_pu_bacteria 2603880202 2606144841 279
185 iso_pu_bacteria 2603880211 2606176048 279
186 iso_pu_bacteria 2636415599 2637224621 279
187 iso_pu_bacteria 2675903046 2676405957 279
188 iso_pu_bacteria 2775507074 2777022284 279
189 iso_pu_bacteria 2884086401 2884088553 279
190 iso_pu_bacteria 2904513164 2904514431 279
191 iso_pu_bacteria 2919108558 2919111594 279
192 iso_pu_bacteria 2939573065 2939573388 279
193 iso_pu_bacteria 2969079654 2969081664 279
194 iso_pu_bacteria 2984559226 2984564091 279
195 iso_pu_bacteria 2984595703 2984596825 279
196 iso_pu_bacteria 2585427591 2585828514 280
197 iso_pu_bacteria 2585427592 2585832942 280
198 iso_pu_bacteria 2602042109 2603867343 280
199 iso_pu_bacteria 2648501241 2649122524 280
200 iso_pu_bacteria 2651869818 2652976091 280
201 iso_pu_bacteria 2667528173 2671110542 280
202 iso_pu_bacteria 2904474040 2904477070 280
203 iso_pu_bacteria 2919150387 2919153237 280
204 iso_pu_bacteria 2927143783 2927143863 280
205 iso_pu_bacteria 8054357960 8054359784 280
206 3300042006 Ga0439432_002553 Ga0439432_002553_189_1058 281
207 iso_pu_bacteria 2511231035 2511437243 281
208 iso_pu_bacteria 2599185299 2599925384 281
209 iso_pu_bacteria 2608642108 2608669198 281
210 iso_pu_bacteria 2648501693 2650898719 281
211 iso_pu_bacteria 2684622997 2686353103 281
212 iso_pu_bacteria 2791354903 2791921589 281
213 iso_pu_bacteria 2808606414 2809123844 281
214 iso_pu_bacteria 2844528606 2844530731 281
215 iso_pu_bacteria 2847797336 2847800117 281
216 iso_pu_bacteria 2865014394 2865015020 281
217 iso_pu_bacteria 2881609920 2881612170 281
218 iso_pu_bacteria 2939602548 2939605675 281
219 iso_pu_bacteria 2945951305 2945953241 281
220 iso_pu_bacteria 2978975091 2978975762 281
221 iso_pu_bacteria 2984494565 2984496389 281
222 iso_pu_bacteria 2990261002 2990261810 281
223 3300027312 Ga0209371_1004474 Ga0209371_10044742 282
224 3300030500 Ga0268256_1003922 Ga0268256_10039222 282
225 iso_pu_bacteria 2888373701 2888377890 282
226 iso_pu_bacteria 8057304971 8057309190 282
227 2162886007 SwRhRL2b_contig_848545 SwRhRL2b_0485.00002360 283
228 3300002737 JGI25162J39368_1000092 JGI25162J39368_100009268 283
229 3300002771 JGI25163J39215_1000013 JGI25163J39215_100001351 283
230 3300002772 JGI25164J39214_1000071 JGI25164J39214_100007168 283
231 3300003751 Ga0055538_1000064 Ga0055538_100006468 283
232 3300003752 Ga0055539_1000098 Ga0055539_100009868 283
233 3300003756 Ga0055533_1000108 Ga0055533_100010868 283
234 3300003759 Ga0055525_1000141 Ga0055525_100014168 283
235 3300003841 Ga0055541_1000065 Ga0055541_100006523 283
236 3300005289 Ga0065704_10000167 Ga0065704_100001678 283
237 3300006946 Ga0079104_1000062 Ga0079104_1000062122 283
238 3300009011 Ga0105251_10062078 Ga0105251_100620782 283
239 3300009036 Ga0105244_10000047 Ga0105244_100000472 283
240 3300009036 Ga0105244_10000055 Ga0105244_1000005556 283
241 3300009036 Ga0105244_10001756 Ga0105244_1000175615 283
242 3300009092 Ga0105250_10000272 Ga0105250_100002729 283
243 3300009092 Ga0105250_10001080 Ga0105250_100010805 283
244 3300013102 Ga0157371_10000008 Ga0157371_10000008284 283
245 3300013104 Ga0157370_10004202 Ga0157370_100042025 283
246 3300013306 Ga0163162_10014126 Ga0163162_100141265 283
247 3300025207 Ga0209760_100078 Ga0209760_10007863 283
248 3300025224 Ga0209784_100001 Ga0209784_1000011866 283
249 3300025225 Ga0209566_100001 Ga0209566_1000011866 283
250 3300025226 Ga0209674_100002 Ga0209674_1000021866 283
251 3300025230 Ga0209563_100002 Ga0209563_100002401 283
252 3300025231 Ga0207427_100020 Ga0207427_100020376 283
253 3300025233 Ga0209437_100001 Ga0209437_100001401 283
254 3300025253 Ga0209677_100002 Ga0209677_100002401 283
255 3300025261 Ga0209233_1005096 Ga0209233_10050964 283
256 3300025711 Ga0207696_1000374 Ga0207696_100037412 283
257 3300025711 Ga0207696_1001131 Ga0207696_10011319 283
258 3300025728 Ga0207655_1000004 Ga0207655_1000004843 283
259 3300025728 Ga0207655_1000676 Ga0207655_100067637 283
260 3300025728 Ga0207655_1000912 Ga0207655_100091211 283
261 3300025735 Ga0207713_1000027 Ga0207713_1000027243 283
262 3300027111 Ga0209281_1000001 Ga0209281_1000001420 283
263 3300042532 Ga0450893_0007986 Ga0450893_0007986_256_1119 283
264 3300046471 Ga0495650_0000043 Ga0495650_0000043_68654_69517 283
265 3300046471 Ga0495650_0063737 Ga0495650_0063737_335_1186 283
266 3300046810 Ga0495660_0000014 Ga0495660_0000014_330000_330863 283
267 3300048919 Ga0496116_0000288 Ga0496116_0000288_6464_7327 283
268 3300048920 Ga0496117_0012199 Ga0496117_0012199_6471_7334 283
269 3300048920 Ga0496117_0066525 Ga0496117_0066525_1051_1902 283
270 3300048920 Ga0496117_0182968 Ga0496117_0182968_72_935 283
271 3300048921 Ga0496118_0016051 Ga0496118_0016051_797_1648 283
272 3300048921 Ga0496118_0030212 Ga0496118_0030212_245_1108 283
273 3300048922 Ga0496119_0010830 Ga0496119_0010830_5600_6451 283
274 3300048922 Ga0496119_0165533 Ga0496119_0165533_39_902 283
275 3300048923 Ga0496120_0006275 Ga0496120_0006275_4158_5021 283
276 3300048923 Ga0496120_0073741 Ga0496120_0073741_244_1095 283
277 3300048925 Ga0496122_0000562 Ga0496122_0000562_68650_69513 283
278 3300048925 Ga0496122_0143595 Ga0496122_0143595_286_1137 283
279 3300048926 Ga0496123_0000422 Ga0496123_0000422_6852_7715 283
280 3300048926 Ga0496123_0142377 Ga0496123_0142377_20_871 283
281 3300048927 Ga0496124_0000066 Ga0496124_0000066_56974_57837 283
282 3300048928 Ga0496125_0000009 Ga0496125_0000009_33726_34577 283
283 3300048928 Ga0496125_0000033 Ga0496125_0000033_273909_274772 283
284 3300048929 Ga0496126_0003074 Ga0496126_0003074_6344_7207 283
285 iso_pu_bacteria 2847085930 2847087907 283
286 iso_pu_bacteria 2871282230 2871283795 283
287 iso_pu_bacteria 2908669403 2908670159 283
288 iso_pu_bacteria 3000376612 3000379370 283
289 3300009011 Ga0105251_10000667 Ga0105251_1000066724 284
290 3300009092 Ga0105250_10000335 Ga0105250_1000033530 284
291 3300025711 Ga0207696_1000030 Ga0207696_1000030324 284
292 3300025735 Ga0207713_1000015 Ga0207713_100001562 284
293 3300048929 Ga0496126_0039508 Ga0496126_0039508_2830_3684 284
294 iso_pu_bacteria 2506520007 2506578004 284
295 iso_pu_bacteria 2506520008 2506583142 284
296 iso_pu_bacteria 2508501071 2508851975 284
297 iso_pu_bacteria 2547132181 2547695757 284
298 iso_pu_bacteria 2561511199 2562462448 284
299 iso_pu_bacteria 2600255256 2601533633 284
300 iso_pu_bacteria 2600255257 2601539715 284
301 iso_pu_bacteria 2600255310 2601758064 284
302 iso_pu_bacteria 2600255311 2601763684 284
303 iso_pu_bacteria 2602042046 2603637562 284
304 iso_pu_bacteria 2654587920 2656275363 284
305 iso_pu_bacteria 2687453601 2689444535 284
306 iso_pu_bacteria 2772190666 2772438554 284
307 iso_pu_bacteria 2791355010 2792310768 284
308 iso_pu_bacteria 2806310673 2807178213 284
309 iso_pu_bacteria 2811995292 2813728606 284
310 iso_pu_bacteria 2814123068 2814696124 284
311 iso_pu_bacteria 2869551831 2869553904 284
312 iso_pu_bacteria 2888366609 2888368619 284
313 iso_pu_bacteria 2904504865 2904507490 284
314 iso_pu_bacteria 2932406140 2932407909 284
315 iso_pu_bacteria 2935625433 2935626425 284
316 iso_pu_bacteria 2937967321 2937970349 284
317 iso_pu_bacteria 2939577877 2939580314 284
318 iso_pu_bacteria 2939617950 2939621356 284
319 iso_pu_bacteria 2974435778 2974438671 284
320 iso_pu_bacteria 640753048 640937525 284
321 iso_pu_bacteria 8004592986 8004595517 284
322 iso_pu_bacteria 8015394850 8015395464 284
323 iso_pu_bacteria 8019504834 8019508061 284
324 3300001989 JGI24739J22299_10006022 JGI24739J22299_100060222 285
325 3300002737 JGI25162J39368_1002339 JGI25162J39368_10023397 285
326 3300003856 Ga0058692_1000167 Ga0058692_10001671 285
327 3300003856 Ga0058692_1002986 Ga0058692_10029862 285
328 3300003856 Ga0058692_1003434 Ga0058692_10034345 285
329 3300003856 Ga0058692_1009267 Ga0058692_10092671 285
330 3300005347 Ga0070668_100002531 Ga0070668_1000025318 285
331 3300005457 Ga0070662_100139338 Ga0070662_1001393382 285
332 3300009011 Ga0105251_10001860 Ga0105251_100018602 285
333 3300009011 Ga0105251_10026428 Ga0105251_100264284 285
334 3300009011 Ga0105251_10044536 Ga0105251_100445362 285
335 3300009036 Ga0105244_10002459 Ga0105244_1000245911 285
336 3300009036 Ga0105244_10003444 Ga0105244_1000344414 285
337 3300009036 Ga0105244_10060617 Ga0105244_100606172 285
338 3300011119 Ga0105246_10033625 Ga0105246_100336254 285
339 3300013100 Ga0157373_10083039 Ga0157373_100830392 285
340 3300013100 Ga0157373_10101427 Ga0157373_101014272 285
341 3300013102 Ga0157371_10060191 Ga0157371_100601912 285
342 3300013104 Ga0157370_10003676 Ga0157370_100036766 285
343 3300013105 Ga0157369_10116837 Ga0157369_101168374 285
344 3300013307 Ga0157372_10005933 Ga0157372_100059338 285
345 3300013307 Ga0157372_10033176 Ga0157372_100331766 285
346 3300013307 Ga0157372_10108799 Ga0157372_101087991 285
347 3300013307 Ga0157372_10108812 Ga0157372_101088121 285
348 3300015261 Ga0182006_1008695 Ga0182006_10086952 285
349 3300017792 Ga0163161_10006009 Ga0163161_100060093 285
350 3300025233 Ga0209437_100109 Ga0209437_100109180 285
351 3300025233 Ga0209437_100111 Ga0209437_100111179 285
352 3300025711 Ga0207696_1001979 Ga0207696_10019796 285
353 3300025711 Ga0207696_1029004 Ga0207696_10290042 285
354 3300025728 Ga0207655_1000007 Ga0207655_1000007215 285
355 3300025728 Ga0207655_1002246 Ga0207655_10022464 285
356 3300025728 Ga0207655_1015997 Ga0207655_10159973 285
357 3300025728 Ga0207655_1043237 Ga0207655_10432372 285
358 3300025735 Ga0207713_1000001 Ga0207713_1000001833 285
359 3300025735 Ga0207713_1050525 Ga0207713_10505252 285
360 3300025735 Ga0207713_1057488 Ga0207713_10574882 285
361 3300025933 Ga0207706_10207501 Ga0207706_102075012 285
362 3300027312 Ga0209371_1000039 Ga0209371_1000039339 285
363 3300027312 Ga0209371_1000288 Ga0209371_10002882 285
364 3300027312 Ga0209371_1001645 Ga0209371_10016453 285
365 3300027312 Ga0209371_1001825 Ga0209371_10018258 285
366 3300027312 Ga0209371_1008259 Ga0209371_10082594 285
367 3300030500 Ga0268256_1000033 Ga0268256_100003323 285
368 3300030500 Ga0268256_1000051 Ga0268256_100005189 285
369 3300030500 Ga0268256_1000135 Ga0268256_100013561 285
370 3300030500 Ga0268256_1000368 Ga0268256_100036825 285
371 3300030500 Ga0268256_1001593 Ga0268256_10015937 285
372 3300030500 Ga0268256_1002291 Ga0268256_10022916 285
373 3300030500 Ga0268256_1003662 Ga0268256_10036622 285
374 3300041405 Ga0439438_001496 Ga0439438_001496_2513_3391 285
375 3300041411 Ga0439466_0000023 Ga0439466_0000023_33074_33931 285
376 3300042006 Ga0439432_019921 Ga0439432_019921_198_1055 285
377 3300042010 Ga0439452_000001 Ga0439452_000001_567025_567882 285
378 3300042146 Ga0450907_000118 Ga0450907_000118_11018_11875 285
379 3300042439 Ga0439464_0000724 Ga0439464_0000724_3032_3889 285
380 3300042439 Ga0439464_0041724 Ga0439464_0041724_404_1261 285
381 3300046458 Ga0495591_000007 Ga0495591_000007_359927_360784 285
382 3300046500 Ga0495596_0005615 Ga0495596_0005615_1163_2020 285
383 3300046524 Ga0495648_0001781 Ga0495648_0001781_1489_2346 285
384 3300046530 Ga0495654_0000007 Ga0495654_0000007_397064_397921 285
385 3300047320 Ga0495672_0000043 Ga0495672_0000043_201823_202680 285
386 3300047446 Ga0495679_003750 Ga0495679_003750_3421_4278 285
387 3300048905 Ga0496102_0023716 Ga0496102_0023716_1776_2633 285
388 3300048905 Ga0496102_0326614 Ga0496102_0326614_406_1263 285
389 3300048908 Ga0496105_0012333 Ga0496105_0012333_1427_2284 285
390 3300048913 Ga0496110_0314454 Ga0496110_0314454_251_1108 285
391 3300048919 Ga0496116_0000268 Ga0496116_0000268_2119_2976 285
392 3300048919 Ga0496116_0003134 Ga0496116_0003134_9836_10693 285
393 3300048919 Ga0496116_0168766 Ga0496116_0168766_167_1024 285
394 3300048920 Ga0496117_0000004 Ga0496117_0000004_167388_168245 285
395 3300048920 Ga0496117_0000165 Ga0496117_0000165_10148_11005 285
396 3300048920 Ga0496117_0000388 Ga0496117_0000388_18376_19233 285
397 3300048921 Ga0496118_0000939 Ga0496118_0000939_14130_14987 285
398 3300048921 Ga0496118_0007670 Ga0496118_0007670_285_1142 285
399 3300048921 Ga0496118_0017135 Ga0496118_0017135_220_1077 285
400 3300048922 Ga0496119_0000064 Ga0496119_0000064_67460_68317 285
401 3300048922 Ga0496119_0013513 Ga0496119_0013513_4075_4932 285
402 3300048923 Ga0496120_0000067 Ga0496120_0000067_99256_100113 285
403 3300048923 Ga0496120_0000116 Ga0496120_0000116_101927_102784 285
404 3300048924 Ga0496121_0001180 Ga0496121_0001180_6629_7486 285
405 3300048925 Ga0496122_0001559 Ga0496122_0001559_21082_21939 285
406 3300048925 Ga0496122_0144042 Ga0496122_0144042_220_1077 285
407 3300048926 Ga0496123_0026925 Ga0496123_0026925_2726_3583 285
408 3300048927 Ga0496124_0000107 Ga0496124_0000107_165591_166448 285
409 3300048927 Ga0496124_0000357 Ga0496124_0000357_10622_11479 285
410 3300048928 Ga0496125_0001151 Ga0496125_0001151_35535_36392 285
411 iso_pu_bacteria 2511231025 2511381300 285
412 iso_pu_bacteria 2547132416 2548648422 285
413 iso_pu_bacteria 2602042047 2603641816 285
414 iso_pu_bacteria 2602042066 2603698841 285
415 iso_pu_bacteria 2602042067 2603702518 285
416 iso_pu_bacteria 2609459761 2609910269 285
417 iso_pu_bacteria 2667528172 2671101695 285
418 iso_pu_bacteria 2671180115 2671584791 285
419 iso_pu_bacteria 2681812866 2681998365 285
420 iso_pu_bacteria 2681812869 2682005845 285
421 iso_pu_bacteria 2751185917 2753856411 285
422 iso_pu_bacteria 2765235842 2765589408 285
423 iso_pu_bacteria 2775506706 2775539452 285
424 iso_pu_bacteria 2791355275 2793405326 285
425 iso_pu_bacteria 2821118458 2821122581 285
426 iso_pu_bacteria 2823373977 2823375162 285
427 iso_pu_bacteria 2844425489 2844427892 285
428 iso_pu_bacteria 2846540461 2846543735 285
429 iso_pu_bacteria 2852103415 2852106575 285
430 iso_pu_bacteria 2876601092 2876603830 285
431 iso_pu_bacteria 2891670763 2891672950 285
432 iso_pu_bacteria 2923634449 2923635315 285
433 iso_pu_bacteria 2927833300 2927833700 285
434 iso_pu_bacteria 2937539931 2937541286 285
435 iso_pu_bacteria 2939568625 2939569473 285
436 iso_pu_bacteria 2939607340 2939609159 285
437 iso_pu_bacteria 2939642701 2939643504 285
438 iso_pu_bacteria 2945874760 2945878177 285
439 iso_pu_bacteria 2974310843 2974311682 285
440 iso_pu_bacteria 8016733728 8016735524 285
441 iso_pu_bacteria 8018221730 8018222615 285
442 iso_pu_bacteria 8018405270 8018407375 285
443 iso_pu_bacteria 8019499862 8019501088 285
444 iso_pu_bacteria 8054844752 8054845542 285
445 iso_pu_bacteria 8054849141 8054852944 285
446 iso_pu_bacteria 8055087960 8055090584 285
447 iso_pu_bacteria 8055092621 8055096759 285
448 iso_pu_bacteria 8055097453 8055098702 285
449 iso_pu_bacteria 8055693939 8055695818 285
450 3300006946 Ga0079104_1003208 Ga0079104_10032088 286
451 3300046458 Ga0495591_009014 Ga0495591_009014_2708_3568 286
452 3300046460 Ga0495638_0000959 Ga0495638_0000959_1475_2335 286
453 3300046515 Ga0495620_0016261 Ga0495620_0016261_2239_3099 286
454 3300046522 Ga0495643_0051948 Ga0495643_0051948_1020_1880 286
455 3300047446 Ga0495679_004074 Ga0495679_004074_5397_6257 286
456 iso_pu_bacteria 2537561728 2538424719 286
457 iso_pu_bacteria 2706794495 2707099185 286
458 iso_pu_bacteria 2854601825 2854602501 286
459 iso_pu_bacteria 2855195626 2855197211 286
460 iso_pu_bacteria 2858466076 2858468631 286
461 iso_pu_bacteria 2871272651 2871272950 286
462 iso_pu_bacteria 2900051742 2900051841 286
463 3300006946 Ga0079104_1000785 Ga0079104_10007857 287
464 3300013100 Ga0157373_10003760 Ga0157373_100037602 287
465 3300013102 Ga0157371_10000758 Ga0157371_1000075824 287
466 3300013307 Ga0157372_10125386 Ga0157372_101253863 287
467 3300027111 Ga0209281_1000012 Ga0209281_1000012427 287
468 3300027312 Ga0209371_1007806 Ga0209371_10078061 287
469 3300030500 Ga0268256_1017476 Ga0268256_10174763 287
470 3300041405 Ga0439438_000001 Ga0439438_000001_627584_628447 287
471 3300041407 Ga0439447_008194 Ga0439447_008194_1246_2109 287
472 3300046458 Ga0495591_000757 Ga0495591_000757_20696_21592 287
473 3300046471 Ga0495650_0000187 Ga0495650_0000187_129344_130240 287
474 3300046491 Ga0495584_0009851 Ga0495584_0009851_1806_2702 287
475 3300046501 Ga0495607_0015819 Ga0495607_0015819_2536_3432 287
476 3300046507 Ga0495606_0002101 Ga0495606_0002101_15739_16635 287
477 3300046513 Ga0495616_0016000 Ga0495616_0016000_1577_2473 287
478 3300046518 Ga0495631_0050839 Ga0495631_0050839_378_1274 287
479 3300046524 Ga0495648_0040166 Ga0495648_0040166_45_941 287
480 3300046530 Ga0495654_0000376 Ga0495654_0000376_31061_31957 287
481 3300046692 Ga0495671_0148199 Ga0495671_0148199_202_1098 287
482 3300046694 Ga0495649_0010372 Ga0495649_0010372_2097_2993 287
483 3300046794 Ga0495589_0012640 Ga0495589_0012640_418_1314 287
484 3300046810 Ga0495660_0000139 Ga0495660_0000139_48157_49053 287
485 3300047320 Ga0495672_0000002 Ga0495672_0000002_445272_446168 287
486 3300047469 Ga0495673_0000154 Ga0495673_0000154_70128_71024 287
487 3300048919 Ga0496116_0000442 Ga0496116_0000442_33772_34635 287
488 3300048922 Ga0496119_0000257 Ga0496119_0000257_74278_75141 287
489 3300048922 Ga0496119_0009019 Ga0496119_0009019_406_1269 287
490 3300048923 Ga0496120_0000076 Ga0496120_0000076_133892_134755 287
491 3300048923 Ga0496120_0000259 Ga0496120_0000259_63224_64087 287
492 3300049459 Ga0495678_000182 Ga0495678_000182_12935_13831 287
493 3300049460 Ga0495682_0000001 Ga0495682_0000001_1388299_1389195 287
494 3300053126 Ga0500621_000003 Ga0500621_000003_48513_49409 287
495 3300002773 JGI25152J39213_1000454 JGI25152J39213_10004545 288
496 3300003856 Ga0058692_1000217 Ga0058692_10002173 288
497 3300005272 Ga0065703_1021070 Ga0065703_10210702 288
498 3300006946 Ga0079104_1004228 Ga0079104_10042282 288
499 3300009011 Ga0105251_10018191 Ga0105251_100181913 288
500 3300009011 Ga0105251_10021828 Ga0105251_100218282 288
501 3300009011 Ga0105251_10021898 Ga0105251_100218982 288
502 3300009036 Ga0105244_10003488 Ga0105244_100034882 288
503 3300009092 Ga0105250_10001985 Ga0105250_1000198510 288
504 3300009101 Ga0105247_10000087 Ga0105247_1000008773 288
505 3300009174 Ga0105241_10000002 Ga0105241_10000002722 288
506 3300013100 Ga0157373_10114286 Ga0157373_101142862 288
507 3300013102 Ga0157371_10167544 Ga0157371_101675442 288
508 3300013307 Ga0157372_10009240 Ga0157372_100092402 288
509 3300014497 Ga0182008_10004239 Ga0182008_100042397 288
510 3300017792 Ga0163161_10000001 Ga0163161_10000001759 288
511 3300025245 Ga0207425_1029429 Ga0207425_10294291 288
512 3300025258 Ga0209129_1000004 Ga0209129_1000004493 288
513 3300025711 Ga0207696_1000001 Ga0207696_1000001837 288
514 3300025728 Ga0207655_1000037 Ga0207655_10000379 288
515 3300025735 Ga0207713_1000090 Ga0207713_100009051 288
516 3300025735 Ga0207713_1000291 Ga0207713_100029137 288
517 3300025735 Ga0207713_1006607 Ga0207713_10066075 288
518 3300025900 Ga0207710_10000344 Ga0207710_1000034413 288
519 3300025911 Ga0207654_10000005 Ga0207654_10000005720 288
520 3300027111 Ga0209281_1000027 Ga0209281_100002741 288
521 3300027312 Ga0209371_1000002 Ga0209371_1000002787 288
522 3300027312 Ga0209371_1000057 Ga0209371_1000057216 288
523 3300027312 Ga0209371_1001114 Ga0209371_100111417 288
524 3300027312 Ga0209371_1001780 Ga0209371_10017802 288
525 3300030500 Ga0268256_1000002 Ga0268256_1000002677 288
526 3300030500 Ga0268256_1000084 Ga0268256_100008416 288
527 3300030500 Ga0268256_1001525 Ga0268256_100152515 288
528 3300042010 Ga0439452_000016 Ga0439452_000016_95838_96704 288
529 3300042010 Ga0439452_024005 Ga0439452_024005_174_1040 288
530 3300046453 Ga0495627_000093 Ga0495627_000093_4795_5661 288
531 3300046530 Ga0495654_0002148 Ga0495654_0002148_6101_6967 288
532 3300046794 Ga0495589_0000004 Ga0495589_0000004_238348_239214 288
533 3300048908 Ga0496105_0392223 Ga0496105_0392223_184_1050 288
534 3300048919 Ga0496116_0000001 Ga0496116_0000001_244760_245626 288
535 3300048920 Ga0496117_0006086 Ga0496117_0006086_2148_3014 288
536 3300048920 Ga0496117_0051346 Ga0496117_0051346_1200_2066 288
537 3300048921 Ga0496118_0012712 Ga0496118_0012712_215_1081 288
538 3300048921 Ga0496118_0028086 Ga0496118_0028086_1200_2066 288
539 3300048922 Ga0496119_0000001 Ga0496119_0000001_341509_342375 288
540 3300048923 Ga0496120_0000444 Ga0496120_0000444_62442_63308 288
541 3300048923 Ga0496120_0028604 Ga0496120_0028604_1544_2410 288
542 3300048925 Ga0496122_0047055 Ga0496122_0047055_503_1369 288
543 3300048926 Ga0496123_0111799 Ga0496123_0111799_191_1057 288
544 3300048927 Ga0496124_0000021 Ga0496124_0000021_291591_292457 288
545 3300048927 Ga0496124_0000059 Ga0496124_0000059_114905_115771 288
546 3300048929 Ga0496126_0098808 Ga0496126_0098808_1173_2039 288
547 2162886007 SwRhRL2b_contig_542835 SwRhRL2b_0780.00000130 289
548 3300003320 rootH2_10014261 rootH2_1001426135 289
549 3300005289 Ga0065704_10003176 Ga0065704_100031768 289
550 3300005289 Ga0065704_10085610 Ga0065704_100856102 289
551 3300005289 Ga0065704_10087825 Ga0065704_100878251 289
552 3300005366 Ga0070659_100046019 Ga0070659_1000460192 289
553 3300005548 Ga0070665_100015617 Ga0070665_1000156179 289
554 3300005577 Ga0068857_100000865 Ga0068857_10000086517 289
555 3300005834 Ga0068851_10097585 Ga0068851_100975852 289
556 3300006051 Ga0075364_10008188 Ga0075364_100081888 289
557 3300006051 Ga0075364_10029706 Ga0075364_100297062 289
558 3300006051 Ga0075364_10062802 Ga0075364_100628022 289
559 3300006051 Ga0075364_10278320 Ga0075364_102783202 289
560 3300006195 Ga0075366_10010900 Ga0075366_100109004 289
561 3300006946 Ga0079104_1000102 Ga0079104_100010229 289
562 3300006946 Ga0079104_1000442 Ga0079104_100044246 289
563 3300006946 Ga0079104_1009787 Ga0079104_10097872 289
564 3300009011 Ga0105251_10006802 Ga0105251_100068026 289
565 3300009011 Ga0105251_10123217 Ga0105251_101232172 289
566 3300009036 Ga0105244_10000127 Ga0105244_1000012739 289
567 3300009036 Ga0105244_10012662 Ga0105244_100126622 289
568 3300009036 Ga0105244_10121228 Ga0105244_101212282 289
569 3300009092 Ga0105250_10001809 Ga0105250_100018095 289
570 3300009092 Ga0105250_10002848 Ga0105250_100028485 289
571 3300013102 Ga0157371_10001887 Ga0157371_100018872 289
572 3300013102 Ga0157371_10062545 Ga0157371_100625452 289
573 3300013104 Ga0157370_10012645 Ga0157370_1001264510 289
574 3300013104 Ga0157370_10635881 Ga0157370_106358811 289
575 3300015261 Ga0182006_1000184 Ga0182006_100018425 289
576 3300015679 Ga0183366_1001 Ga0183366_10011810 289
577 3300015680 Ga0183370_1001 Ga0183370_10011810 289
578 3300015685 Ga0183369_1001 Ga0183369_10011810 289
579 3300015687 Ga0183368_1001 Ga0183368_10011810 289
580 3300021384 Ga0213876_10000030 Ga0213876_1000003034 289
581 3300025711 Ga0207696_1000062 Ga0207696_1000062121 289
582 3300025711 Ga0207696_1001422 Ga0207696_10014224 289
583 3300025711 Ga0207696_1002045 Ga0207696_10020455 289
584 3300025728 Ga0207655_1000001 Ga0207655_10000011687 289
585 3300025728 Ga0207655_1000002 Ga0207655_1000002753 289
586 3300025728 Ga0207655_1000282 Ga0207655_100028242 289
587 3300025728 Ga0207655_1004997 Ga0207655_10049976 289
588 3300025735 Ga0207713_1000004 Ga0207713_1000004431 289
589 3300026116 Ga0207674_10001989 Ga0207674_100019895 289
590 3300027111 Ga0209281_1000004 Ga0209281_1000004736 289
591 3300027111 Ga0209281_1000006 Ga0209281_1000006528 289
592 3300027111 Ga0209281_1000124 Ga0209281_100012498 289
593 3300027312 Ga0209371_1000001 Ga0209371_10000011837 289
594 3300028379 Ga0268266_10002406 Ga0268266_1000240616 289
595 3300030500 Ga0268256_1000001 Ga0268256_1000001804 289
596 3300030500 Ga0268256_1027021 Ga0268256_10270212 289
597 3300039437 Ga0436365_0368505 Ga0436365_0368505_194642_195511 289
598 3300041512 Ga0451853_3424606 Ga0451853_3424606_1222_2091 289
599 3300042010 Ga0439452_000002 Ga0439452_000002_827473_828342 289
600 3300042010 Ga0439452_000025 Ga0439452_000025_97203_98072 289
601 3300042010 Ga0439452_000304 Ga0439452_000304_30566_31435 289
602 3300044669 Ga0466981_0000012 Ga0466981_0000012_30095_30964 289
603 3300046458 Ga0495591_000077 Ga0495591_000077_20718_21587 289
604 3300046471 Ga0495650_0000005 Ga0495650_0000005_11415_12284 289
605 3300046530 Ga0495654_0002498 Ga0495654_0002498_2532_3401 289
606 3300046530 Ga0495654_0019576 Ga0495654_0019576_784_1653 289
607 3300046542 Ga0495597_0001308 Ga0495597_0001308_6379_7248 289
608 3300046660 Ga0495625_0001638 Ga0495625_0001638_22854_23723 289
609 3300046674 Ga0495588_0001947 Ga0495588_0001947_3998_4867 289
610 3300047320 Ga0495672_0000020 Ga0495672_0000020_279667_280536 289
611 3300047446 Ga0495679_000018 Ga0495679_000018_25674_26543 289
612 3300047469 Ga0495673_0000007 Ga0495673_0000007_466930_467799 289
613 3300048903 Ga0496100_0024435 Ga0496100_0024435_1417_2286 289
614 3300048904 Ga0496101_0000093 Ga0496101_0000093_3676_4545 289
615 3300048904 Ga0496101_0525622 Ga0496101_0525622_36_911 289
616 3300048907 Ga0496104_0003627 Ga0496104_0003627_4435_5304 289
617 3300048908 Ga0496105_0065021 Ga0496105_0065021_575_1444 289
618 3300048919 Ga0496116_0010425 Ga0496116_0010425_2627_3496 289
619 3300048919 Ga0496116_0163362 Ga0496116_0163362_275_1144 289
620 3300048920 Ga0496117_0017385 Ga0496117_0017385_4913_5782 289
621 3300048920 Ga0496117_0043123 Ga0496117_0043123_2193_3062 289
622 3300048920 Ga0496117_0103637 Ga0496117_0103637_706_1575 289
623 3300048920 Ga0496117_0164553 Ga0496117_0164553_229_1098 289
624 3300048921 Ga0496118_0027780 Ga0496118_0027780_3219_4088 289
625 3300048922 Ga0496119_0063035 Ga0496119_0063035_51_920 289
626 3300048922 Ga0496119_0084668 Ga0496119_0084668_257_1126 289
627 3300048923 Ga0496120_0001787 Ga0496120_0001787_12707_13576 289
628 3300048923 Ga0496120_0032733 Ga0496120_0032733_1557_2426 289
629 3300048924 Ga0496121_0005456 Ga0496121_0005456_10166_11035 289
630 3300048924 Ga0496121_0021701 Ga0496121_0021701_5200_6069 289
631 3300048924 Ga0496121_0102372 Ga0496121_0102372_632_1501 289
632 3300048925 Ga0496122_0000005 Ga0496122_0000005_623624_624493 289
633 3300048925 Ga0496122_0001175 Ga0496122_0001175_7986_8855 289
634 3300048925 Ga0496122_0006111 Ga0496122_0006111_11640_12509 289
635 3300048925 Ga0496122_0010865 Ga0496122_0010865_6447_7316 289
636 3300048925 Ga0496122_0032841 Ga0496122_0032841_1407_2276 289
637 3300048925 Ga0496122_0125541 Ga0496122_0125541_70_939 289
638 3300048926 Ga0496123_0000008 Ga0496123_0000008_6136_7005 289
639 3300048926 Ga0496123_0000014 Ga0496123_0000014_259526_260395 289
640 3300048926 Ga0496123_0000677 Ga0496123_0000677_45264_46133 289
641 3300048926 Ga0496123_0033461 Ga0496123_0033461_824_1693 289
642 3300048926 Ga0496123_0038308 Ga0496123_0038308_2433_3302 289
643 3300048926 Ga0496123_0096773 Ga0496123_0096773_40_909 289
644 3300048927 Ga0496124_0001151 Ga0496124_0001151_766_1635 289
645 3300048927 Ga0496124_0037327 Ga0496124_0037327_2840_3709 289
646 3300048927 Ga0496124_0048823 Ga0496124_0048823_2520_3389 289
647 3300048927 Ga0496124_0403840 Ga0496124_0403840_52_921 289
648 3300048928 Ga0496125_0114519 Ga0496125_0114519_301_1170 289
649 3300048928 Ga0496125_0133928 Ga0496125_0133928_821_1690 289
650 3300048929 Ga0496126_0000741 Ga0496126_0000741_30478_31347 289
651 3300048929 Ga0496126_0235630 Ga0496126_0235630_39_908 289
652 3300050491 nmdc:mga00v17_242931_c1 nmdc:mga00v17_242931_c1_42_911 289
653 3300050491 nmdc:mga00v17_43741_c1 nmdc:mga00v17_43741_c1_536_1405 289
654 3300050491 nmdc:mga00v17_83259_c1 nmdc:mga00v17_83259_c1_201_1070 289
655 3300050493 nmdc:mga0k408_29306_c1 nmdc:mga0k408_29306_c1_672_1541 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00288

GHMP_kinases_N

GHMP kinases N terminal domain

105

184

0.96

PF08544

GHMP_kinases_C

GHMP kinases C terminal

224

302

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ww4-assembly1.cif.gz_B a triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase 0.9825 1 281
2ww4-assembly1.cif.gz_B a triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase 0.9757 1 281
1uek-assembly1.cif.gz_A crystal structure of 4-(cytidine 5'-diphospho)-2c-methyl-d-erythritol kinase 0.8852 3 272
1uek-assembly1.cif.gz_A crystal structure of 4-(cytidine 5'-diphospho)-2c-methyl-d-erythritol kinase 0.8726 3 272
4emd-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to cmp and so4 0.8465 1 276
ID Description Score Start End Superfamily
1oj4B01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9818 3 164 3.30.230.10
2ww4A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.9796 165 282 3.30.70.890
1oj4B01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9697 3 164 3.30.230.10
2ww4A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.9636 165 282 3.30.70.890
1uekA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.928 3 164 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A377DUA2-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9969 1 198 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A9MP98-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9921 1 282 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-B5R921-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9919 1 282 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A0A377DUA2-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9919 1 198 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A0A2T1LLA2-F1-model_v4 deleted 0.9915 1 282

Feature Viewer

pLDDT pTM Quality
93.67 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map