F472766

General Info

Members Datasets Scaffolds Average Seq Length
653 248 1306 376

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10004907|Ga0207689_1000490712
Length 463
Sequence MTKRIKRRDFIRTSAAAGLTLAGTKASVLQFPNIIVQGAVKPIVVSSANGNKFKHDGNVTAVQKAFTMITQGADVLDAVIAGVNIVELDPLDDSVGYGGLPNAEGVVQLDSSCMHGPKKRAGAVGALEGVRTPSLVAKAVLETTDHHLLVGKGAQDFARNMGFKIEDDLNTEHSRELWLEWKRRTDPSHYLDPKARAEVWRREGLKMVEEGLVDREHYYGTINCDGINAKGEICGVTTTSGLSWKIPGRLGDSPILGAGLYVDGAVGAAGSTGRGEANLYNLCSFLIVEEMRRGKHPKDAGMEALRRIKANTVEKRLLNSRGLQRTTPHLGNARHTLARLLDNQGWRQLKGRRWRGMRNDLFLKKWAEDSNSFKSDPPNAVLSVFNDKAPPTSTVVVLNNPRLNGNNLTYDVRPLRGDLPTTGIEGTLFIDGSGAPCDPAFNQGDSAYPCWAQQAFAAAGGGL

Samples

Sample ID Description Type Environment
1 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
175 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
204 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
205 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
219 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
220 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
226 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.99
Nodule 0
Rhizoplane 2.76
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 12.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207689_10004907 3300025942 Bacteria 12050
2 JGI25406J46586_10042970 3300003203 Unclassified 1577
3 Ga0065704_10011083 3300005289 Unclassified 2458
4 Ga0065712_10067728 3300005290 Bacteria 178215
5 Ga0065712_10070571 3300005290 Bacteria 5893
6 Ga0065715_10089970 3300005293 Bacteria 7989
7 Ga0065715_10104045 3300005293 Bacteria 2981
8 Ga0065715_10119367 3300005293 Bacteria 2288
9 Ga0065715_10122175 3300005293 Bacteria 2211
10 Ga0065707_10004294 3300005295 Unclassified 4456
11 Ga0065707_10008079 3300005295 Unclassified 3802
12 Ga0065707_10109045 3300005295 Bacteria 2484
13 Ga0065707_10149830 3300005295 Bacteria 1671
14 Ga0070683_100000059 3300005329 Bacteria 81605
15 Ga0070690_100004197 3300005330 Bacteria 7969
16 Ga0070690_100008261 3300005330 Bacteria 5988
17 Ga0070690_100043819 3300005330 Bacteria 2839
18 Ga0070690_100045472 3300005330 Bacteria 2788
19 Ga0070670_100000165 3300005331 Bacteria 59984
20 Ga0070670_100002492 3300005331 Bacteria 15184
21 Ga0070670_100027587 3300005331 Bacteria 4884
22 Ga0070670_100067710 3300005331 Bacteria 3063
23 Ga0068869_100006040 3300005334 Bacteria 7661
24 Ga0068869_100036869 3300005334 Bacteria 3473
25 Ga0068869_100041264 3300005334 Bacteria 3304
26 Ga0070666_10001149 3300005335 Bacteria 16101
27 Ga0070666_10003641 3300005335 Bacteria 9344
28 Ga0070666_10041887 3300005335 Bacteria 3061
29 Ga0070680_100000123 3300005336 Bacteria 45833
30 Ga0070680_100025977 3300005336 Bacteria 4683
31 Ga0070682_100000271 3300005337 Bacteria 37361
32 Ga0068868_100073805 3300005338 Bacteria 2724
33 Ga0068868_100214529 3300005338 Bacteria 1610
34 Ga0070687_100002790 3300005343 Bacteria 6646
35 Ga0070687_100016258 3300005343 Bacteria 3388
36 Ga0070687_100119467 3300005343 Bacteria 1505
37 Ga0070661_100021925 3300005344 Bacteria 4568
38 Ga0070661_100096372 3300005344 Bacteria 2195
39 Ga0070692_10005382 3300005345 Bacteria 5451
40 Ga0070668_100012070 3300005347 Bacteria 6436
41 Ga0070669_100000538 3300005353 Bacteria 28222
42 Ga0070669_100021358 3300005353 Unclassified 4625
43 Ga0070669_100023409 3300005353 Bacteria 4423
44 Ga0070669_100038326 3300005353 Bacteria 3479
45 Ga0070675_100002354 3300005354 Bacteria 14062
46 Ga0070675_100019397 3300005354 Bacteria 5418
47 Ga0070671_100259230 3300005355 Bacteria 1477
48 Ga0070673_100019249 3300005364 Bacteria 4899
49 Ga0070673_100025864 3300005364 Bacteria 4327
50 Ga0070673_100034960 3300005364 Bacteria 3808
51 Ga0070673_100057830 3300005364 Unclassified 3065
52 Ga0070673_100220385 3300005364 Unclassified 1642
53 Ga0070688_100001483 3300005365 Bacteria 11677
54 Ga0070688_100038924 3300005365 Bacteria 2907
55 Ga0070688_100173780 3300005365 Bacteria 1489
56 Ga0070659_100000925 3300005366 Bacteria 21520
57 Ga0070667_100001304 3300005367 Bacteria 22474
58 Ga0070667_100021489 3300005367 Bacteria 5357
59 Ga0070667_100022080 3300005367 Bacteria 5279
60 Ga0070709_10000638 3300005434 Bacteria 19999
61 Ga0070701_10001342 3300005438 Bacteria 9066
62 Ga0070700_100009764 3300005441 Bacteria 5276
63 Ga0070700_100016347 3300005441 Bacteria 4226
64 Ga0070694_100017398 3300005444 Bacteria 4544
65 Ga0070694_100027923 3300005444 Bacteria 3668
66 Ga0070694_100061332 3300005444 Unclassified 2566
67 Ga0070694_100114764 3300005444 Bacteria 1924
68 Ga0070694_100119969 3300005444 Bacteria 1886
69 Ga0070694_100147807 3300005444 Unclassified 1713
70 Ga0070694_100245796 3300005444 Bacteria 1351
71 Ga0070708_100276353 3300005445 Bacteria 1580
72 Ga0070708_100343670 3300005445 Bacteria 1406
73 Ga0070663_100034047 3300005455 Bacteria 3525
74 Ga0070663_100129564 3300005455 Bacteria 1914
75 Ga0070678_100025285 3300005456 Bacteria 3992
76 Ga0070678_100054643 3300005456 Bacteria 2911
77 Ga0070678_100091148 3300005456 Bacteria 2338
78 Ga0070681_10001768 3300005458 Bacteria 19378
79 Ga0070681_10014914 3300005458 Bacteria 7727
80 Ga0068867_100005923 3300005459 Bacteria 8670
81 Ga0070685_10007564 3300005466 Bacteria 5560
82 Ga0070685_10010376 3300005466 Unclassified 4839
83 Ga0070685_10052573 3300005466 Bacteria 2358
84 Ga0070685_10216737 3300005466 Bacteria 1252
85 Ga0070706_100002444 3300005467 Bacteria 18726
86 Ga0070706_100029474 3300005467 Bacteria 5056
87 Ga0070706_100035631 3300005467 Unclassified 4593
88 Ga0070706_100036586 3300005467 Bacteria 4534
89 Ga0070706_100051649 3300005467 Bacteria 3795
90 Ga0070706_100093545 3300005467 Bacteria 2789
91 Ga0070707_100017154 3300005468 Bacteria 6803
92 Ga0070707_100025429 3300005468 Bacteria 5617
93 Ga0070707_100054259 3300005468 Bacteria 3842
94 Ga0070707_100058615 3300005468 Bacteria 3692
95 Ga0070707_100063395 3300005468 Bacteria 3547
96 Ga0070707_100066272 3300005468 Bacteria 3470
97 Ga0070707_100105913 3300005468 Unclassified 2727
98 Ga0070707_100124493 3300005468 Bacteria 2504
99 Ga0070698_100000663 3300005471 Bacteria 36731
100 Ga0070698_100003071 3300005471 Bacteria 18406
101 Ga0070698_100011440 3300005471 Bacteria 9413
102 Ga0070698_100023286 3300005471 Bacteria 6475
103 Ga0070698_100244254 3300005471 Bacteria 1728
104 Ga0070699_100001203 3300005518 Bacteria 23916
105 Ga0070699_100001758 3300005518 Bacteria 19749
106 Ga0070699_100029783 3300005518 Unclassified 4707
107 Ga0070699_100081380 3300005518 Bacteria 2823
108 Ga0070679_100000014 3300005530 Bacteria 150481
109 Ga0070679_100006157 3300005530 Bacteria 11164
110 Ga0070684_100000164 3300005535 Bacteria 45706
111 Ga0070697_100000052 3300005536 Bacteria 88211
112 Ga0070697_100000392 3300005536 Bacteria 33968
113 Ga0070697_100001507 3300005536 Bacteria 17693
114 Ga0070697_100007189 3300005536 Bacteria 8657
115 Ga0070697_100082412 3300005536 Bacteria 2651
116 Ga0068853_100268761 3300005539 Unclassified 1569
117 Ga0070672_100002799 3300005543 Bacteria 11173
118 Ga0070672_100006986 3300005543 Bacteria 7639
119 Ga0070672_100039304 3300005543 Bacteria 3623
120 Ga0070672_100080294 3300005543 Bacteria 2613
121 Ga0070672_100082146 3300005543 Bacteria 2585
122 Ga0070695_100003292 3300005545 Bacteria 9439
123 Ga0070695_100071544 3300005545 Bacteria 2272
124 Ga0070696_100105246 3300005546 Bacteria 2027
125 Ga0070696_100205550 3300005546 Bacteria 1472
126 Ga0070693_100001436 3300005547 Bacteria 10739
127 Ga0070704_100014368 3300005549 Bacteria 4944
128 Ga0070704_100040138 3300005549 Bacteria 3219
129 Ga0070704_100078065 3300005549 Bacteria 2427
130 Ga0070704_100130982 3300005549 Bacteria 1944
131 Ga0070704_100303482 3300005549 Bacteria 1331
132 Ga0070664_100000622 3300005564 Bacteria 27108
133 Ga0070664_100001706 3300005564 Bacteria 17591
134 Ga0070664_100235941 3300005564 Bacteria 1641
135 Ga0070664_100268672 3300005564 Unclassified 1536
136 Ga0068857_100001440 3300005577 Bacteria 18873
137 Ga0068857_100018599 3300005577 Bacteria 6097
138 Ga0068857_100055714 3300005577 Bacteria 3508
139 Ga0068854_100018079 3300005578 Bacteria 4726
140 Ga0068854_100032954 3300005578 Unclassified 3609
141 Ga0068854_100083846 3300005578 Bacteria 2357
142 Ga0068854_100156450 3300005578 Bacteria 1761
143 Ga0068856_100011522 3300005614 Bacteria 8578
144 Ga0068856_100042909 3300005614 Unclassified 4450
145 Ga0070702_100004219 3300005615 Bacteria 6540
146 Ga0070702_100073970 3300005615 Bacteria 2020
147 Ga0070702_100118846 3300005615 Bacteria 1651
148 Ga0068859_100001240 3300005617 Bacteria 26061
149 Ga0068859_100011794 3300005617 Bacteria 8781
150 Ga0068859_100032878 3300005617 Bacteria 5210
151 Ga0068859_100037599 3300005617 Unclassified 4858
152 Ga0068859_100042862 3300005617 Bacteria 4547
153 Ga0068859_100045496 3300005617 Unclassified 4409
154 Ga0068859_100074804 3300005617 Bacteria 3427
155 Ga0068859_100084922 3300005617 Bacteria 3210
156 Ga0068859_100104200 3300005617 Bacteria 2896
157 Ga0068859_100143180 3300005617 Unclassified 2464
158 Ga0068859_100325245 3300005617 Bacteria 1631
159 Ga0068859_100442687 3300005617 Unclassified 1396
160 Ga0068864_100002141 3300005618 Bacteria 16331
161 Ga0068864_100005377 3300005618 Bacteria 10490
162 Ga0068864_100014627 3300005618 Bacteria 6518
163 Ga0068864_100046072 3300005618 Bacteria 3741
164 Ga0068864_100086700 3300005618 Bacteria 2755
165 Ga0068866_10062752 3300005718 Unclassified 1934
166 Ga0068861_100010082 3300005719 Bacteria 6550
167 Ga0068861_100016346 3300005719 Bacteria 5249
168 Ga0068861_100026089 3300005719 Unclassified 4245
169 Ga0068861_100042353 3300005719 Bacteria 3412
170 Ga0068861_100053634 3300005719 Bacteria 3069
171 Ga0068861_100151192 3300005719 Unclassified 1905
172 Ga0068861_100169067 3300005719 Bacteria 1810
173 Ga0068851_10000697 3300005834 Bacteria 14334
174 Ga0068870_10004836 3300005840 Bacteria 5824
175 Ga0068870_10025704 3300005840 Unclassified 2926
176 Ga0068863_100057835 3300005841 Bacteria 3670
177 Ga0068863_100090525 3300005841 Bacteria 2901
178 Ga0068863_100105877 3300005841 Bacteria 2676
179 Ga0068863_100269925 3300005841 Unclassified 1647
180 Ga0068863_100286824 3300005841 Bacteria 1595
181 Ga0068858_100001704 3300005842 Bacteria 22458
182 Ga0068858_100064992 3300005842 Unclassified 3376
183 Ga0068858_100245528 3300005842 Unclassified 1699
184 Ga0068858_100265706 3300005842 Bacteria 1632
185 Ga0068858_100275493 3300005842 Unclassified 1601
186 Ga0068860_100000332 3300005843 Bacteria 64247
187 Ga0068860_100011247 3300005843 Bacteria 8820
188 Ga0068860_100028339 3300005843 Bacteria 5390
189 Ga0068860_100120547 3300005843 Bacteria 2512
190 Ga0068860_100130706 3300005843 Unclassified 2409
191 Ga0068860_100273728 3300005843 Bacteria 1648
192 Ga0068862_100013402 3300005844 Bacteria 6782
193 Ga0068862_100026252 3300005844 Unclassified 4896
194 Ga0068862_100028086 3300005844 Unclassified 4738
195 Ga0068862_100036387 3300005844 Bacteria 4173
196 Ga0068862_100088354 3300005844 Bacteria 2696
197 Ga0068862_100423455 3300005844 Unclassified 1250
198 Ga0081539_10000189 3300005985 Bacteria 143321
199 Ga0081539_10000586 3300005985 Bacteria 74721
200 Ga0081539_10002211 3300005985 Bacteria 28439
201 Ga0081539_10010534 3300005985 Bacteria 7488
202 Ga0075365_10012018 3300006038 Bacteria 5119
203 Ga0075365_10012208 3300006038 Bacteria 5089
204 Ga0075364_10017911 3300006051 Bacteria 4429
205 Ga0075367_10000293 3300006178 Bacteria 17572
206 Ga0075367_10070636 3300006178 Bacteria 2099
207 Ga0075366_10000346 3300006195 Bacteria 21304
208 Ga0075366_10006149 3300006195 Bacteria 6549
209 Ga0097621_100003304 3300006237 Bacteria 11097
210 Ga0097621_100029472 3300006237 Bacteria 4335
211 Ga0068871_100003714 3300006358 Bacteria 10498
212 Ga0068871_100175201 3300006358 Bacteria 1841
213 Ga0075428_100006346 3300006844 Bacteria 13155
214 Ga0075428_100009479 3300006844 Bacteria 10806
215 Ga0075428_100266858 3300006844 Bacteria 1842
216 Ga0075428_100467130 3300006844 Bacteria 1351
217 Ga0075428_100535998 3300006844 Bacteria 1252
218 Ga0075430_100085697 3300006846 Bacteria 2637
219 Ga0075430_100241987 3300006846 Bacteria 1495
220 Ga0075431_100049164 3300006847 Bacteria 4349
221 Ga0075431_100084987 3300006847 Bacteria 3266
222 Ga0075431_100108970 3300006847 Bacteria 2858
223 Ga0075431_100128034 3300006847 Bacteria 2620
224 Ga0075433_10021780 3300006852 Bacteria 5377
225 Ga0075433_10032569 3300006852 Bacteria 4465
226 Ga0075433_10060093 3300006852 Unclassified 3327
227 Ga0075433_10207060 3300006852 Bacteria 1744
228 Ga0075433_10310532 3300006852 Unclassified 1396
229 Ga0075434_100065898 3300006871 Bacteria 3607
230 Ga0075434_100073830 3300006871 Bacteria 3404
231 Ga0075434_100097861 3300006871 Bacteria 2938
232 Ga0075434_100280858 3300006871 Bacteria 1685
233 Ga0075434_100296994 3300006871 Unclassified 1635
234 Ga0075429_100204212 3300006880 Bacteria 1731
235 Ga0068865_100006874 3300006881 Bacteria 6970
236 Ga0068865_100045223 3300006881 Bacteria 3018
237 Ga0075436_100003346 3300006914 Bacteria 10981
238 Ga0097620_100001240 3300006931 Bacteria 26061
239 Ga0097620_100011794 3300006931 Bacteria 8781
240 Ga0097620_100032879 3300006931 Bacteria 5210
241 Ga0097620_100037599 3300006931 Unclassified 4858
242 Ga0097620_100042862 3300006931 Bacteria 4547
243 Ga0097620_100045502 3300006931 Unclassified 4409
244 Ga0097620_100074804 3300006931 Bacteria 3427
245 Ga0097620_100084919 3300006931 Bacteria 3210
246 Ga0097620_100104198 3300006931 Bacteria 2896
247 Ga0097620_100143182 3300006931 Unclassified 2464
248 Ga0097620_100325231 3300006931 Bacteria 1631
249 Ga0097620_100442711 3300006931 Unclassified 1396
250 Ga0075435_100001795 3300007076 Bacteria 13957
251 Ga0075435_100016257 3300007076 Bacteria 5609
252 Ga0075435_100046973 3300007076 Bacteria 3465
253 Ga0075435_100062255 3300007076 Bacteria 3028
254 Ga0075435_100183703 3300007076 Bacteria 1768
255 Ga0111539_10003985 3300009094 Bacteria 19399
256 Ga0111539_10012899 3300009094 Bacteria 10455
257 Ga0111539_10027812 3300009094 Bacteria 6905
258 Ga0111539_10038827 3300009094 Bacteria 5743
259 Ga0111539_10142020 3300009094 Bacteria 2811
260 Ga0105245_10059728 3300009098 Bacteria 3433
261 Ga0105245_10133766 3300009098 Bacteria 2328
262 Ga0114129_10009353 3300009147 Bacteria 13977
263 Ga0114129_10017418 3300009147 Bacteria 10233
264 Ga0114129_10024082 3300009147 Bacteria 8626
265 Ga0114129_10035012 3300009147 Bacteria 7093
266 Ga0114129_10049547 3300009147 Bacteria 5901
267 Ga0114129_10057631 3300009147 Bacteria 5435
268 Ga0114129_10072964 3300009147 Bacteria 4783
269 Ga0114129_10082140 3300009147 Bacteria 4478
270 Ga0114129_10138382 3300009147 Bacteria 3340
271 Ga0114129_10151386 3300009147 Unclassified 3175
272 Ga0114129_10252090 3300009147 Unclassified 2369
273 Ga0114129_10267953 3300009147 Bacteria 2286
274 Ga0114129_10320748 3300009147 Bacteria 2060
275 Ga0105243_10001428 3300009148 Bacteria 21057
276 Ga0105243_10013165 3300009148 Bacteria 6252
277 Ga0105243_10121986 3300009148 Bacteria 2199
278 Ga0105243_10128957 3300009148 Bacteria 2143
279 Ga0105241_10025495 3300009174 Bacteria 4394
280 Ga0105242_10019734 3300009176 Bacteria 5283
281 Ga0105242_10026021 3300009176 Bacteria 4634
282 Ga0105248_10000564 3300009177 Bacteria 42053
283 Ga0105248_10039608 3300009177 Bacteria 5280
284 Ga0105248_10133047 3300009177 Bacteria 2806
285 Ga0105248_10452959 3300009177 Unclassified 1446
286 Ga0105237_10175384 3300009545 Bacteria 2144
287 Ga0105238_10020418 3300009551 Bacteria 6744
288 Ga0105249_10000112 3300009553 Bacteria 108891
289 Ga0105249_10048988 3300009553 Unclassified 3853
290 Ga0105249_10155246 3300009553 Bacteria 2207
291 Ga0105249_10161542 3300009553 Bacteria 2165
292 Ga0105239_10074282 3300010375 Bacteria 3739
293 Ga0105239_10249687 3300010375 Bacteria 1993
294 Ga0157378_10000113 3300013297 Bacteria 77834
295 Ga0157378_10002538 3300013297 Bacteria 16246
296 Ga0157378_10008274 3300013297 Bacteria 9067
297 Ga0157378_10014464 3300013297 Bacteria 6908
298 Ga0163162_10000055 3300013306 Bacteria 109443
299 Ga0163162_10017543 3300013306 Bacteria 7005
300 Ga0163162_10024565 3300013306 Bacteria 5950
301 Ga0163162_10036773 3300013306 Bacteria 4882
302 Ga0163162_10053662 3300013306 Bacteria 4052
303 Ga0157372_10076113 3300013307 Unclassified 3789
304 Ga0157372_10082361 3300013307 Bacteria 3643
305 Ga0157375_10002293 3300013308 Bacteria 16538
306 Ga0157375_10008617 3300013308 Bacteria 8928
307 Ga0157375_10038431 3300013308 Bacteria 4596
308 Ga0157375_10086154 3300013308 Bacteria 3192
309 Ga0157375_10219687 3300013308 Bacteria 2059
310 Ga0163163_10001068 3300014325 Bacteria 23309
311 Ga0163163_10110007 3300014325 Bacteria 2783
312 Ga0163163_10368453 3300014325 Bacteria 1493
313 Ga0157380_10010958 3300014326 Bacteria 6539
314 Ga0157380_10037231 3300014326 Unclassified 3768
315 Ga0157377_10062664 3300014745 Bacteria 2128
316 Ga0157379_10001932 3300014968 Bacteria 17129
317 Ga0157379_10124713 3300014968 Bacteria 2317
318 Ga0157376_10008467 3300014969 Bacteria 7425
319 Ga0157376_10015538 3300014969 Bacteria 5754
320 Ga0157376_10018488 3300014969 Bacteria 5345
321 Ga0163161_10018014 3300017792 Bacteria 4950
322 Ga0207656_10007706 3300025321 Bacteria 3936
323 Ga0207653_10034147 3300025885 Unclassified 1652
324 Ga0207642_10024793 3300025899 Bacteria 2416
325 Ga0207642_10035105 3300025899 Bacteria 2138
326 Ga0207710_10002567 3300025900 Bacteria 8393
327 Ga0207680_10009808 3300025903 Bacteria 4766
328 Ga0207647_10097649 3300025904 Unclassified 1746
329 Ga0207699_10000487 3300025906 Bacteria 20007
330 Ga0207645_10011781 3300025907 Bacteria 5956
331 Ga0207643_10001640 3300025908 Bacteria 12590
332 Ga0207643_10006247 3300025908 Bacteria 6373
333 Ga0207684_10000150 3300025910 Bacteria 121849
334 Ga0207684_10001515 3300025910 Bacteria 24912
335 Ga0207684_10002540 3300025910 Bacteria 18326
336 Ga0207684_10009673 3300025910 Bacteria 8500
337 Ga0207684_10022304 3300025910 Bacteria 5405
338 Ga0207684_10023528 3300025910 Bacteria 5261
339 Ga0207684_10034084 3300025910 Bacteria 4327
340 Ga0207684_10072098 3300025910 Bacteria 2934
341 Ga0207684_10085391 3300025910 Unclassified 2689
342 Ga0207684_10275338 3300025910 Bacteria 1452
343 Ga0207707_10000016 3300025912 Bacteria 256002
344 Ga0207707_10030530 3300025912 Bacteria 4715
345 Ga0207695_10075988 3300025913 Bacteria 3416
346 Ga0207671_10013889 3300025914 Bacteria 6394
347 Ga0207671_10253618 3300025914 Bacteria 1383
348 Ga0207660_10062820 3300025917 Bacteria 2676
349 Ga0207662_10031399 3300025918 Bacteria 3086
350 Ga0207649_10067084 3300025920 Bacteria 2277
351 Ga0207649_10282442 3300025920 Bacteria 1207
352 Ga0207652_10000693 3300025921 Bacteria 32703
353 Ga0207652_10080277 3300025921 Bacteria 2851
354 Ga0207646_10002445 3300025922 Bacteria 21924
355 Ga0207646_10003620 3300025922 Bacteria 17297
356 Ga0207646_10005648 3300025922 Bacteria 13127
357 Ga0207646_10044828 3300025922 Bacteria 3970
358 Ga0207646_10072185 3300025922 Bacteria 3083
359 Ga0207646_10075009 3300025922 Bacteria 3022
360 Ga0207681_10016403 3300025923 Bacteria 4634
361 Ga0207681_10045495 3300025923 Bacteria 2948
362 Ga0207681_10191897 3300025923 Unclassified 1563
363 Ga0207650_10000011 3300025925 Bacteria 450115
364 Ga0207650_10001109 3300025925 Bacteria 19799
365 Ga0207650_10007858 3300025925 Bacteria 7263
366 Ga0207650_10014076 3300025925 Bacteria 5555
367 Ga0207659_10043564 3300025926 Unclassified 3152
368 Ga0207659_10072184 3300025926 Bacteria 2523
369 Ga0207659_10305594 3300025926 Bacteria 1308
370 Ga0207687_10129042 3300025927 Bacteria 1902
371 Ga0207644_10184178 3300025931 Bacteria 1638
372 Ga0207644_10233178 3300025931 Bacteria 1463
373 Ga0207706_10033215 3300025933 Bacteria 4593
374 Ga0207706_10081288 3300025933 Bacteria 2848
375 Ga0207706_10095869 3300025933 Bacteria 2609
376 Ga0207686_10033065 3300025934 Bacteria 3083
377 Ga0207686_10135107 3300025934 Bacteria 1697
378 Ga0207670_10011935 3300025936 Bacteria 5060
379 Ga0207670_10064621 3300025936 Bacteria 2509
380 Ga0207670_10074929 3300025936 Unclassified 2351
381 Ga0207669_10037475 3300025937 Bacteria 2782
382 Ga0207669_10041842 3300025937 Bacteria 2670
383 Ga0207704_10072147 3300025938 Bacteria 2193
384 Ga0207691_10004374 3300025940 Bacteria 13698
385 Ga0207691_10004462 3300025940 Bacteria 13557
386 Ga0207691_10013415 3300025940 Bacteria 7843
387 Ga0207691_10015463 3300025940 Bacteria 7255
388 Ga0207691_10021941 3300025940 Bacteria 6024
389 Ga0207691_10024798 3300025940 Bacteria 5637
390 Ga0207691_10063573 3300025940 Bacteria 3347
391 Ga0207711_10000319 3300025941 Bacteria 51495
392 Ga0207711_10003877 3300025941 Bacteria 12869
393 Ga0207711_10012552 3300025941 Bacteria 7040
394 Ga0207711_10037485 3300025941 Bacteria 4119
395 Ga0207711_10042205 3300025941 Bacteria 3886
396 Ga0207711_10046999 3300025941 Bacteria 3689
397 Ga0207689_10001943 3300025942 Bacteria 19567
398 Ga0207689_10010949 3300025942 Bacteria 7797
399 Ga0207689_10014815 3300025942 Bacteria 6618
400 Ga0207689_10039942 3300025942 Bacteria 3884
401 Ga0207689_10204653 3300025942 Bacteria 1630
402 Ga0207661_10000482 3300025944 Bacteria 25729
403 Ga0207679_10026648 3300025945 Bacteria 3988
404 Ga0207679_10082692 3300025945 Bacteria 2459
405 Ga0207679_10167478 3300025945 Bacteria 1805
406 Ga0207679_10212542 3300025945 Bacteria 1623
407 Ga0207651_10018643 3300025960 Bacteria 4137
408 Ga0207651_10025936 3300025960 Unclassified 3652
409 Ga0207651_10053006 3300025960 Bacteria 2770
410 Ga0207651_10082240 3300025960 Bacteria 2324
411 Ga0207651_10100340 3300025960 Bacteria 2146
412 Ga0207651_10110315 3300025960 Unclassified 2064
413 Ga0207651_10249669 3300025960 Bacteria 1451
414 Ga0207712_10000416 3300025961 Bacteria 36519
415 Ga0207712_10007881 3300025961 Bacteria 6733
416 Ga0207712_10014558 3300025961 Bacteria 5064
417 Ga0207712_10264146 3300025961 Bacteria 1397
418 Ga0207668_10015113 3300025972 Bacteria 4791
419 Ga0207640_10025704 3300025981 Bacteria 3567
420 Ga0207640_10033246 3300025981 Unclassified 3207
421 Ga0207658_10004948 3300025986 Bacteria 9190
422 Ga0207658_10048736 3300025986 Unclassified 3108
423 Ga0207658_10111775 3300025986 Bacteria 2161
424 Ga0207677_10152234 3300026023 Bacteria 1786
425 Ga0207703_10232137 3300026035 Bacteria 1654
426 Ga0207678_10018286 3300026067 Bacteria 6155
427 Ga0207678_10021305 3300026067 Bacteria 5683
428 Ga0207678_10021506 3300026067 Bacteria 5657
429 Ga0207678_10040231 3300026067 Bacteria 4055
430 Ga0207678_10256608 3300026067 Bacteria 1498
431 Ga0207708_10013289 3300026075 Bacteria 6148
432 Ga0207708_10021887 3300026075 Bacteria 4824
433 Ga0207708_10098962 3300026075 Bacteria 2255
434 Ga0207708_10289914 3300026075 Bacteria 1328
435 Ga0207702_10008510 3300026078 Bacteria 8650
436 Ga0207702_10053728 3300026078 Unclassified 3411
437 Ga0207641_10017551 3300026088 Bacteria 5860
438 Ga0207641_10052860 3300026088 Bacteria 3441
439 Ga0207641_10269001 3300026088 Bacteria 1599
440 Ga0207641_10286627 3300026088 Bacteria 1551
441 Ga0207648_10007033 3300026089 Bacteria 11124
442 Ga0207648_10017631 3300026089 Bacteria 6485
443 Ga0207648_10352825 3300026089 Bacteria 1326
444 Ga0207676_10033479 3300026095 Unclassified 3882
445 Ga0207676_10376194 3300026095 Bacteria 1321
446 Ga0207674_10000108 3300026116 Bacteria 95567
447 Ga0207674_10069303 3300026116 Bacteria 3547
448 Ga0207674_10139763 3300026116 Bacteria 2382
449 Ga0207674_10199232 3300026116 Unclassified 1952
450 Ga0207674_10257262 3300026116 Bacteria 1693
451 Ga0207674_10345420 3300026116 Bacteria 1439
452 Ga0207675_100004786 3300026118 Bacteria 13037
453 Ga0207675_100014312 3300026118 Bacteria 7395
454 Ga0207675_100025741 3300026118 Bacteria 5475
455 Ga0207675_100032539 3300026118 Unclassified 4857
456 Ga0207675_100050979 3300026118 Bacteria 3862
457 Ga0207675_100079021 3300026118 Bacteria 3083
458 Ga0207675_100091962 3300026118 Unclassified 2853
459 Ga0207675_100121536 3300026118 Bacteria 2471
460 Ga0207675_100227252 3300026118 Bacteria 1799
461 Ga0207683_10016006 3300026121 Bacteria 6383
462 Ga0207683_10016131 3300026121 Bacteria 6358
463 Ga0207683_10071417 3300026121 Bacteria 3069
464 Ga0207698_10268590 3300026142 Bacteria 1571
465 Ga0207428_10000535 3300027907 Bacteria 45319
466 Ga0268266_10263751 3300028379 Unclassified 1597
467 Ga0268265_10047592 3300028380 Bacteria 3214
468 Ga0268265_10236230 3300028380 Bacteria 1610
469 Ga0268265_10312528 3300028380 Bacteria 1419
470 Ga0268264_10000681 3300028381 Bacteria 39558
471 Ga0268264_10046882 3300028381 Bacteria 3592
472 Ga0268264_10083303 3300028381 Bacteria 2739
473 Ga0268264_10109933 3300028381 Unclassified 2413
474 Ga0265328_10030706 3300031239 Bacteria 2000
475 Ga0265328_10038504 3300031239 Unclassified 1764
476 Ga0265325_10052200 3300031241 Bacteria 2100
477 Ga0265329_10002284 3300031242 Bacteria 8780
478 Ga0265339_10011004 3300031249 Bacteria 5593
479 Ga0265331_10029472 3300031250 Bacteria 2739
480 Ga0265316_10028836 3300031344 Bacteria 4573
481 Ga0265316_10140180 3300031344 Unclassified 1817
482 Ga0307513_10276834 3300031456 Bacteria 1458
483 Ga0307408_100019737 3300031548 Bacteria 4541
484 Ga0307408_100046355 3300031548 Bacteria 3109
485 Ga0307408_100110492 3300031548 Bacteria 2111
486 Ga0307408_100387769 3300031548 Bacteria 1196
487 Ga0265314_10003215 3300031711 Bacteria 15985
488 Ga0265314_10163265 3300031711 Bacteria 1353
489 Ga0307405_10131443 3300031731 Unclassified 1730
490 Ga0307413_10057602 3300031824 Bacteria 2377
491 Ga0307413_10082362 3300031824 Bacteria 2067
492 Ga0307413_10208638 3300031824 Bacteria 1417
493 Ga0307410_10031921 3300031852 Bacteria 3384
494 Ga0307410_10087099 3300031852 Bacteria 2208
495 Ga0307407_10049701 3300031903 Bacteria 2395
496 Ga0307412_10005497 3300031911 Bacteria 7117
497 Ga0307412_10080904 3300031911 Bacteria 2245
498 Ga0307409_100182262 3300031995 Bacteria 1860
499 Ga0307409_100317555 3300031995 Bacteria 1456
500 Ga0307416_100019896 3300032002 Bacteria 4772
501 Ga0307416_100047582 3300032002 Bacteria 3396
502 Ga0307416_100105972 3300032002 Bacteria 2462
503 Ga0307416_100127092 3300032002 Bacteria 2285
504 Ga0307416_100150814 3300032002 Bacteria 2131
505 Ga0307416_100241206 3300032002 Unclassified 1752
506 Ga0307416_100305286 3300032002 Bacteria 1584
507 Ga0307414_10067019 3300032004 Bacteria 2569
508 Ga0307414_10095507 3300032004 Bacteria 2222
509 Ga0307411_10034791 3300032005 Bacteria 3139
510 Ga0307411_10056996 3300032005 Bacteria 2578
511 Ga0307411_10105887 3300032005 Bacteria 2000
512 Ga0307411_10273460 3300032005 Bacteria 1341
513 Ga0307415_100106594 3300032126 Bacteria 2069
514 Ga0307415_100145863 3300032126 Bacteria 1814
515 Ga0307415_100192433 3300032126 Bacteria 1611
516 Ga0373948_0002612 3300034817 Bacteria 2683
517 Ga0373951_0000974 3300035091 Bacteria 7703
518 Ga0373941_0006128 3300035115 Unclassified 2879
519 Ga0373960_0018719 3300035121 Bacteria 1811
520 Ga0373961_0010888 3300035241 Bacteria 2249
521 Ga0373937_0054902 3300036401 Bacteria 3656
522 Ga0395905_0153701 3300037471 Bacteria 2164
523 Ga0395901_0306173 3300038443 Bacteria 1647
524 Ga0450923_001924 3300042125 Bacteria 2871
525 Ga0453683_0086571 3300044673 Bacteria 1963
526 Ga0453684_0021356 3300044712 Bacteria 9678
527 Ga0451576_0078586 3300045051 Bacteria 3433
528 Ga0495638_0028832 3300046460 Bacteria 3582
529 Ga0495663_0001413 3300046525 Bacteria 7580
530 Ga0495598_0000020 3300046537 Bacteria 24699
531 Ga0495621_0000177 3300046539 Bacteria 14531
532 Ga0495621_0022595 3300046539 Bacteria 2086
533 Ga0495645_0036416 3300046543 Bacteria 3586
534 Ga0495667_0080397 3300046559 Bacteria 2119
535 Ga0495613_0145188 3300046689 Bacteria 1694
536 Ga0495600_0159939 3300046809 Bacteria 1456
537 Ga0496103_0040984 3300048906 Bacteria 2846
538 Ga0496104_0002343 3300048907 Bacteria 16373
539 Ga0496104_0043753 3300048907 Unclassified 4206
540 Ga0496104_0076035 3300048907 Bacteria 3198
541 Ga0496106_0000318 3300048909 Bacteria 33853
542 Ga0496106_0046661 3300048909 Unclassified 3258
543 Ga0496106_0087443 3300048909 Unclassified 2401
544 Ga0496106_0131510 3300048909 Bacteria 1963
545 Ga0496108_0005229 3300048911 Bacteria 10480
546 Ga0496109_0001089 3300048912 Bacteria 22572
547 Ga0496109_0200299 3300048912 Bacteria 1877
548 Ga0496109_0373311 3300048912 Bacteria 1347
549 Ga0496109_0384008 3300048912 Unclassified 1327
550 Ga0496110_0008729 3300048913 Bacteria 8163
551 Ga0496111_0040068 3300048914 Bacteria 3360
552 Ga0496112_0008391 3300048915 Bacteria 9253
553 Ga0496112_0215037 3300048915 Bacteria 1879
554 Ga0496113_0074358 3300048916 Bacteria 2591
555 Ga0501292_007497 3300049515 Bacteria 1578
556 Ga0501298_003706 3300049521 Bacteria 2380
557 Ga0501299_014557 3300049522 Bacteria 1370
558 Ga0501036_0080848 3300049572 Bacteria 2747
559 Ga0501036_0190290 3300049572 Bacteria 1727
560 Ga0501040_0025239 3300049576 Bacteria 3996
561 Ga0501042_0034953 3300049578 Bacteria 3566
562 Ga0501042_0054827 3300049578 Bacteria 2844
563 Ga0501042_0145391 3300049578 Bacteria 1709
564 Ga0501046_0062939 3300049580 Bacteria 2898
565 Ga0501046_0118590 3300049580 Bacteria 2015
566 Ga0501048_0018199 3300049582 Bacteria 5170
567 Ga0501048_0039918 3300049582 Bacteria 3365
568 Ga0501048_0113658 3300049582 Bacteria 1913
569 Ga0501048_0136700 3300049582 Bacteria 1732
570 Ga0501067_0022682 3300049583 Bacteria 3474
571 Ga0501069_0137430 3300049585 Bacteria 1401
572 Ga0501071_0049977 3300049587 Bacteria 3011
573 Ga0501072_0030593 3300049588 Bacteria 4212
574 Ga0501072_0118847 3300049588 Bacteria 2106
575 Ga0501075_0010280 3300049591 Bacteria 6575
576 Ga0501075_0010839 3300049591 Bacteria 6426
577 Ga0501075_0032342 3300049591 Bacteria 3885
578 Ga0501075_0052374 3300049591 Bacteria 3069
579 Ga0501076_0022579 3300049592 Bacteria 4837
580 Ga0501076_0033248 3300049592 Bacteria 4027
581 Ga0501076_0048981 3300049592 Bacteria 3340
582 Ga0501076_0329301 3300049592 Bacteria 1253
583 Ga0501077_0000559 3300049593 Bacteria 22635
584 Ga0501235_008119 3300049669 Bacteria 2290
585 Ga0501243_009338 3300049675 Bacteria 1523
586 Ga0501249_003530 3300049679 Unclassified 3139
587 Ga0501225_0008773 3300049705 Unclassified 2893
588 Ga0501079_0089629 3300049741 Unclassified 2382
589 Ga0501079_0149422 3300049741 Bacteria 1821
590 Ga0501081_0001396 3300049743 Bacteria 14735
591 Ga0501081_0165892 3300049743 Bacteria 1593
592 Ga0501083_0145951 3300049744 Bacteria 1549
593 Ga0501265_003280 3300049762 Bacteria 1840
594 Ga0501283_002388 3300049779 Bacteria 2440
595 Ga0501045_0022890 3300049824 Bacteria 4476
596 Ga0501045_0028225 3300049824 Bacteria 4048
597 Ga0501045_0096810 3300049824 Bacteria 2183
598 Ga0501045_0164949 3300049824 Unclassified 1650
599 nmdc:mga03683_10534_c1 3300050489 Bacteria 3318
600 nmdc:mga00v17_21642_c1 3300050491 Bacteria 3699
601 nmdc:mga0yw44_12225_c1 3300050492 Bacteria 4466
602 nmdc:mga06z11_1616_c1 3300050494 Bacteria 8418
603 nmdc:mga06z11_51765_c1 3300050494 Bacteria 2104
604 nmdc:mga05p37_145660_c1 3300050507 Bacteria 2901
605 nmdc:mga05p37_18308_c1 3300050507 Bacteria 8460
606 nmdc:mga05p37_195198_c1 3300050507 Bacteria 2455
607 nmdc:mga05p37_214714_c1 3300050507 Bacteria 2324
608 nmdc:mga05p37_217743_c1 3300050507 Bacteria 2306
609 nmdc:mga05p37_31782_c1 3300050507 Bacteria 6450
610 nmdc:mga05p37_38468_c1 3300050507 Bacteria 5868
611 nmdc:mga05p37_68875_c1 3300050507 Bacteria 4351
612 nmdc:mga05p37_69900_c1 3300050507 Bacteria 4319
613 nmdc:mga05p37_79435_c1 3300050507 Bacteria 4039
614 nmdc:mga05p37_8524_c1 3300050507 Bacteria 12118
615 nmdc:mga09592_215662_c1 3300050508 Bacteria 1663
616 nmdc:mga09592_99521_c1 3300050508 Bacteria 2489
617 nmdc:mga0qj67_300411_c1 3300050509 Bacteria 1301
618 nmdc:mga0qj67_58614_c1 3300050509 Bacteria 3053
619 nmdc:mga06r32_112398_c1 3300050510 Bacteria 2680
620 nmdc:mga06r32_116259_c1 3300050510 Bacteria 2635
621 nmdc:mga06r32_152688_c1 3300050510 Bacteria 2289
622 nmdc:mga06r32_23114_c1 3300050510 Bacteria 5752
623 nmdc:mga06r32_84032_c1 3300050510 Bacteria 3102
624 nmdc:mga08y16_15085_c1 3300050511 Bacteria 8124
625 nmdc:mga08y16_152594_c1 3300050511 Bacteria 2401
626 nmdc:mga08y16_185387_c1 3300050511 Unclassified 2160
627 nmdc:mga08y16_4851_c1 3300050511 Bacteria 14040
628 nmdc:mga08y16_5560_c1 3300050511 Bacteria 13198
629 nmdc:mga0n895_15270_c1 3300050512 Bacteria 6997
630 nmdc:mga0n895_21932_c1 3300050512 Bacteria 5982
631 nmdc:mga0n895_233687_c1 3300050512 Unclassified 1866
632 nmdc:mga0n895_458536_c1 3300050512 Bacteria 1287
633 nmdc:mga0rr50_33110_c1 3300050513 Bacteria 3690
634 nmdc:mga0rr50_8273_c1 3300050513 Bacteria 6467
635 nmdc:mga0rr50_87344_c1 3300050513 Bacteria 2421
636 nmdc:mga08x19_2717_c1 3300050514 Bacteria 10694
637 nmdc:mga0a205_125071_c1 3300050515 Bacteria 2471
638 nmdc:mga0a205_184626_c1 3300050515 Unclassified 1979
639 nmdc:mga0a205_203473_c1 3300050515 Bacteria 1870
640 nmdc:mga0a205_250704_c1 3300050515 Bacteria 1650
641 nmdc:mga0a205_85052_c1 3300050515 Bacteria 3055
642 nmdc:mga0a205_99937_c1 3300050515 Bacteria 2800
643 Ga0495601_0091698 3300053077 Bacteria 1956
644 Ga0495619_0006474 3300053085 Bacteria 7417
645 Ga0500568_0001572 3300053139 Bacteria 14442
646 Ga0501084_0010745 3300054114 Bacteria 7578
647 Ga0501084_0035929 3300054114 Bacteria 4141
648 Ga0501084_0150722 3300054114 Unclassified 1960
649 Ga0590071_000833 3300059421 Bacteria 8587
650 Ga0590074_006163 3300059423 Bacteria 1990
651 Ga0501082_0040687 3300060353 Bacteria 4008
652 Ga0530510_0058715 3300061734 Unclassified 2782
653 Ga0530510_0069217 3300061734 Unclassified 2561
654 Ga0207689_10004907
655 JGI25406J46586_10042970
656 Ga0065704_10011083
657 Ga0065712_10067728
658 Ga0065712_10070571
659 Ga0065715_10089970
660 Ga0065715_10104045
661 Ga0065715_10119367
662 Ga0065715_10122175
663 Ga0065707_10004294
664 Ga0065707_10008079
665 Ga0065707_10109045
666 Ga0065707_10149830
667 Ga0070683_100000059
668 Ga0070690_100004197
669 Ga0070690_100008261
670 Ga0070690_100043819
671 Ga0070690_100045472
672 Ga0070670_100000165
673 Ga0070670_100002492
674 Ga0070670_100027587
675 Ga0070670_100067710
676 Ga0068869_100006040
677 Ga0068869_100036869
678 Ga0068869_100041264
679 Ga0070666_10001149
680 Ga0070666_10003641
681 Ga0070666_10041887
682 Ga0070680_100000123
683 Ga0070680_100025977
684 Ga0070682_100000271
685 Ga0068868_100073805
686 Ga0068868_100214529
687 Ga0070687_100002790
688 Ga0070687_100016258
689 Ga0070687_100119467
690 Ga0070661_100021925
691 Ga0070661_100096372
692 Ga0070692_10005382
693 Ga0070668_100012070
694 Ga0070669_100000538
695 Ga0070669_100021358
696 Ga0070669_100023409
697 Ga0070669_100038326
698 Ga0070675_100002354
699 Ga0070675_100019397
700 Ga0070671_100259230
701 Ga0070673_100019249
702 Ga0070673_100025864
703 Ga0070673_100034960
704 Ga0070673_100057830
705 Ga0070673_100220385
706 Ga0070688_100001483
707 Ga0070688_100038924
708 Ga0070688_100173780
709 Ga0070659_100000925
710 Ga0070667_100001304
711 Ga0070667_100021489
712 Ga0070667_100022080
713 Ga0070709_10000638
714 Ga0070701_10001342
715 Ga0070700_100009764
716 Ga0070700_100016347
717 Ga0070694_100017398
718 Ga0070694_100027923
719 Ga0070694_100061332
720 Ga0070694_100114764
721 Ga0070694_100119969
722 Ga0070694_100147807
723 Ga0070694_100245796
724 Ga0070708_100276353
725 Ga0070708_100343670
726 Ga0070663_100034047
727 Ga0070663_100129564
728 Ga0070678_100025285
729 Ga0070678_100054643
730 Ga0070678_100091148
731 Ga0070681_10001768
732 Ga0070681_10014914
733 Ga0068867_100005923
734 Ga0070685_10007564
735 Ga0070685_10010376
736 Ga0070685_10052573
737 Ga0070685_10216737
738 Ga0070706_100002444
739 Ga0070706_100029474
740 Ga0070706_100035631
741 Ga0070706_100036586
742 Ga0070706_100051649
743 Ga0070706_100093545
744 Ga0070707_100017154
745 Ga0070707_100025429
746 Ga0070707_100054259
747 Ga0070707_100058615
748 Ga0070707_100063395
749 Ga0070707_100066272
750 Ga0070707_100105913
751 Ga0070707_100124493
752 Ga0070698_100000663
753 Ga0070698_100003071
754 Ga0070698_100011440
755 Ga0070698_100023286
756 Ga0070698_100244254
757 Ga0070699_100001203
758 Ga0070699_100001758
759 Ga0070699_100029783
760 Ga0070699_100081380
761 Ga0070679_100000014
762 Ga0070679_100006157
763 Ga0070684_100000164
764 Ga0070697_100000052
765 Ga0070697_100000392
766 Ga0070697_100001507
767 Ga0070697_100007189
768 Ga0070697_100082412
769 Ga0068853_100268761
770 Ga0070672_100002799
771 Ga0070672_100006986
772 Ga0070672_100039304
773 Ga0070672_100080294
774 Ga0070672_100082146
775 Ga0070695_100003292
776 Ga0070695_100071544
777 Ga0070696_100105246
778 Ga0070696_100205550
779 Ga0070693_100001436
780 Ga0070704_100014368
781 Ga0070704_100040138
782 Ga0070704_100078065
783 Ga0070704_100130982
784 Ga0070704_100303482
785 Ga0070664_100000622
786 Ga0070664_100001706
787 Ga0070664_100235941
788 Ga0070664_100268672
789 Ga0068857_100001440
790 Ga0068857_100018599
791 Ga0068857_100055714
792 Ga0068854_100018079
793 Ga0068854_100032954
794 Ga0068854_100083846
795 Ga0068854_100156450
796 Ga0068856_100011522
797 Ga0068856_100042909
798 Ga0070702_100004219
799 Ga0070702_100073970
800 Ga0070702_100118846
801 Ga0068859_100001240
802 Ga0068859_100011794
803 Ga0068859_100032878
804 Ga0068859_100037599
805 Ga0068859_100042862
806 Ga0068859_100045496
807 Ga0068859_100074804
808 Ga0068859_100084922
809 Ga0068859_100104200
810 Ga0068859_100143180
811 Ga0068859_100325245
812 Ga0068859_100442687
813 Ga0068864_100002141
814 Ga0068864_100005377
815 Ga0068864_100014627
816 Ga0068864_100046072
817 Ga0068864_100086700
818 Ga0068866_10062752
819 Ga0068861_100010082
820 Ga0068861_100016346
821 Ga0068861_100026089
822 Ga0068861_100042353
823 Ga0068861_100053634
824 Ga0068861_100151192
825 Ga0068861_100169067
826 Ga0068851_10000697
827 Ga0068870_10004836
828 Ga0068870_10025704
829 Ga0068863_100057835
830 Ga0068863_100090525
831 Ga0068863_100105877
832 Ga0068863_100269925
833 Ga0068863_100286824
834 Ga0068858_100001704
835 Ga0068858_100064992
836 Ga0068858_100245528
837 Ga0068858_100265706
838 Ga0068858_100275493
839 Ga0068860_100000332
840 Ga0068860_100011247
841 Ga0068860_100028339
842 Ga0068860_100120547
843 Ga0068860_100130706
844 Ga0068860_100273728
845 Ga0068862_100013402
846 Ga0068862_100026252
847 Ga0068862_100028086
848 Ga0068862_100036387
849 Ga0068862_100088354
850 Ga0068862_100423455
851 Ga0081539_10000189
852 Ga0081539_10000586
853 Ga0081539_10002211
854 Ga0081539_10010534
855 Ga0075365_10012018
856 Ga0075365_10012208
857 Ga0075364_10017911
858 Ga0075367_10000293
859 Ga0075367_10070636
860 Ga0075366_10000346
861 Ga0075366_10006149
862 Ga0097621_100003304
863 Ga0097621_100029472
864 Ga0068871_100003714
865 Ga0068871_100175201
866 Ga0075428_100006346
867 Ga0075428_100009479
868 Ga0075428_100266858
869 Ga0075428_100467130
870 Ga0075428_100535998
871 Ga0075430_100085697
872 Ga0075430_100241987
873 Ga0075431_100049164
874 Ga0075431_100084987
875 Ga0075431_100108970
876 Ga0075431_100128034
877 Ga0075433_10021780
878 Ga0075433_10032569
879 Ga0075433_10060093
880 Ga0075433_10207060
881 Ga0075433_10310532
882 Ga0075434_100065898
883 Ga0075434_100073830
884 Ga0075434_100097861
885 Ga0075434_100280858
886 Ga0075434_100296994
887 Ga0075429_100204212
888 Ga0068865_100006874
889 Ga0068865_100045223
890 Ga0075436_100003346
891 Ga0097620_100001240
892 Ga0097620_100011794
893 Ga0097620_100032879
894 Ga0097620_100037599
895 Ga0097620_100042862
896 Ga0097620_100045502
897 Ga0097620_100074804
898 Ga0097620_100084919
899 Ga0097620_100104198
900 Ga0097620_100143182
901 Ga0097620_100325231
902 Ga0097620_100442711
903 Ga0075435_100001795
904 Ga0075435_100016257
905 Ga0075435_100046973
906 Ga0075435_100062255
907 Ga0075435_100183703
908 Ga0111539_10003985
909 Ga0111539_10012899
910 Ga0111539_10027812
911 Ga0111539_10038827
912 Ga0111539_10142020
913 Ga0105245_10059728
914 Ga0105245_10133766
915 Ga0114129_10009353
916 Ga0114129_10017418
917 Ga0114129_10024082
918 Ga0114129_10035012
919 Ga0114129_10049547
920 Ga0114129_10057631
921 Ga0114129_10072964
922 Ga0114129_10082140
923 Ga0114129_10138382
924 Ga0114129_10151386
925 Ga0114129_10252090
926 Ga0114129_10267953
927 Ga0114129_10320748
928 Ga0105243_10001428
929 Ga0105243_10013165
930 Ga0105243_10121986
931 Ga0105243_10128957
932 Ga0105241_10025495
933 Ga0105242_10019734
934 Ga0105242_10026021
935 Ga0105248_10000564
936 Ga0105248_10039608
937 Ga0105248_10133047
938 Ga0105248_10452959
939 Ga0105237_10175384
940 Ga0105238_10020418
941 Ga0105249_10000112
942 Ga0105249_10048988
943 Ga0105249_10155246
944 Ga0105249_10161542
945 Ga0105239_10074282
946 Ga0105239_10249687
947 Ga0157378_10000113
948 Ga0157378_10002538
949 Ga0157378_10008274
950 Ga0157378_10014464
951 Ga0163162_10000055
952 Ga0163162_10017543
953 Ga0163162_10024565
954 Ga0163162_10036773
955 Ga0163162_10053662
956 Ga0157372_10076113
957 Ga0157372_10082361
958 Ga0157375_10002293
959 Ga0157375_10008617
960 Ga0157375_10038431
961 Ga0157375_10086154
962 Ga0157375_10219687
963 Ga0163163_10001068
964 Ga0163163_10110007
965 Ga0163163_10368453
966 Ga0157380_10010958
967 Ga0157380_10037231
968 Ga0157377_10062664
969 Ga0157379_10001932
970 Ga0157379_10124713
971 Ga0157376_10008467
972 Ga0157376_10015538
973 Ga0157376_10018488
974 Ga0163161_10018014
975 Ga0207656_10007706
976 Ga0207653_10034147
977 Ga0207642_10024793
978 Ga0207642_10035105
979 Ga0207710_10002567
980 Ga0207680_10009808
981 Ga0207647_10097649
982 Ga0207699_10000487
983 Ga0207645_10011781
984 Ga0207643_10001640
985 Ga0207643_10006247
986 Ga0207684_10000150
987 Ga0207684_10001515
988 Ga0207684_10002540
989 Ga0207684_10009673
990 Ga0207684_10022304
991 Ga0207684_10023528
992 Ga0207684_10034084
993 Ga0207684_10072098
994 Ga0207684_10085391
995 Ga0207684_10275338
996 Ga0207707_10000016
997 Ga0207707_10030530
998 Ga0207695_10075988
999 Ga0207671_10013889
1000 Ga0207671_10253618
1001 Ga0207660_10062820
1002 Ga0207662_10031399
1003 Ga0207649_10067084
1004 Ga0207649_10282442
1005 Ga0207652_10000693
1006 Ga0207652_10080277
1007 Ga0207646_10002445
1008 Ga0207646_10003620
1009 Ga0207646_10005648
1010 Ga0207646_10044828
1011 Ga0207646_10072185
1012 Ga0207646_10075009
1013 Ga0207681_10016403
1014 Ga0207681_10045495
1015 Ga0207681_10191897
1016 Ga0207650_10000011
1017 Ga0207650_10001109
1018 Ga0207650_10007858
1019 Ga0207650_10014076
1020 Ga0207659_10043564
1021 Ga0207659_10072184
1022 Ga0207659_10305594
1023 Ga0207687_10129042
1024 Ga0207644_10184178
1025 Ga0207644_10233178
1026 Ga0207706_10033215
1027 Ga0207706_10081288
1028 Ga0207706_10095869
1029 Ga0207686_10033065
1030 Ga0207686_10135107
1031 Ga0207670_10011935
1032 Ga0207670_10064621
1033 Ga0207670_10074929
1034 Ga0207669_10037475
1035 Ga0207669_10041842
1036 Ga0207704_10072147
1037 Ga0207691_10004374
1038 Ga0207691_10004462
1039 Ga0207691_10013415
1040 Ga0207691_10015463
1041 Ga0207691_10021941
1042 Ga0207691_10024798
1043 Ga0207691_10063573
1044 Ga0207711_10000319
1045 Ga0207711_10003877
1046 Ga0207711_10012552
1047 Ga0207711_10037485
1048 Ga0207711_10042205
1049 Ga0207711_10046999
1050 Ga0207689_10001943
1051 Ga0207689_10010949
1052 Ga0207689_10014815
1053 Ga0207689_10039942
1054 Ga0207689_10204653
1055 Ga0207661_10000482
1056 Ga0207679_10026648
1057 Ga0207679_10082692
1058 Ga0207679_10167478
1059 Ga0207679_10212542
1060 Ga0207651_10018643
1061 Ga0207651_10025936
1062 Ga0207651_10053006
1063 Ga0207651_10082240
1064 Ga0207651_10100340
1065 Ga0207651_10110315
1066 Ga0207651_10249669
1067 Ga0207712_10000416
1068 Ga0207712_10007881
1069 Ga0207712_10014558
1070 Ga0207712_10264146
1071 Ga0207668_10015113
1072 Ga0207640_10025704
1073 Ga0207640_10033246
1074 Ga0207658_10004948
1075 Ga0207658_10048736
1076 Ga0207658_10111775
1077 Ga0207677_10152234
1078 Ga0207703_10232137
1079 Ga0207678_10018286
1080 Ga0207678_10021305
1081 Ga0207678_10021506
1082 Ga0207678_10040231
1083 Ga0207678_10256608
1084 Ga0207708_10013289
1085 Ga0207708_10021887
1086 Ga0207708_10098962
1087 Ga0207708_10289914
1088 Ga0207702_10008510
1089 Ga0207702_10053728
1090 Ga0207641_10017551
1091 Ga0207641_10052860
1092 Ga0207641_10269001
1093 Ga0207641_10286627
1094 Ga0207648_10007033
1095 Ga0207648_10017631
1096 Ga0207648_10352825
1097 Ga0207676_10033479
1098 Ga0207676_10376194
1099 Ga0207674_10000108
1100 Ga0207674_10069303
1101 Ga0207674_10139763
1102 Ga0207674_10199232
1103 Ga0207674_10257262
1104 Ga0207674_10345420
1105 Ga0207675_100004786
1106 Ga0207675_100014312
1107 Ga0207675_100025741
1108 Ga0207675_100032539
1109 Ga0207675_100050979
1110 Ga0207675_100079021
1111 Ga0207675_100091962
1112 Ga0207675_100121536
1113 Ga0207675_100227252
1114 Ga0207683_10016006
1115 Ga0207683_10016131
1116 Ga0207683_10071417
1117 Ga0207698_10268590
1118 Ga0207428_10000535
1119 Ga0268266_10263751
1120 Ga0268265_10047592
1121 Ga0268265_10236230
1122 Ga0268265_10312528
1123 Ga0268264_10000681
1124 Ga0268264_10046882
1125 Ga0268264_10083303
1126 Ga0268264_10109933
1127 Ga0265328_10030706
1128 Ga0265328_10038504
1129 Ga0265325_10052200
1130 Ga0265329_10002284
1131 Ga0265339_10011004
1132 Ga0265331_10029472
1133 Ga0265316_10028836
1134 Ga0265316_10140180
1135 Ga0307513_10276834
1136 Ga0307408_100019737
1137 Ga0307408_100046355
1138 Ga0307408_100110492
1139 Ga0307408_100387769
1140 Ga0265314_10003215
1141 Ga0265314_10163265
1142 Ga0307405_10131443
1143 Ga0307413_10057602
1144 Ga0307413_10082362
1145 Ga0307413_10208638
1146 Ga0307410_10031921
1147 Ga0307410_10087099
1148 Ga0307407_10049701
1149 Ga0307412_10005497
1150 Ga0307412_10080904
1151 Ga0307409_100182262
1152 Ga0307409_100317555
1153 Ga0307416_100019896
1154 Ga0307416_100047582
1155 Ga0307416_100105972
1156 Ga0307416_100127092
1157 Ga0307416_100150814
1158 Ga0307416_100241206
1159 Ga0307416_100305286
1160 Ga0307414_10067019
1161 Ga0307414_10095507
1162 Ga0307411_10034791
1163 Ga0307411_10056996
1164 Ga0307411_10105887
1165 Ga0307411_10273460
1166 Ga0307415_100106594
1167 Ga0307415_100145863
1168 Ga0307415_100192433
1169 Ga0373948_0002612
1170 Ga0373951_0000974
1171 Ga0373941_0006128
1172 Ga0373960_0018719
1173 Ga0373961_0010888
1174 Ga0373937_0054902
1175 Ga0395905_0153701
1176 Ga0395901_0306173
1177 Ga0450923_001924
1178 Ga0453683_0086571
1179 Ga0453684_0021356
1180 Ga0451576_0078586
1181 Ga0495638_0028832
1182 Ga0495663_0001413
1183 Ga0495598_0000020
1184 Ga0495621_0000177
1185 Ga0495621_0022595
1186 Ga0495645_0036416
1187 Ga0495667_0080397
1188 Ga0495613_0145188
1189 Ga0495600_0159939
1190 Ga0496103_0040984
1191 Ga0496104_0002343
1192 Ga0496104_0043753
1193 Ga0496104_0076035
1194 Ga0496106_0000318
1195 Ga0496106_0046661
1196 Ga0496106_0087443
1197 Ga0496106_0131510
1198 Ga0496108_0005229
1199 Ga0496109_0001089
1200 Ga0496109_0200299
1201 Ga0496109_0373311
1202 Ga0496109_0384008
1203 Ga0496110_0008729
1204 Ga0496111_0040068
1205 Ga0496112_0008391
1206 Ga0496112_0215037
1207 Ga0496113_0074358
1208 Ga0501292_007497
1209 Ga0501298_003706
1210 Ga0501299_014557
1211 Ga0501036_0080848
1212 Ga0501036_0190290
1213 Ga0501040_0025239
1214 Ga0501042_0034953
1215 Ga0501042_0054827
1216 Ga0501042_0145391
1217 Ga0501046_0062939
1218 Ga0501046_0118590
1219 Ga0501048_0018199
1220 Ga0501048_0039918
1221 Ga0501048_0113658
1222 Ga0501048_0136700
1223 Ga0501067_0022682
1224 Ga0501069_0137430
1225 Ga0501071_0049977
1226 Ga0501072_0030593
1227 Ga0501072_0118847
1228 Ga0501075_0010280
1229 Ga0501075_0010839
1230 Ga0501075_0032342
1231 Ga0501075_0052374
1232 Ga0501076_0022579
1233 Ga0501076_0033248
1234 Ga0501076_0048981
1235 Ga0501076_0329301
1236 Ga0501077_0000559
1237 Ga0501235_008119
1238 Ga0501243_009338
1239 Ga0501249_003530
1240 Ga0501225_0008773
1241 Ga0501079_0089629
1242 Ga0501079_0149422
1243 Ga0501081_0001396
1244 Ga0501081_0165892
1245 Ga0501083_0145951
1246 Ga0501265_003280
1247 Ga0501283_002388
1248 Ga0501045_0022890
1249 Ga0501045_0028225
1250 Ga0501045_0096810
1251 Ga0501045_0164949
1252 nmdc:mga03683_10534_c1
1253 nmdc:mga00v17_21642_c1
1254 nmdc:mga0yw44_12225_c1
1255 nmdc:mga06z11_1616_c1
1256 nmdc:mga06z11_51765_c1
1257 nmdc:mga05p37_145660_c1
1258 nmdc:mga05p37_18308_c1
1259 nmdc:mga05p37_195198_c1
1260 nmdc:mga05p37_214714_c1
1261 nmdc:mga05p37_217743_c1
1262 nmdc:mga05p37_31782_c1
1263 nmdc:mga05p37_38468_c1
1264 nmdc:mga05p37_68875_c1
1265 nmdc:mga05p37_69900_c1
1266 nmdc:mga05p37_79435_c1
1267 nmdc:mga05p37_8524_c1
1268 nmdc:mga09592_215662_c1
1269 nmdc:mga09592_99521_c1
1270 nmdc:mga0qj67_300411_c1
1271 nmdc:mga0qj67_58614_c1
1272 nmdc:mga06r32_112398_c1
1273 nmdc:mga06r32_116259_c1
1274 nmdc:mga06r32_152688_c1
1275 nmdc:mga06r32_23114_c1
1276 nmdc:mga06r32_84032_c1
1277 nmdc:mga08y16_15085_c1
1278 nmdc:mga08y16_152594_c1
1279 nmdc:mga08y16_185387_c1
1280 nmdc:mga08y16_4851_c1
1281 nmdc:mga08y16_5560_c1
1282 nmdc:mga0n895_15270_c1
1283 nmdc:mga0n895_21932_c1
1284 nmdc:mga0n895_233687_c1
1285 nmdc:mga0n895_458536_c1
1286 nmdc:mga0rr50_33110_c1
1287 nmdc:mga0rr50_8273_c1
1288 nmdc:mga0rr50_87344_c1
1289 nmdc:mga08x19_2717_c1
1290 nmdc:mga0a205_125071_c1
1291 nmdc:mga0a205_184626_c1
1292 nmdc:mga0a205_203473_c1
1293 nmdc:mga0a205_250704_c1
1294 nmdc:mga0a205_85052_c1
1295 nmdc:mga0a205_99937_c1
1296 Ga0495601_0091698
1297 Ga0495619_0006474
1298 Ga0500568_0001572
1299 Ga0501084_0010745
1300 Ga0501084_0035929
1301 Ga0501084_0150722
1302 Ga0590071_000833
1303 Ga0590074_006163
1304 Ga0501082_0040687
1305 Ga0530510_0058715
1306 Ga0530510_0069217

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01112

Asparaginase_2

Asparaginase

32

317

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
9gac-assembly1.cif.gz_A precursor of the t152c mutant glycosylasparaginase from flavobacterium meningosepticum 0.9624 40 363
5v2i-assembly1.cif.gz_A crystal structure of a mutant glycosylasparaginase (g172d) that causes the genetic disease aspartylglucosaminuria 0.9617 38 363
2gac-assembly1.cif.gz_C t152c mutant glycosylasparaginase from flavobacterium meningosepticum 0.9586 63 182
6nq6-assembly1.cif.gz_C structure & function of a new aspartylglucosaminuria variant 0.9555 63 182
9gac-assembly1.cif.gz_C precursor of the t152c mutant glycosylasparaginase from flavobacterium meningosepticum 0.954 40 363
ID Description Score Start End Superfamily
af_Q9VXT7_188_321_3.60.20.30 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase 0.9207 222 359 3.60.20.30
6nq6B00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase 0.9181 222 363 3.60.20.30
af_F1QE55_150_287_3.60.20.30 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase 0.8901 222 361 3.60.20.30
af_A0A1D6E422_260_394_3.60.20.30 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase 0.889 222 362 3.60.20.30
6nq6B00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase 0.8754 222 363 3.60.20.30
ID Description Score Start End GO Terms
AF-A0A7W1HKR6-F1-model_v4 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase 0.9902 38 367 GO:0005737
GO:0016787
AF-A0A6L7JYI3-F1-model_v4 deleted 0.9893 98 178
AF-A0A3D2ZBX6-F1-model_v4 Glycosylasparaginase 0.9696 60 181 GO:0005737
GO:0016787
AF-A0A7X4E001-F1-model_v4 Asparaginase 0.9692 238 371 GO:0005737
GO:0016787
AF-A0A2V7YXN7-F1-model_v4 Asparaginase 0.968 101 233 GO:0005737
GO:0016787

Map