F472297
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 647 | 296 | 629 | 625 |
Family's Representative Sequence
| Representative Sequence | 3300031727|Ga0316576_10000968|Ga0316576_100009683 |
| Length | 661 |
| Sequence | MLNMPDRPSSFSGPTLHRHPLLASIDSPADLRALPEHQLAAVANELRSFLVDTVAQTGGHLAAGLGVVELTIGLHYVFDTPEDRLIWDVGHQAYPHKILTGRRERMRTLRQQDGLSGFPKRSESEYDCFGVGHSSTSISAALGMSLAAMQRGERRNVVAVIGDGALSAGMAFEALNHAGSMDVDLTVILNDNEMSISPPVGAITNHLARLLSGKFYTTMREGSKSALRGMPQLRHLVGRWEEHMKGMLMPSTLFEELGFNYIGPIDGHDVHAVVKTLRNIKEMCGQRFLHVVTQKGHGYEPAEGHPVTYHGVTPFDRRTGELRKGGSKGPTYTQVFGGWLCDTAEKDPRLVGITPAMCEGSGLTVFSKRFPERYYDVGIAEQHAVTLAAGMACEGLKPVVAIYSSFLQRAYDQLVHDVCLQDLDVTFAVDRGGLVGADGPTHAGSFDLSFGRPLPRLVIMAPSDENECRRMLRTAYEYPGPAMVRYPRGSGLGVAIDPDAPVLPIGCGEVVRRGRQVALLAFGSMVAPALAAAEGLGATVANMRFVKPLDGALVRELAEGHELLVTIEENSIAGGAGSGVAEWLSSQGLTLPCVHLGLPDRYVEHAEHAQQLAACGLDAPGILTSVRDALSRCFPDRASPGAATTSPAEVMQERHQGIGAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 4 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 5 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 6 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 7 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 8 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 9 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 10 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 11 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 12 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 13 | 2913912277 | Desmonostoc muscorum LEGE 12446 | Isolate | Unclassified |
| 14 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 15 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 16 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 17 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 185 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 193 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 194 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 195 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 196 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 197 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 199 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 210 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 217 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 218 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 219 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 226 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 227 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 228 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 229 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 230 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 231 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 232 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 233 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 234 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 235 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 236 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 239 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 254 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 277 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 285 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 286 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 287 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 288 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 289 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 290 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 291 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 292 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 293 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 296 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.83 |
| Metatranscriptomes | 1.39 |
| Isolates | 2.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 2.47 |
| Nodule | 0 |
| Rhizoplane | 1.55 |
| Rhizosphere | 89.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10015059 | 3300003215 | Bacteria | 3173 |
| 2 | Ga0065165_1000967 | 3300005262 | Bacteria | 36011 |
| 3 | Ga0070658_10034906 | 3300005327 | Bacteria | 4048 |
| 4 | Ga0070676_10000669 | 3300005328 | Bacteria | 16700 |
| 5 | Ga0070676_10001034 | 3300005328 | Bacteria | 13850 |
| 6 | Ga0070676_10023839 | 3300005328 | Bacteria | 3442 |
| 7 | Ga0070676_10055009 | 3300005328 | Bacteria | 2347 |
| 8 | Ga0070683_100001269 | 3300005329 | Bacteria | 19223 |
| 9 | Ga0070683_100017092 | 3300005329 | Bacteria | 6404 |
| 10 | Ga0070683_100056513 | 3300005329 | Bacteria | 3645 |
| 11 | Ga0070670_100025573 | 3300005331 | Bacteria | 5078 |
| 12 | Ga0070670_100036095 | 3300005331 | Bacteria | 4255 |
| 13 | Ga0070677_10000567 | 3300005333 | Bacteria | 12596 |
| 14 | Ga0070677_10000838 | 3300005333 | Bacteria | 10102 |
| 15 | Ga0070677_10003738 | 3300005333 | Bacteria | 4924 |
| 16 | Ga0068869_100003429 | 3300005334 | Bacteria | 9692 |
| 17 | Ga0070666_10001457 | 3300005335 | Bacteria | 14355 |
| 18 | Ga0070682_100048817 | 3300005337 | Bacteria | 2637 |
| 19 | Ga0068868_100007835 | 3300005338 | Bacteria | 7624 |
| 20 | Ga0068868_100019673 | 3300005338 | Bacteria | 5063 |
| 21 | Ga0068868_100068650 | 3300005338 | Bacteria | 2823 |
| 22 | Ga0070660_100001725 | 3300005339 | Bacteria | 14990 |
| 23 | Ga0070660_100026101 | 3300005339 | Bacteria | 4348 |
| 24 | Ga0070660_100083946 | 3300005339 | Bacteria | 2503 |
| 25 | Ga0070689_100000557 | 3300005340 | Bacteria | 22315 |
| 26 | Ga0070689_100006704 | 3300005340 | Bacteria | 8003 |
| 27 | Ga0070689_100047646 | 3300005340 | Bacteria | 3304 |
| 28 | Ga0070687_100002704 | 3300005343 | Bacteria | 6710 |
| 29 | Ga0070661_100001819 | 3300005344 | Bacteria | 14786 |
| 30 | Ga0070661_100003561 | 3300005344 | Bacteria | 10721 |
| 31 | Ga0070661_100009780 | 3300005344 | Bacteria | 6651 |
| 32 | Ga0070668_100001724 | 3300005347 | Bacteria | 15891 |
| 33 | Ga0070668_100003798 | 3300005347 | Bacteria | 11164 |
| 34 | Ga0070668_100007290 | 3300005347 | Bacteria | 8205 |
| 35 | Ga0070668_100009366 | 3300005347 | Bacteria | 7265 |
| 36 | Ga0070668_100056258 | 3300005347 | Bacteria | 3037 |
| 37 | Ga0070668_100061786 | 3300005347 | Bacteria | 2903 |
| 38 | Ga0070668_100099464 | 3300005347 | Bacteria | 2303 |
| 39 | Ga0070669_100001481 | 3300005353 | Bacteria | 16988 |
| 40 | Ga0070669_100011126 | 3300005353 | Bacteria | 6386 |
| 41 | Ga0070669_100018241 | 3300005353 | Bacteria | 5014 |
| 42 | Ga0070675_100003903 | 3300005354 | Bacteria | 11300 |
| 43 | Ga0070675_100009408 | 3300005354 | Bacteria | 7603 |
| 44 | Ga0070675_100009969 | 3300005354 | Bacteria | 7410 |
| 45 | Ga0070675_100020283 | 3300005354 | Bacteria | 5304 |
| 46 | Ga0070675_100026322 | 3300005354 | Bacteria | 4669 |
| 47 | Ga0070675_100054286 | 3300005354 | Bacteria | 3296 |
| 48 | Ga0070675_100092379 | 3300005354 | Bacteria | 2537 |
| 49 | Ga0070671_100000593 | 3300005355 | Bacteria | 25873 |
| 50 | Ga0070671_100003441 | 3300005355 | Bacteria | 12354 |
| 51 | Ga0070671_100005776 | 3300005355 | Bacteria | 9855 |
| 52 | Ga0070671_100007129 | 3300005355 | Bacteria | 8931 |
| 53 | Ga0070671_100010109 | 3300005355 | Bacteria | 7579 |
| 54 | Ga0070671_100012314 | 3300005355 | Bacteria | 6887 |
| 55 | Ga0070671_100031073 | 3300005355 | Bacteria | 4409 |
| 56 | Ga0070671_100049905 | 3300005355 | Bacteria | 3481 |
| 57 | Ga0070674_100001635 | 3300005356 | Bacteria | 12065 |
| 58 | Ga0070674_100017988 | 3300005356 | Bacteria | 4459 |
| 59 | Ga0070673_100000080 | 3300005364 | Bacteria | 41486 |
| 60 | Ga0070673_100001988 | 3300005364 | Bacteria | 12328 |
| 61 | Ga0070673_100014064 | 3300005364 | Bacteria | 5559 |
| 62 | Ga0070673_100104679 | 3300005364 | Bacteria | 2337 |
| 63 | Ga0070659_100001068 | 3300005366 | Bacteria | 20045 |
| 64 | Ga0070659_100083126 | 3300005366 | Bacteria | 2559 |
| 65 | Ga0070667_100003598 | 3300005367 | Bacteria | 13182 |
| 66 | Ga0070667_100006553 | 3300005367 | Bacteria | 9678 |
| 67 | Ga0070667_100007287 | 3300005367 | Bacteria | 9195 |
| 68 | Ga0070667_100007540 | 3300005367 | Bacteria | 9025 |
| 69 | Ga0070667_100014815 | 3300005367 | Bacteria | 6441 |
| 70 | Ga0070667_100034829 | 3300005367 | Bacteria | 4215 |
| 71 | Ga0070667_100133459 | 3300005367 | Bacteria | 2169 |
| 72 | Ga0070709_10061892 | 3300005434 | Bacteria | 2384 |
| 73 | Ga0070714_100011920 | 3300005435 | Bacteria | 6913 |
| 74 | Ga0070714_100047637 | 3300005435 | Bacteria | 3642 |
| 75 | Ga0070713_100000049 | 3300005436 | Bacteria | 74072 |
| 76 | Ga0070713_100012791 | 3300005436 | Bacteria | 6169 |
| 77 | Ga0070705_100017562 | 3300005440 | Bacteria | 3736 |
| 78 | Ga0070705_100022441 | 3300005440 | Bacteria | 3373 |
| 79 | Ga0070705_100033576 | 3300005440 | Bacteria | 2861 |
| 80 | Ga0070694_100017694 | 3300005444 | Bacteria | 4505 |
| 81 | Ga0070708_100000012 | 3300005445 | Bacteria | 133550 |
| 82 | Ga0070663_100058747 | 3300005455 | Bacteria | 2763 |
| 83 | Ga0070678_100002115 | 3300005456 | Bacteria | 10765 |
| 84 | Ga0070678_100005691 | 3300005456 | Bacteria | 7240 |
| 85 | Ga0070678_100009819 | 3300005456 | Bacteria | 5819 |
| 86 | Ga0070678_100023815 | 3300005456 | Bacteria | 4087 |
| 87 | Ga0070678_100049351 | 3300005456 | Bacteria | 3037 |
| 88 | Ga0070678_100079212 | 3300005456 | Bacteria | 2484 |
| 89 | Ga0070662_100001613 | 3300005457 | Bacteria | 13924 |
| 90 | Ga0070662_100014178 | 3300005457 | Bacteria | 5318 |
| 91 | Ga0070662_100031453 | 3300005457 | Bacteria | 3724 |
| 92 | Ga0070662_100044204 | 3300005457 | Bacteria | 3190 |
| 93 | Ga0070681_10002261 | 3300005458 | Bacteria | 17589 |
| 94 | Ga0068867_100001683 | 3300005459 | Bacteria | 15420 |
| 95 | Ga0068867_100002555 | 3300005459 | Bacteria | 12829 |
| 96 | Ga0068867_100007906 | 3300005459 | Bacteria | 7514 |
| 97 | Ga0070685_10010723 | 3300005466 | Bacteria | 4771 |
| 98 | Ga0070685_10012286 | 3300005466 | Bacteria | 4496 |
| 99 | Ga0070707_100049687 | 3300005468 | Bacteria | 4020 |
| 100 | Ga0070699_100004966 | 3300005518 | Bacteria | 11730 |
| 101 | Ga0070697_100011619 | 3300005536 | Bacteria | 6882 |
| 102 | Ga0070697_100036887 | 3300005536 | Bacteria | 3948 |
| 103 | Ga0068853_100000801 | 3300005539 | Bacteria | 21847 |
| 104 | Ga0068853_100013983 | 3300005539 | Bacteria | 6565 |
| 105 | Ga0070672_100001862 | 3300005543 | Bacteria | 13173 |
| 106 | Ga0070672_100002100 | 3300005543 | Bacteria | 12567 |
| 107 | Ga0070672_100002116 | 3300005543 | Bacteria | 12536 |
| 108 | Ga0070672_100002490 | 3300005543 | Bacteria | 11720 |
| 109 | Ga0070672_100054868 | 3300005543 | Bacteria | 3120 |
| 110 | Ga0070686_100005776 | 3300005544 | Bacteria | 6858 |
| 111 | Ga0070686_100023233 | 3300005544 | Bacteria | 3703 |
| 112 | Ga0070696_100022229 | 3300005546 | Bacteria | 4308 |
| 113 | Ga0070693_100001090 | 3300005547 | Bacteria | 12181 |
| 114 | Ga0070693_100010495 | 3300005547 | Bacteria | 4644 |
| 115 | Ga0070665_100000769 | 3300005548 | Bacteria | 42290 |
| 116 | Ga0070665_100005673 | 3300005548 | Bacteria | 12825 |
| 117 | Ga0070665_100006695 | 3300005548 | Bacteria | 11713 |
| 118 | Ga0070665_100015080 | 3300005548 | Bacteria | 7759 |
| 119 | Ga0070665_100035159 | 3300005548 | Bacteria | 5037 |
| 120 | Ga0070665_100090774 | 3300005548 | Bacteria | 3061 |
| 121 | Ga0070704_100010773 | 3300005549 | Bacteria | 5574 |
| 122 | Ga0070704_100094465 | 3300005549 | Bacteria | 2237 |
| 123 | Ga0068855_100004503 | 3300005563 | Bacteria | 17022 |
| 124 | Ga0068855_100064429 | 3300005563 | Bacteria | 4274 |
| 125 | Ga0068855_100074434 | 3300005563 | Bacteria | 3944 |
| 126 | Ga0068855_100111679 | 3300005563 | Bacteria | 3138 |
| 127 | Ga0070664_100000855 | 3300005564 | Bacteria | 23547 |
| 128 | Ga0070664_100002684 | 3300005564 | Bacteria | 14358 |
| 129 | Ga0070664_100016106 | 3300005564 | Bacteria | 6128 |
| 130 | Ga0070664_100056597 | 3300005564 | Bacteria | 3332 |
| 131 | Ga0070664_100139631 | 3300005564 | Bacteria | 2133 |
| 132 | Ga0068854_100007266 | 3300005578 | Bacteria | 7073 |
| 133 | Ga0068854_100014053 | 3300005578 | Bacteria | 5270 |
| 134 | Ga0068854_100029505 | 3300005578 | Bacteria | 3798 |
| 135 | Ga0068856_100000125 | 3300005614 | Bacteria | 77301 |
| 136 | Ga0068856_100003705 | 3300005614 | Bacteria | 15335 |
| 137 | Ga0070702_100001358 | 3300005615 | Bacteria | 9970 |
| 138 | Ga0070702_100019107 | 3300005615 | Bacteria | 3566 |
| 139 | Ga0070702_100022379 | 3300005615 | Bacteria | 3339 |
| 140 | Ga0068852_100083762 | 3300005616 | Bacteria | 2836 |
| 141 | Ga0068852_100091280 | 3300005616 | Bacteria | 2725 |
| 142 | Ga0068859_100015900 | 3300005617 | Bacteria | 7563 |
| 143 | Ga0068859_100019851 | 3300005617 | Bacteria | 6746 |
| 144 | Ga0068859_100022664 | 3300005617 | Bacteria | 6296 |
| 145 | Ga0068864_100002543 | 3300005618 | Bacteria | 15058 |
| 146 | Ga0068864_100017016 | 3300005618 | Bacteria | 6059 |
| 147 | Ga0068864_100021775 | 3300005618 | Bacteria | 5370 |
| 148 | Ga0068864_100046626 | 3300005618 | Bacteria | 3719 |
| 149 | Ga0068866_10001951 | 3300005718 | Bacteria | 8595 |
| 150 | Ga0068861_100000502 | 3300005719 | Bacteria | 22776 |
| 151 | Ga0068861_100000511 | 3300005719 | Bacteria | 22624 |
| 152 | Ga0068861_100000559 | 3300005719 | Bacteria | 22056 |
| 153 | Ga0068861_100069869 | 3300005719 | Bacteria | 2718 |
| 154 | Ga0068861_100086813 | 3300005719 | Bacteria | 2460 |
| 155 | Ga0068851_10000160 | 3300005834 | Bacteria | 35442 |
| 156 | Ga0068851_10008106 | 3300005834 | Bacteria | 4847 |
| 157 | Ga0068870_10013406 | 3300005840 | Bacteria | 3850 |
| 158 | Ga0068863_100012466 | 3300005841 | Bacteria | 8206 |
| 159 | Ga0068863_100032091 | 3300005841 | Bacteria | 5008 |
| 160 | Ga0068858_100011298 | 3300005842 | Bacteria | 8438 |
| 161 | Ga0068858_100017415 | 3300005842 | Bacteria | 6739 |
| 162 | Ga0068858_100026879 | 3300005842 | Bacteria | 5345 |
| 163 | Ga0068858_100063456 | 3300005842 | Bacteria | 3419 |
| 164 | Ga0068860_100006234 | 3300005843 | Bacteria | 11984 |
| 165 | Ga0068860_100006790 | 3300005843 | Bacteria | 11470 |
| 166 | Ga0068860_100015014 | 3300005843 | Bacteria | 7569 |
| 167 | Ga0068860_100018470 | 3300005843 | Bacteria | 6782 |
| 168 | Ga0068860_100054494 | 3300005843 | Bacteria | 3801 |
| 169 | Ga0068862_100004088 | 3300005844 | Bacteria | 12372 |
| 170 | Ga0068862_100009782 | 3300005844 | Bacteria | 7926 |
| 171 | Ga0068862_100013173 | 3300005844 | Bacteria | 6840 |
| 172 | Ga0068862_100014504 | 3300005844 | Bacteria | 6540 |
| 173 | Ga0081455_10001787 | 3300005937 | Bacteria | 25984 |
| 174 | Ga0070716_100014257 | 3300006173 | Bacteria | 4070 |
| 175 | Ga0070712_100020705 | 3300006175 | Bacteria | 4306 |
| 176 | Ga0075366_10001852 | 3300006195 | Bacteria | 10665 |
| 177 | Ga0097621_100004956 | 3300006237 | Bacteria | 9334 |
| 178 | Ga0097621_100005297 | 3300006237 | Bacteria | 9084 |
| 179 | Ga0097621_100016840 | 3300006237 | Bacteria | 5538 |
| 180 | Ga0097621_100049946 | 3300006237 | Bacteria | 3400 |
| 181 | Ga0075370_10019906 | 3300006353 | Bacteria | 3658 |
| 182 | Ga0068871_100008985 | 3300006358 | Bacteria | 7215 |
| 183 | Ga0068871_100038937 | 3300006358 | Bacteria | 3801 |
| 184 | Ga0068871_100088568 | 3300006358 | Bacteria | 2575 |
| 185 | Ga0075428_100001689 | 3300006844 | Bacteria | 23548 |
| 186 | Ga0075428_100001774 | 3300006844 | Bacteria | 23035 |
| 187 | Ga0075428_100002700 | 3300006844 | Bacteria | 19312 |
| 188 | Ga0075428_100035286 | 3300006844 | Bacteria | 5513 |
| 189 | Ga0075428_100176831 | 3300006844 | Bacteria | 2311 |
| 190 | Ga0075430_100000749 | 3300006846 | Bacteria | 24969 |
| 191 | Ga0075430_100010346 | 3300006846 | Bacteria | 7899 |
| 192 | Ga0075430_100090366 | 3300006846 | Bacteria | 2562 |
| 193 | Ga0075431_100000091 | 3300006847 | Bacteria | 55827 |
| 194 | Ga0075431_100011736 | 3300006847 | Bacteria | 8840 |
| 195 | Ga0075434_100000391 | 3300006871 | Bacteria | 32055 |
| 196 | Ga0075429_100000742 | 3300006880 | Bacteria | 25591 |
| 197 | Ga0075429_100043811 | 3300006880 | Bacteria | 3893 |
| 198 | Ga0068865_100010605 | 3300006881 | Bacteria | 5743 |
| 199 | Ga0068865_100019608 | 3300006881 | Bacteria | 4378 |
| 200 | Ga0068865_100022421 | 3300006881 | Bacteria | 4119 |
| 201 | Ga0068865_100106120 | 3300006881 | Bacteria | 2065 |
| 202 | Ga0075436_100010289 | 3300006914 | Bacteria | 6404 |
| 203 | Ga0097620_100015901 | 3300006931 | Bacteria | 7563 |
| 204 | Ga0097620_100019851 | 3300006931 | Bacteria | 6746 |
| 205 | Ga0097620_100022664 | 3300006931 | Bacteria | 6296 |
| 206 | Ga0075435_100006842 | 3300007076 | Bacteria | 8090 |
| 207 | Ga0099795_10000016 | 3300007788 | Bacteria | 63930 |
| 208 | Ga0105240_10009479 | 3300009093 | Bacteria | 13784 |
| 209 | Ga0105240_10052541 | 3300009093 | Bacteria | 5122 |
| 210 | Ga0111539_10000486 | 3300009094 | Bacteria | 50337 |
| 211 | Ga0111539_10005451 | 3300009094 | Bacteria | 16460 |
| 212 | Ga0111539_10072061 | 3300009094 | Bacteria | 4075 |
| 213 | Ga0105245_10019608 | 3300009098 | Bacteria | 5925 |
| 214 | Ga0105245_10029850 | 3300009098 | Bacteria | 4820 |
| 215 | Ga0114129_10000484 | 3300009147 | Bacteria | 48049 |
| 216 | Ga0114129_10013411 | 3300009147 | Bacteria | 11679 |
| 217 | Ga0105241_10004734 | 3300009174 | Bacteria | 10031 |
| 218 | Ga0105241_10026924 | 3300009174 | Bacteria | 4280 |
| 219 | Ga0105242_10035475 | 3300009176 | Bacteria | 4000 |
| 220 | Ga0105242_10107307 | 3300009176 | Bacteria | 2375 |
| 221 | Ga0105248_10002830 | 3300009177 | Bacteria | 19252 |
| 222 | Ga0105248_10048166 | 3300009177 | Bacteria | 4780 |
| 223 | Ga0105248_10048405 | 3300009177 | Bacteria | 4769 |
| 224 | Ga0105238_10016470 | 3300009551 | Bacteria | 7483 |
| 225 | Ga0105249_10006904 | 3300009553 | Bacteria | 9897 |
| 226 | Ga0105249_10028407 | 3300009553 | Bacteria | 5048 |
| 227 | Ga0099796_10000003 | 3300010159 | Bacteria | 81717 |
| 228 | Ga0105239_10008175 | 3300010375 | Bacteria | 11935 |
| 229 | Ga0157373_10000833 | 3300013100 | Bacteria | 23948 |
| 230 | Ga0157373_10006811 | 3300013100 | Bacteria | 8512 |
| 231 | Ga0157373_10053654 | 3300013100 | Bacteria | 2866 |
| 232 | Ga0157371_10002450 | 3300013102 | Bacteria | 17681 |
| 233 | Ga0157371_10031715 | 3300013102 | Bacteria | 3807 |
| 234 | Ga0157370_10002271 | 3300013104 | Bacteria | 23325 |
| 235 | Ga0157370_10003286 | 3300013104 | Bacteria | 19065 |
| 236 | Ga0157369_10004230 | 3300013105 | Bacteria | 17004 |
| 237 | Ga0157369_10097566 | 3300013105 | Bacteria | 3135 |
| 238 | Ga0157369_10136427 | 3300013105 | Bacteria | 2598 |
| 239 | Ga0157374_10052465 | 3300013296 | Bacteria | 3798 |
| 240 | Ga0157374_10075254 | 3300013296 | Bacteria | 3191 |
| 241 | Ga0157374_10153685 | 3300013296 | Bacteria | 2239 |
| 242 | Ga0157378_10005252 | 3300013297 | Bacteria | 11376 |
| 243 | Ga0157378_10005800 | 3300013297 | Bacteria | 10821 |
| 244 | Ga0157378_10009642 | 3300013297 | Bacteria | 8406 |
| 245 | Ga0163162_10000874 | 3300013306 | Bacteria | 28091 |
| 246 | Ga0163162_10013843 | 3300013306 | Bacteria | 7880 |
| 247 | Ga0163162_10020412 | 3300013306 | Bacteria | 6510 |
| 248 | Ga0163162_10025680 | 3300013306 | Bacteria | 5824 |
| 249 | Ga0157372_10010634 | 3300013307 | Bacteria | 9793 |
| 250 | Ga0157375_10004266 | 3300013308 | Bacteria | 12398 |
| 251 | Ga0163163_10001444 | 3300014325 | Bacteria | 20077 |
| 252 | Ga0163163_10010745 | 3300014325 | Bacteria | 8257 |
| 253 | Ga0163163_10038021 | 3300014325 | Bacteria | 4686 |
| 254 | Ga0163163_10039604 | 3300014325 | Bacteria | 4600 |
| 255 | Ga0163163_10132838 | 3300014325 | Bacteria | 2529 |
| 256 | Ga0157380_10005809 | 3300014326 | Bacteria | 8637 |
| 257 | Ga0157380_10015362 | 3300014326 | Bacteria | 5627 |
| 258 | Ga0157380_10058304 | 3300014326 | Bacteria | 3077 |
| 259 | Ga0157377_10004789 | 3300014745 | Bacteria | 6275 |
| 260 | Ga0157377_10056704 | 3300014745 | Bacteria | 2226 |
| 261 | Ga0157379_10004023 | 3300014968 | Bacteria | 12525 |
| 262 | Ga0157379_10009639 | 3300014968 | Bacteria | 8407 |
| 263 | Ga0157379_10016262 | 3300014968 | Bacteria | 6546 |
| 264 | Ga0157379_10017483 | 3300014968 | Bacteria | 6313 |
| 265 | Ga0157376_10004890 | 3300014969 | Bacteria | 9337 |
| 266 | Ga0157376_10005676 | 3300014969 | Bacteria | 8739 |
| 267 | Ga0157376_10024290 | 3300014969 | Bacteria | 4756 |
| 268 | Ga0157376_10035057 | 3300014969 | Bacteria | 4056 |
| 269 | Ga0163161_10004806 | 3300017792 | Bacteria | 9411 |
| 270 | Ga0163161_10061132 | 3300017792 | Bacteria | 2742 |
| 271 | Ga0209758_1000146 | 3300025297 | Bacteria | 169246 |
| 272 | Ga0209050_1000980 | 3300025298 | Bacteria | 36398 |
| 273 | Ga0207697_10000114 | 3300025315 | Bacteria | 37714 |
| 274 | Ga0207656_10007034 | 3300025321 | Bacteria | 4083 |
| 275 | Ga0207656_10011601 | 3300025321 | Bacteria | 3334 |
| 276 | Ga0207682_10000858 | 3300025893 | Bacteria | 14097 |
| 277 | Ga0207682_10008312 | 3300025893 | Bacteria | 4106 |
| 278 | Ga0207682_10009031 | 3300025893 | Bacteria | 3939 |
| 279 | Ga0207642_10006674 | 3300025899 | Bacteria | 3852 |
| 280 | Ga0207688_10002342 | 3300025901 | Bacteria | 10177 |
| 281 | Ga0207680_10002593 | 3300025903 | Bacteria | 8431 |
| 282 | Ga0207680_10027865 | 3300025903 | Bacteria | 3153 |
| 283 | Ga0207645_10001112 | 3300025907 | Bacteria | 22233 |
| 284 | Ga0207645_10002453 | 3300025907 | Bacteria | 14596 |
| 285 | Ga0207645_10015746 | 3300025907 | Bacteria | 5014 |
| 286 | Ga0207645_10032720 | 3300025907 | Bacteria | 3343 |
| 287 | Ga0207643_10005318 | 3300025908 | Bacteria | 6887 |
| 288 | Ga0207643_10009326 | 3300025908 | Bacteria | 5274 |
| 289 | Ga0207643_10014470 | 3300025908 | Bacteria | 4287 |
| 290 | Ga0207643_10049520 | 3300025908 | Bacteria | 2381 |
| 291 | Ga0207684_10082656 | 3300025910 | Bacteria | 2735 |
| 292 | Ga0207707_10046708 | 3300025912 | Bacteria | 3772 |
| 293 | Ga0207695_10079514 | 3300025913 | Bacteria | 3323 |
| 294 | Ga0207663_10014918 | 3300025916 | Bacteria | 4271 |
| 295 | Ga0207660_10010375 | 3300025917 | Bacteria | 6044 |
| 296 | Ga0207660_10019006 | 3300025917 | Bacteria | 4590 |
| 297 | Ga0207662_10009113 | 3300025918 | Bacteria | 5454 |
| 298 | Ga0207657_10000193 | 3300025919 | Bacteria | 63264 |
| 299 | Ga0207657_10001407 | 3300025919 | Bacteria | 25663 |
| 300 | Ga0207657_10024634 | 3300025919 | Bacteria | 5566 |
| 301 | Ga0207649_10024324 | 3300025920 | Bacteria | 3519 |
| 302 | Ga0207649_10033316 | 3300025920 | Bacteria | 3077 |
| 303 | Ga0207681_10006104 | 3300025923 | Bacteria | 7389 |
| 304 | Ga0207650_10002803 | 3300025925 | Bacteria | 12028 |
| 305 | Ga0207650_10058573 | 3300025925 | Bacteria | 2868 |
| 306 | Ga0207659_10001621 | 3300025926 | Bacteria | 13334 |
| 307 | Ga0207659_10002324 | 3300025926 | Bacteria | 11326 |
| 308 | Ga0207659_10004740 | 3300025926 | Bacteria | 8247 |
| 309 | Ga0207659_10031686 | 3300025926 | Bacteria | 3623 |
| 310 | Ga0207687_10009320 | 3300025927 | Bacteria | 6421 |
| 311 | Ga0207687_10087385 | 3300025927 | Bacteria | 2265 |
| 312 | Ga0207700_10000429 | 3300025928 | Bacteria | 24686 |
| 313 | Ga0207664_10001005 | 3300025929 | Bacteria | 18899 |
| 314 | Ga0207644_10003348 | 3300025931 | Bacteria | 10340 |
| 315 | Ga0207644_10004529 | 3300025931 | Bacteria | 9028 |
| 316 | Ga0207644_10012407 | 3300025931 | Bacteria | 5659 |
| 317 | Ga0207690_10003798 | 3300025932 | Bacteria | 8940 |
| 318 | Ga0207706_10000133 | 3300025933 | Bacteria | 80935 |
| 319 | Ga0207706_10002930 | 3300025933 | Bacteria | 16489 |
| 320 | Ga0207706_10015833 | 3300025933 | Bacteria | 6819 |
| 321 | Ga0207706_10019927 | 3300025933 | Bacteria | 6028 |
| 322 | Ga0207686_10001096 | 3300025934 | Bacteria | 15845 |
| 323 | Ga0207686_10074494 | 3300025934 | Bacteria | 2194 |
| 324 | Ga0207670_10004746 | 3300025936 | Bacteria | 7370 |
| 325 | Ga0207670_10010751 | 3300025936 | Bacteria | 5284 |
| 326 | Ga0207670_10014088 | 3300025936 | Bacteria | 4735 |
| 327 | Ga0207669_10037626 | 3300025937 | Bacteria | 2778 |
| 328 | Ga0207704_10003876 | 3300025938 | Bacteria | 6799 |
| 329 | Ga0207704_10017552 | 3300025938 | Bacteria | 3714 |
| 330 | Ga0207665_10014310 | 3300025939 | Bacteria | 5224 |
| 331 | Ga0207691_10000379 | 3300025940 | Bacteria | 44711 |
| 332 | Ga0207691_10000560 | 3300025940 | Bacteria | 37165 |
| 333 | Ga0207691_10002611 | 3300025940 | Bacteria | 17592 |
| 334 | Ga0207691_10003982 | 3300025940 | Bacteria | 14348 |
| 335 | Ga0207691_10008726 | 3300025940 | Bacteria | 9724 |
| 336 | Ga0207691_10012018 | 3300025940 | Bacteria | 8304 |
| 337 | Ga0207691_10045792 | 3300025940 | Bacteria | 4021 |
| 338 | Ga0207711_10128161 | 3300025941 | Bacteria | 2272 |
| 339 | Ga0207689_10000354 | 3300025942 | Bacteria | 42996 |
| 340 | Ga0207689_10004023 | 3300025942 | Bacteria | 13366 |
| 341 | Ga0207689_10010086 | 3300025942 | Bacteria | 8142 |
| 342 | Ga0207689_10011981 | 3300025942 | Bacteria | 7433 |
| 343 | Ga0207689_10028334 | 3300025942 | Bacteria | 4685 |
| 344 | Ga0207689_10069006 | 3300025942 | Bacteria | 2905 |
| 345 | Ga0207661_10009925 | 3300025944 | Bacteria | 6837 |
| 346 | Ga0207661_10012689 | 3300025944 | Bacteria | 6134 |
| 347 | Ga0207679_10002124 | 3300025945 | Bacteria | 12288 |
| 348 | Ga0207679_10009654 | 3300025945 | Bacteria | 6186 |
| 349 | Ga0207679_10012210 | 3300025945 | Bacteria | 5595 |
| 350 | Ga0207667_10001411 | 3300025949 | Bacteria | 30087 |
| 351 | Ga0207667_10004399 | 3300025949 | Bacteria | 17263 |
| 352 | Ga0207667_10015930 | 3300025949 | Bacteria | 8513 |
| 353 | Ga0207667_10046061 | 3300025949 | Bacteria | 4617 |
| 354 | Ga0207667_10088662 | 3300025949 | Bacteria | 3199 |
| 355 | Ga0207651_10010732 | 3300025960 | Bacteria | 5090 |
| 356 | Ga0207651_10015080 | 3300025960 | Bacteria | 4480 |
| 357 | Ga0207651_10057921 | 3300025960 | Bacteria | 2675 |
| 358 | Ga0207651_10095514 | 3300025960 | Bacteria | 2189 |
| 359 | Ga0207712_10027415 | 3300025961 | Bacteria | 3804 |
| 360 | Ga0207668_10011613 | 3300025972 | Bacteria | 5357 |
| 361 | Ga0207668_10020947 | 3300025972 | Bacteria | 4163 |
| 362 | Ga0207668_10024395 | 3300025972 | Bacteria | 3902 |
| 363 | Ga0207668_10032458 | 3300025972 | Bacteria | 3450 |
| 364 | Ga0207668_10085674 | 3300025972 | Bacteria | 2300 |
| 365 | Ga0207640_10009097 | 3300025981 | Bacteria | 5547 |
| 366 | Ga0207640_10013089 | 3300025981 | Bacteria | 4745 |
| 367 | Ga0207658_10001175 | 3300025986 | Bacteria | 20875 |
| 368 | Ga0207658_10006148 | 3300025986 | Bacteria | 8196 |
| 369 | Ga0207658_10007614 | 3300025986 | Bacteria | 7376 |
| 370 | Ga0207658_10060887 | 3300025986 | Bacteria | 2819 |
| 371 | Ga0207658_10103885 | 3300025986 | Bacteria | 2231 |
| 372 | Ga0207677_10006771 | 3300026023 | Bacteria | 6296 |
| 373 | Ga0207677_10020735 | 3300026023 | Bacteria | 3998 |
| 374 | Ga0207677_10021813 | 3300026023 | Bacteria | 3923 |
| 375 | Ga0207677_10024802 | 3300026023 | Bacteria | 3732 |
| 376 | Ga0207703_10000804 | 3300026035 | Bacteria | 30944 |
| 377 | Ga0207703_10007993 | 3300026035 | Bacteria | 8357 |
| 378 | Ga0207639_10005169 | 3300026041 | Bacteria | 8804 |
| 379 | Ga0207639_10087966 | 3300026041 | Bacteria | 2478 |
| 380 | Ga0207678_10001121 | 3300026067 | Bacteria | 24571 |
| 381 | Ga0207708_10002496 | 3300026075 | Bacteria | 13538 |
| 382 | Ga0207708_10035340 | 3300026075 | Bacteria | 3802 |
| 383 | Ga0207708_10037070 | 3300026075 | Bacteria | 3714 |
| 384 | Ga0207702_10019447 | 3300026078 | Bacteria | 5618 |
| 385 | Ga0207641_10001267 | 3300026088 | Bacteria | 25148 |
| 386 | Ga0207641_10005488 | 3300026088 | Bacteria | 10819 |
| 387 | Ga0207641_10011486 | 3300026088 | Bacteria | 7270 |
| 388 | Ga0207641_10036242 | 3300026088 | Bacteria | 4117 |
| 389 | Ga0207648_10000715 | 3300026089 | Bacteria | 37217 |
| 390 | Ga0207648_10004748 | 3300026089 | Bacteria | 13886 |
| 391 | Ga0207648_10032259 | 3300026089 | Bacteria | 4625 |
| 392 | Ga0207648_10043921 | 3300026089 | Bacteria | 3922 |
| 393 | Ga0207648_10051635 | 3300026089 | Bacteria | 3594 |
| 394 | Ga0207676_10006273 | 3300026095 | Bacteria | 8396 |
| 395 | Ga0207676_10006901 | 3300026095 | Bacteria | 8047 |
| 396 | Ga0207676_10012267 | 3300026095 | Bacteria | 6133 |
| 397 | Ga0207676_10062421 | 3300026095 | Bacteria | 2955 |
| 398 | Ga0207674_10001508 | 3300026116 | Bacteria | 30031 |
| 399 | Ga0207674_10010085 | 3300026116 | Bacteria | 10741 |
| 400 | Ga0207674_10045963 | 3300026116 | Bacteria | 4487 |
| 401 | Ga0207674_10062571 | 3300026116 | Bacteria | 3759 |
| 402 | Ga0207675_100001230 | 3300026118 | Bacteria | 25559 |
| 403 | Ga0207675_100002626 | 3300026118 | Bacteria | 17775 |
| 404 | Ga0207675_100003866 | 3300026118 | Bacteria | 14554 |
| 405 | Ga0207675_100005405 | 3300026118 | Bacteria | 12238 |
| 406 | Ga0207675_100019191 | 3300026118 | Bacteria | 6380 |
| 407 | Ga0207675_100021444 | 3300026118 | Bacteria | 6017 |
| 408 | Ga0207675_100032655 | 3300026118 | Bacteria | 4848 |
| 409 | Ga0207675_100034845 | 3300026118 | Bacteria | 4695 |
| 410 | Ga0207675_100104940 | 3300026118 | Bacteria | 2663 |
| 411 | Ga0207683_10000219 | 3300026121 | Bacteria | 50089 |
| 412 | Ga0207683_10000835 | 3300026121 | Bacteria | 28207 |
| 413 | Ga0207683_10001087 | 3300026121 | Bacteria | 24715 |
| 414 | Ga0207683_10003105 | 3300026121 | Bacteria | 14515 |
| 415 | Ga0207683_10004720 | 3300026121 | Bacteria | 11743 |
| 416 | Ga0207683_10007647 | 3300026121 | Bacteria | 9254 |
| 417 | Ga0207683_10050403 | 3300026121 | Bacteria | 3646 |
| 418 | Ga0207683_10052835 | 3300026121 | Bacteria | 3561 |
| 419 | Ga0207698_10001048 | 3300026142 | Bacteria | 16094 |
| 420 | Ga0207698_10058164 | 3300026142 | Bacteria | 2995 |
| 421 | Ga0209179_1000057 | 3300027512 | Bacteria | 20795 |
| 422 | Ga0207428_10002009 | 3300027907 | Bacteria | 20590 |
| 423 | Ga0207428_10002833 | 3300027907 | Bacteria | 17208 |
| 424 | Ga0207428_10028440 | 3300027907 | Bacteria | 4645 |
| 425 | Ga0268266_10020216 | 3300028379 | Bacteria | 5676 |
| 426 | Ga0268266_10026161 | 3300028379 | Bacteria | 4965 |
| 427 | Ga0268266_10034107 | 3300028379 | Bacteria | 4327 |
| 428 | Ga0268266_10153431 | 3300028379 | Bacteria | 2078 |
| 429 | Ga0268265_10002172 | 3300028380 | Bacteria | 15171 |
| 430 | Ga0268265_10004875 | 3300028380 | Bacteria | 9248 |
| 431 | Ga0268264_10006919 | 3300028381 | Bacteria | 9517 |
| 432 | Ga0268264_10012957 | 3300028381 | Bacteria | 6856 |
| 433 | Ga0268264_10015059 | 3300028381 | Bacteria | 6344 |
| 434 | Ga0265334_10001186 | 3300028573 | Bacteria | 12763 |
| 435 | Ga0307515_10000090 | 3300028794 | Bacteria | 215043 |
| 436 | Ga0307515_10000889 | 3300028794 | Bacteria | 68865 |
| 437 | Ga0307515_10126165 | 3300028794 | Bacteria | 2857 |
| 438 | Ga0265330_10001258 | 3300031235 | Bacteria | 14845 |
| 439 | Ga0265332_10001479 | 3300031238 | Bacteria | 13111 |
| 440 | Ga0265329_10001661 | 3300031242 | Bacteria | 10655 |
| 441 | Ga0265327_10024591 | 3300031251 | Bacteria | 3532 |
| 442 | Ga0307513_10013861 | 3300031456 | Bacteria | 9881 |
| 443 | Ga0307513_10050276 | 3300031456 | Bacteria | 4508 |
| 444 | Ga0307509_10000072 | 3300031507 | Bacteria | 140566 |
| 445 | Ga0307509_10005364 | 3300031507 | Bacteria | 17877 |
| 446 | Ga0307408_100007011 | 3300031548 | Bacteria | 7451 |
| 447 | Ga0307408_100010172 | 3300031548 | Bacteria | 6206 |
| 448 | Ga0307508_10000007 | 3300031616 | Bacteria | 268359 |
| 449 | Ga0316579_10011653 | 3300031691 | Bacteria | 3742 |
| 450 | Ga0316576_10000968 | 3300031727 | Bacteria | 14735 |
| 451 | Ga0316576_10011841 | 3300031727 | Bacteria | 5736 |
| 452 | Ga0316576_10026869 | 3300031727 | Bacteria | 4042 |
| 453 | Ga0316576_10076363 | 3300031727 | Bacteria | 2479 |
| 454 | Ga0316578_10000827 | 3300031728 | Bacteria | 11549 |
| 455 | Ga0316578_10024937 | 3300031728 | Bacteria | 3358 |
| 456 | Ga0307516_10000398 | 3300031730 | Bacteria | 56825 |
| 457 | Ga0307405_10004332 | 3300031731 | Bacteria | 6689 |
| 458 | Ga0307405_10019417 | 3300031731 | Bacteria | 3774 |
| 459 | Ga0316577_10002878 | 3300031733 | Bacteria | 8602 |
| 460 | Ga0307413_10000277 | 3300031824 | Bacteria | 15683 |
| 461 | Ga0307413_10000910 | 3300031824 | Bacteria | 10480 |
| 462 | Ga0307413_10014540 | 3300031824 | Bacteria | 4002 |
| 463 | Ga0307410_10003717 | 3300031852 | Bacteria | 7725 |
| 464 | Ga0307410_10005461 | 3300031852 | Bacteria | 6734 |
| 465 | Ga0307406_10001701 | 3300031901 | Bacteria | 12094 |
| 466 | Ga0307406_10003217 | 3300031901 | Bacteria | 8889 |
| 467 | Ga0307407_10002689 | 3300031903 | Bacteria | 7047 |
| 468 | Ga0307412_10035572 | 3300031911 | Bacteria | 3183 |
| 469 | Ga0307409_100000588 | 3300031995 | Bacteria | 15873 |
| 470 | Ga0307409_100004952 | 3300031995 | Bacteria | 7583 |
| 471 | Ga0307409_100025708 | 3300031995 | Bacteria | 4136 |
| 472 | Ga0307416_100022817 | 3300032002 | Bacteria | 4527 |
| 473 | Ga0307416_100029829 | 3300032002 | Bacteria | 4082 |
| 474 | Ga0307414_10028146 | 3300032004 | Bacteria | 3641 |
| 475 | Ga0307411_10004650 | 3300032005 | Bacteria | 6613 |
| 476 | Ga0307415_100003057 | 3300032126 | Bacteria | 8442 |
| 477 | Ga0307415_100017578 | 3300032126 | Bacteria | 4292 |
| 478 | Ga0316580_10003674 | 3300032139 | Bacteria | 4388 |
| 479 | Ga0316593_10001714 | 3300032168 | Bacteria | 4953 |
| 480 | Ga0316593_10002926 | 3300032168 | Bacteria | 4149 |
| 481 | Ga0316593_10018752 | 3300032168 | Bacteria | 2131 |
| 482 | Ga0316592_1000745 | 3300033524 | Bacteria | 4824 |
| 483 | Ga0316592_1001282 | 3300033524 | Bacteria | 3991 |
| 484 | Ga0316586_1000273 | 3300033527 | Bacteria | 4597 |
| 485 | Ga0316587_1002822 | 3300033529 | Bacteria | 2369 |
| 486 | Ga0316596_1002002 | 3300033541 | Bacteria | 4279 |
| 487 | Ga0316596_1002895 | 3300033541 | Bacteria | 3715 |
| 488 | Ga0373923_0001864 | 3300035111 | Bacteria | 6270 |
| 489 | Ga0316574_0010119 | 3300035398 | Bacteria | 5312 |
| 490 | Ga0316574_0010424 | 3300035398 | Bacteria | 5253 |
| 491 | Ga0316574_0020330 | 3300035398 | Bacteria | 3929 |
| 492 | Ga0316574_0053359 | 3300035398 | Bacteria | 2523 |
| 493 | Ga0373927_0026377 | 3300035695 | Bacteria | 3797 |
| 494 | Ga0316582_0026694 | 3300036647 | Bacteria | 3479 |
| 495 | Ga0316584_0000396 | 3300036712 | Bacteria | 22652 |
| 496 | Ga0316584_0021320 | 3300036712 | Bacteria | 4708 |
| 497 | Ga0316584_0026814 | 3300036712 | Bacteria | 4237 |
| 498 | Ga0373925_0049975 | 3300037068 | Bacteria | 3118 |
| 499 | Ga0395899_0098529 | 3300037312 | Bacteria | 2112 |
| 500 | Ga0395900_0012104 | 3300037418 | Bacteria | 8815 |
| 501 | Ga0395900_0084789 | 3300037418 | Bacteria | 3256 |
| 502 | Ga0436364_1334883 | 3300037853 | Bacteria | 4161 |
| 503 | Ga0395901_0033643 | 3300038443 | Bacteria | 5293 |
| 504 | Ga0400484_41940 | 3300038725 | Bacteria | 27044 |
| 505 | Ga0400490_00726 | 3300038726 | Bacteria | 6234 |
| 506 | Ga0400490_60503 | 3300038726 | Bacteria | 6717 |
| 507 | Ga0400491_25235 | 3300038727 | Bacteria | 5901 |
| 508 | Ga0400485_02514 | 3300038735 | Bacteria | 5283 |
| 509 | Ga0400488_47521 | 3300038741 | Bacteria | 5089 |
| 510 | Ga0400486_23219 | 3300038742 | Bacteria | 5768 |
| 511 | Ga0400486_27054 | 3300038742 | Bacteria | 4176 |
| 512 | Ga0400483_010229 | 3300039062 | Bacteria | 3460 |
| 513 | Ga0400483_062114 | 3300039062 | Bacteria | 16677 |
| 514 | Ga0400483_097543 | 3300039062 | Bacteria | 4607 |
| 515 | Ga0400483_241992 | 3300039062 | Bacteria | 4984 |
| 516 | Ga0400483_267281 | 3300039062 | Bacteria | 3196 |
| 517 | Ga0400489_50293 | 3300039093 | Bacteria | 5458 |
| 518 | Ga0400487_35747 | 3300039110 | Bacteria | 7300 |
| 519 | Ga0439443_000740 | 3300042003 | Bacteria | 3191 |
| 520 | Ga0439435_0000630 | 3300042436 | Bacteria | 5770 |
| 521 | Ga0453683_0001668 | 3300044673 | Bacteria | 18578 |
| 522 | Ga0453684_0000114 | 3300044712 | Bacteria | 356610 |
| 523 | Ga0453684_0000316 | 3300044712 | Bacteria | 204457 |
| 524 | Ga0453684_0004641 | 3300044712 | Bacteria | 28551 |
| 525 | Ga0453684_0007378 | 3300044712 | Bacteria | 20264 |
| 526 | Ga0453684_0064017 | 3300044712 | Bacteria | 4699 |
| 527 | Ga0451576_0000128 | 3300045051 | Bacteria | 192071 |
| 528 | Ga0451576_0001681 | 3300045051 | Bacteria | 36675 |
| 529 | Ga0451576_0011629 | 3300045051 | Bacteria | 9971 |
| 530 | Ga0451576_0011665 | 3300045051 | Bacteria | 9956 |
| 531 | Ga0451576_0019403 | 3300045051 | Bacteria | 7422 |
| 532 | Ga0451576_0024433 | 3300045051 | Bacteria | 6527 |
| 533 | Ga0451576_0128366 | 3300045051 | Bacteria | 2642 |
| 534 | Ga0495632_0002939 | 3300046519 | Bacteria | 12506 |
| 535 | Ga0495654_0002047 | 3300046530 | Bacteria | 13234 |
| 536 | Ga0495621_0000820 | 3300046539 | Bacteria | 7869 |
| 537 | Ga0495669_0002648 | 3300046684 | Bacteria | 7329 |
| 538 | Ga0495686_0004579 | 3300047472 | Bacteria | 11287 |
| 539 | Ga0496101_0070880 | 3300048904 | Bacteria | 2553 |
| 540 | Ga0496102_0167515 | 3300048905 | Bacteria | 2068 |
| 541 | Ga0496105_0005362 | 3300048908 | Bacteria | 9720 |
| 542 | Ga0496106_0001570 | 3300048909 | Bacteria | 17186 |
| 543 | Ga0496106_0052453 | 3300048909 | Bacteria | 3077 |
| 544 | Ga0496107_0081130 | 3300048910 | Bacteria | 2366 |
| 545 | Ga0496108_0044597 | 3300048911 | Bacteria | 3701 |
| 546 | Ga0496109_0000601 | 3300048912 | Bacteria | 30117 |
| 547 | Ga0496110_0034147 | 3300048913 | Bacteria | 4404 |
| 548 | Ga0496114_0095154 | 3300048917 | Bacteria | 2534 |
| 549 | Ga0496126_0037486 | 3300048929 | Bacteria | 4523 |
| 550 | Ga0501033_0014643 | 3300049570 | Bacteria | 5954 |
| 551 | Ga0501033_0018722 | 3300049570 | Bacteria | 5234 |
| 552 | Ga0501036_0001716 | 3300049572 | Bacteria | 17030 |
| 553 | Ga0501038_0006982 | 3300049574 | Bacteria | 10428 |
| 554 | Ga0501038_0073747 | 3300049574 | Bacteria | 2889 |
| 555 | Ga0501039_0003439 | 3300049575 | Bacteria | 11823 |
| 556 | Ga0501039_0014801 | 3300049575 | Bacteria | 5967 |
| 557 | Ga0501039_0030938 | 3300049575 | Bacteria | 4127 |
| 558 | Ga0501040_0001049 | 3300049576 | Bacteria | 17492 |
| 559 | Ga0501040_0053539 | 3300049576 | Bacteria | 2764 |
| 560 | Ga0501041_0001962 | 3300049577 | Bacteria | 11561 |
| 561 | Ga0501041_0017807 | 3300049577 | Bacteria | 4227 |
| 562 | Ga0501042_0007861 | 3300049578 | Bacteria | 7012 |
| 563 | Ga0501046_0006823 | 3300049580 | Bacteria | 10072 |
| 564 | Ga0501046_0056197 | 3300049580 | Bacteria | 3090 |
| 565 | Ga0501048_0002611 | 3300049582 | Bacteria | 13796 |
| 566 | Ga0501048_0046369 | 3300049582 | Bacteria | 3103 |
| 567 | Ga0501070_0012854 | 3300049586 | Bacteria | 7054 |
| 568 | Ga0501070_0020472 | 3300049586 | Bacteria | 5548 |
| 569 | Ga0501071_0003792 | 3300049587 | Bacteria | 9499 |
| 570 | Ga0501071_0026106 | 3300049587 | Bacteria | 4098 |
| 571 | Ga0501072_0002996 | 3300049588 | Bacteria | 12733 |
| 572 | Ga0501072_0015981 | 3300049588 | Bacteria | 5755 |
| 573 | Ga0501072_0037294 | 3300049588 | Bacteria | 3812 |
| 574 | Ga0501073_0002745 | 3300049589 | Bacteria | 13190 |
| 575 | Ga0501074_0003284 | 3300049590 | Bacteria | 11437 |
| 576 | Ga0501075_0001026 | 3300049591 | Bacteria | 17906 |
| 577 | Ga0501075_0002537 | 3300049591 | Bacteria | 12169 |
| 578 | Ga0501075_0031098 | 3300049591 | Bacteria | 3960 |
| 579 | Ga0501075_0033905 | 3300049591 | Bacteria | 3799 |
| 580 | Ga0501075_0121677 | 3300049591 | Bacteria | 1986 |
| 581 | Ga0501076_0000185 | 3300049592 | Bacteria | 37179 |
| 582 | Ga0501076_0000823 | 3300049592 | Bacteria | 20155 |
| 583 | Ga0501076_0002196 | 3300049592 | Bacteria | 13366 |
| 584 | Ga0501077_0002232 | 3300049593 | Bacteria | 11685 |
| 585 | Ga0501077_0108165 | 3300049593 | Bacteria | 1761 |
| 586 | Ga0501079_0000163 | 3300049741 | Bacteria | 36976 |
| 587 | Ga0501079_0002265 | 3300049741 | Bacteria | 13891 |
| 588 | Ga0501079_0002741 | 3300049741 | Bacteria | 12841 |
| 589 | Ga0501079_0185183 | 3300049741 | Bacteria | 1625 |
| 590 | Ga0501080_0035819 | 3300049742 | Bacteria | 4632 |
| 591 | Ga0501080_0054341 | 3300049742 | Bacteria | 3729 |
| 592 | Ga0501080_0061130 | 3300049742 | Bacteria | 3507 |
| 593 | Ga0501081_0001515 | 3300049743 | Bacteria | 14277 |
| 594 | Ga0501081_0001676 | 3300049743 | Bacteria | 13709 |
| 595 | Ga0501081_0015342 | 3300049743 | Bacteria | 5054 |
| 596 | Ga0501035_0023915 | 3300049822 | Bacteria | 5606 |
| 597 | Ga0501045_0002002 | 3300049824 | Bacteria | 13762 |
| 598 | Ga0501045_0002996 | 3300049824 | Bacteria | 11559 |
| 599 | nmdc:mga0k408_8866_c1 | 3300050493 | Bacteria | 5410 |
| 600 | nmdc:mga05p37_16088_c1 | 3300050507 | Bacteria | 9005 |
| 601 | nmdc:mga05p37_889_c1 | 3300050507 | Bacteria | 33704 |
| 602 | nmdc:mga09592_128990_c1 | 3300050508 | Bacteria | 2175 |
| 603 | nmdc:mga09592_16436_c1 | 3300050508 | Bacteria | 6053 |
| 604 | nmdc:mga09592_360_c1 | 3300050508 | Bacteria | 33201 |
| 605 | nmdc:mga0qj67_11168_c1 | 3300050509 | Bacteria | 6725 |
| 606 | nmdc:mga06r32_1015_c1 | 3300050510 | Bacteria | 25208 |
| 607 | nmdc:mga06r32_29_c1 | 3300050510 | Bacteria | 85620 |
| 608 | nmdc:mga06r32_9332_c1 | 3300050510 | Bacteria | 8847 |
| 609 | nmdc:mga08y16_1764_c1 | 3300050511 | Bacteria | 21920 |
| 610 | nmdc:mga08y16_6277_c1 | 3300050511 | Bacteria | 12462 |
| 611 | nmdc:mga0n895_2992_c1 | 3300050512 | Bacteria | 13414 |
| 612 | nmdc:mga0rr50_16025_c1 | 3300050513 | Bacteria | 4965 |
| 613 | Ga0500578_0000213 | 3300053086 | Bacteria | 71211 |
| 614 | Ga0500651_0032774 | 3300053093 | Bacteria | 3275 |
| 615 | Ga0500642_0016576 | 3300053130 | Bacteria | 2803 |
| 616 | Ga0500652_000839 | 3300053131 | Bacteria | 10178 |
| 617 | Ga0500655_000856 | 3300053133 | Bacteria | 5909 |
| 618 | Ga0500588_0000119 | 3300053146 | Bacteria | 10440 |
| 619 | Ga0500619_000325 | 3300053154 | Bacteria | 9276 |
| 620 | Ga0500622_0003145 | 3300053156 | Bacteria | 11307 |
| 621 | Ga0500637_0000737 | 3300053178 | Bacteria | 13089 |
| 622 | Ga0501084_0030606 | 3300054114 | Bacteria | 4500 |
| 623 | Ga0501084_0047376 | 3300054114 | Bacteria | 3600 |
| 624 | Ga0501082_0001772 | 3300060353 | Bacteria | 18993 |
| 625 | Ga0501082_0003981 | 3300060353 | Bacteria | 12898 |
| 626 | Ga0501082_0005109 | 3300060353 | Bacteria | 11430 |
| 627 | Ga0501082_0023235 | 3300060353 | Bacteria | 5349 |
| 628 | Ga0530510_0001291 | 3300061734 | Bacteria | 16737 |
| 629 | Ga0530510_0003511 | 3300061734 | Bacteria | 10780 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049741 | Ga0501079_0185183 | Ga0501079_0185183_45_1613 | 509 |
| 2 | 3300039062 | Ga0400483_010229 | Ga0400483_010229_1771_3378 | 525 |
| 3 | 3300039062 | Ga0400483_097543 | Ga0400483_097543_76_1683 | 525 |
| 4 | 3300049593 | Ga0501077_0108165 | Ga0501077_0108165_29_1636 | 532 |
| 5 | iso_pu_bacteria | 2687453129 | 2687577391 | 576 |
| 6 | 3300025926 | Ga0207659_10031686 | Ga0207659_100316863 | 578 |
| 7 | 3300025972 | Ga0207668_10020947 | Ga0207668_100209472 | 578 |
| 8 | 3300005331 | Ga0070670_100025573 | Ga0070670_1000255734 | 579 |
| 9 | 3300005347 | Ga0070668_100001724 | Ga0070668_1000017244 | 579 |
| 10 | 3300005353 | Ga0070669_100011126 | Ga0070669_1000111263 | 579 |
| 11 | 3300005364 | Ga0070673_100104679 | Ga0070673_1001046791 | 579 |
| 12 | 3300005367 | Ga0070667_100034829 | Ga0070667_1000348293 | 579 |
| 13 | 3300005459 | Ga0068867_100007906 | Ga0068867_1000079063 | 579 |
| 14 | 3300005618 | Ga0068864_100002543 | Ga0068864_1000025433 | 579 |
| 15 | 3300005719 | Ga0068861_100069869 | Ga0068861_1000698692 | 579 |
| 16 | 3300005842 | Ga0068858_100026879 | Ga0068858_1000268795 | 579 |
| 17 | 3300005844 | Ga0068862_100004088 | Ga0068862_1000040886 | 579 |
| 18 | 3300009177 | Ga0105248_10048405 | Ga0105248_100484053 | 579 |
| 19 | 3300014325 | Ga0163163_10039604 | Ga0163163_100396042 | 579 |
| 20 | 3300014968 | Ga0157379_10017483 | Ga0157379_100174832 | 579 |
| 21 | 3300025908 | Ga0207643_10014470 | Ga0207643_100144703 | 579 |
| 22 | 3300025942 | Ga0207689_10000354 | Ga0207689_1000035414 | 579 |
| 23 | 3300025986 | Ga0207658_10103885 | Ga0207658_101038852 | 579 |
| 24 | 3300026023 | Ga0207677_10021813 | Ga0207677_100218133 | 579 |
| 25 | 3300026035 | Ga0207703_10000804 | Ga0207703_100008043 | 579 |
| 26 | 3300026089 | Ga0207648_10004748 | Ga0207648_100047485 | 579 |
| 27 | 3300026095 | Ga0207676_10062421 | Ga0207676_100624212 | 579 |
| 28 | 3300026118 | Ga0207675_100003866 | Ga0207675_1000038661 | 579 |
| 29 | 3300028380 | Ga0268265_10004875 | Ga0268265_100048756 | 579 |
| 30 | 3300005329 | Ga0070683_100017092 | Ga0070683_1000170923 | 580 |
| 31 | 3300005337 | Ga0070682_100048817 | Ga0070682_1000488172 | 580 |
| 32 | 3300005344 | Ga0070661_100001819 | Ga0070661_10000181912 | 580 |
| 33 | 3300005435 | Ga0070714_100047637 | Ga0070714_1000476373 | 580 |
| 34 | 3300005564 | Ga0070664_100000855 | Ga0070664_10000085521 | 580 |
| 35 | 3300005578 | Ga0068854_100014053 | Ga0068854_1000140533 | 580 |
| 36 | 3300005614 | Ga0068856_100003705 | Ga0068856_10000370513 | 580 |
| 37 | 3300009174 | Ga0105241_10004734 | Ga0105241_100047344 | 580 |
| 38 | 3300009551 | Ga0105238_10016470 | Ga0105238_100164703 | 580 |
| 39 | 3300010375 | Ga0105239_10008175 | Ga0105239_100081757 | 580 |
| 40 | 3300013100 | Ga0157373_10006811 | Ga0157373_100068113 | 580 |
| 41 | 3300013102 | Ga0157371_10031715 | Ga0157371_100317153 | 580 |
| 42 | 3300013104 | Ga0157370_10003286 | Ga0157370_1000328610 | 580 |
| 43 | 3300013105 | Ga0157369_10136427 | Ga0157369_101364272 | 580 |
| 44 | 3300025913 | Ga0207695_10079514 | Ga0207695_100795142 | 580 |
| 45 | 3300025919 | Ga0207657_10000193 | Ga0207657_1000019328 | 580 |
| 46 | 3300025920 | Ga0207649_10033316 | Ga0207649_100333162 | 580 |
| 47 | 3300025944 | Ga0207661_10012689 | Ga0207661_100126894 | 580 |
| 48 | 3300025945 | Ga0207679_10012210 | Ga0207679_100122102 | 580 |
| 49 | 3300025949 | Ga0207667_10004399 | Ga0207667_100043995 | 580 |
| 50 | 3300025949 | Ga0207667_10088662 | Ga0207667_100886622 | 580 |
| 51 | 3300025981 | Ga0207640_10013089 | Ga0207640_100130893 | 580 |
| 52 | 3300026116 | Ga0207674_10001508 | Ga0207674_100015087 | 580 |
| 53 | 3300048929 | Ga0496126_0037486 | Ga0496126_0037486_1207_3066 | 580 |
| 54 | 3300005354 | Ga0070675_100026322 | Ga0070675_1000263224 | 581 |
| 55 | 3300005367 | Ga0070667_100133459 | Ga0070667_1001334591 | 581 |
| 56 | 3300005457 | Ga0070662_100044204 | Ga0070662_1000442043 | 581 |
| 57 | 3300005543 | Ga0070672_100054868 | Ga0070672_1000548683 | 581 |
| 58 | 3300025940 | Ga0207691_10002611 | Ga0207691_100026114 | 581 |
| 59 | 3300028573 | Ga0265334_10001186 | Ga0265334_100011868 | 581 |
| 60 | 3300037312 | Ga0395899_0098529 | Ga0395899_0098529_153_2042 | 582 |
| 61 | 3300037418 | Ga0395900_0084789 | Ga0395900_0084789_1099_2988 | 582 |
| 62 | 3300038443 | Ga0395901_0033643 | Ga0395901_0033643_1507_3396 | 582 |
| 63 | 3300005339 | Ga0070660_100083946 | Ga0070660_1000839462 | 587 |
| 64 | 3300005458 | Ga0070681_10002261 | Ga0070681_100022616 | 587 |
| 65 | 3300005563 | Ga0068855_100111679 | Ga0068855_1001116792 | 587 |
| 66 | 3300005844 | Ga0068862_100014504 | Ga0068862_1000145042 | 587 |
| 67 | 3300013100 | Ga0157373_10053654 | Ga0157373_100536542 | 587 |
| 68 | 3300013105 | Ga0157369_10004230 | Ga0157369_1000423014 | 587 |
| 69 | 3300025912 | Ga0207707_10046708 | Ga0207707_100467082 | 587 |
| 70 | 3300025917 | Ga0207660_10010375 | Ga0207660_100103753 | 587 |
| 71 | 3300046684 | Ga0495669_0002648 | Ga0495669_0002648_2278_4164 | 587 |
| 72 | 3300005563 | Ga0068855_100064429 | Ga0068855_1000644294 | 590 |
| 73 | 3300013104 | Ga0157370_10002271 | Ga0157370_1000227115 | 590 |
| 74 | 3300025949 | Ga0207667_10015930 | Ga0207667_100159302 | 590 |
| 75 | 3300035398 | Ga0316574_0053359 | Ga0316574_0053359_516_2306 | 590 |
| 76 | 3300049588 | Ga0501072_0015981 | Ga0501072_0015981_1124_2905 | 590 |
| 77 | 3300005355 | Ga0070671_100049905 | Ga0070671_1000499051 | 591 |
| 78 | 3300005356 | Ga0070674_100001635 | Ga0070674_1000016351 | 591 |
| 79 | 3300013308 | Ga0157375_10004266 | Ga0157375_100042668 | 591 |
| 80 | 3300025937 | Ga0207669_10037626 | Ga0207669_100376261 | 591 |
| 81 | 3300025940 | Ga0207691_10012018 | Ga0207691_100120184 | 591 |
| 82 | 3300035398 | Ga0316574_0020330 | Ga0316574_0020330_1035_2978 | 591 |
| 83 | 3300006844 | Ga0075428_100001689 | Ga0075428_10000168918 | 592 |
| 84 | 3300006880 | Ga0075429_100043811 | Ga0075429_1000438113 | 592 |
| 85 | 3300009094 | Ga0111539_10000486 | Ga0111539_1000048618 | 592 |
| 86 | 3300027907 | Ga0207428_10002833 | Ga0207428_1000283314 | 592 |
| 87 | 3300050508 | nmdc:mga09592_16436_c1 | nmdc:mga09592_16436_c1_995_2905 | 592 |
| 88 | 3300050511 | nmdc:mga08y16_6277_c1 | nmdc:mga08y16_6277_c1_1392_3302 | 592 |
| 89 | 3300035398 | Ga0316574_0010424 | Ga0316574_0010424_1580_3430 | 596 |
| 90 | 3300006846 | Ga0075430_100090366 | Ga0075430_1000903662 | 597 |
| 91 | 3300042003 | Ga0439443_000740 | Ga0439443_000740_451_2331 | 598 |
| 92 | 3300042436 | Ga0439435_0000630 | Ga0439435_0000630_2728_4608 | 598 |
| 93 | 3300049574 | Ga0501038_0073747 | Ga0501038_0073747_285_2165 | 598 |
| 94 | 3300049575 | Ga0501039_0014801 | Ga0501039_0014801_65_1945 | 598 |
| 95 | 3300049576 | Ga0501040_0053539 | Ga0501040_0053539_592_2472 | 598 |
| 96 | 3300049580 | Ga0501046_0056197 | Ga0501046_0056197_655_2535 | 598 |
| 97 | 3300049582 | Ga0501048_0046369 | Ga0501048_0046369_860_2740 | 598 |
| 98 | 3300049587 | Ga0501071_0026106 | Ga0501071_0026106_616_2496 | 598 |
| 99 | 3300049591 | Ga0501075_0031098 | Ga0501075_0031098_1098_2978 | 598 |
| 100 | 3300049592 | Ga0501076_0000185 | Ga0501076_0000185_32254_34134 | 598 |
| 101 | 3300049743 | Ga0501081_0015342 | Ga0501081_0015342_671_2551 | 598 |
| 102 | 3300060353 | Ga0501082_0003981 | Ga0501082_0003981_1837_3717 | 598 |
| 103 | 3300061734 | Ga0530510_0001291 | Ga0530510_0001291_14701_16581 | 598 |
| 104 | 3300006871 | Ga0075434_100000391 | Ga0075434_10000039125 | 600 |
| 105 | 3300006914 | Ga0075436_100010289 | Ga0075436_1000102895 | 600 |
| 106 | 3300037853 | Ga0436364_1334883 | Ga0436364_1334883_1062_2969 | 600 |
| 107 | 3300050512 | nmdc:mga0n895_2992_c1 | nmdc:mga0n895_2992_c1_8248_10146 | 600 |
| 108 | 3300007076 | Ga0075435_100006842 | Ga0075435_1000068424 | 601 |
| 109 | 3300049570 | Ga0501033_0014643 | Ga0501033_0014643_1244_3136 | 601 |
| 110 | 3300049572 | Ga0501036_0001716 | Ga0501036_0001716_10957_12849 | 601 |
| 111 | 3300049574 | Ga0501038_0006982 | Ga0501038_0006982_5695_7587 | 601 |
| 112 | 3300049575 | Ga0501039_0003439 | Ga0501039_0003439_9830_11722 | 601 |
| 113 | 3300049576 | Ga0501040_0001049 | Ga0501040_0001049_11890_13782 | 601 |
| 114 | 3300049577 | Ga0501041_0001962 | Ga0501041_0001962_2712_4604 | 601 |
| 115 | 3300049580 | Ga0501046_0006823 | Ga0501046_0006823_5878_7770 | 601 |
| 116 | 3300049582 | Ga0501048_0002611 | Ga0501048_0002611_9443_11335 | 601 |
| 117 | 3300049587 | Ga0501071_0003792 | Ga0501071_0003792_1377_3266 | 601 |
| 118 | 3300049588 | Ga0501072_0002996 | Ga0501072_0002996_7132_9024 | 601 |
| 119 | 3300049591 | Ga0501075_0002537 | Ga0501075_0002537_6907_8799 | 601 |
| 120 | 3300049591 | Ga0501075_0033905 | Ga0501075_0033905_448_2337 | 601 |
| 121 | 3300049592 | Ga0501076_0002196 | Ga0501076_0002196_7034_8926 | 601 |
| 122 | 3300049593 | Ga0501077_0002232 | Ga0501077_0002232_7332_9224 | 601 |
| 123 | 3300049741 | Ga0501079_0002265 | Ga0501079_0002265_2757_4649 | 601 |
| 124 | 3300049743 | Ga0501081_0001515 | Ga0501081_0001515_7178_9070 | 601 |
| 125 | 3300049822 | Ga0501035_0023915 | Ga0501035_0023915_2693_4585 | 601 |
| 126 | 3300049824 | Ga0501045_0002002 | Ga0501045_0002002_4696_6588 | 601 |
| 127 | 3300050513 | nmdc:mga0rr50_16025_c1 | nmdc:mga0rr50_16025_c1_1788_3668 | 601 |
| 128 | 3300060353 | Ga0501082_0005109 | Ga0501082_0005109_7201_9093 | 601 |
| 129 | 3300031727 | Ga0316576_10011841 | Ga0316576_100118415 | 603 |
| 130 | 3300037418 | Ga0395900_0012104 | Ga0395900_0012104_1756_3645 | 604 |
| 131 | 3300005355 | Ga0070671_100005776 | Ga0070671_1000057764 | 606 |
| 132 | 3300013297 | Ga0157378_10009642 | Ga0157378_100096425 | 606 |
| 133 | 3300025931 | Ga0207644_10012407 | Ga0207644_100124072 | 606 |
| 134 | 3300005445 | Ga0070708_100000012 | Ga0070708_10000001218 | 607 |
| 135 | 3300035398 | Ga0316574_0010119 | Ga0316574_0010119_1063_2946 | 608 |
| 136 | 3300036712 | Ga0316584_0021320 | Ga0316584_0021320_1005_2888 | 608 |
| 137 | 3300049586 | Ga0501070_0020472 | Ga0501070_0020472_784_2670 | 608 |
| 138 | 3300049742 | Ga0501080_0035819 | Ga0501080_0035819_1451_3337 | 608 |
| 139 | iso_pu_bacteria | 2919506607 | 2919507570 | 608 |
| 140 | 3300005355 | Ga0070671_100012314 | Ga0070671_1000123143 | 609 |
| 141 | 3300005367 | Ga0070667_100007287 | Ga0070667_1000072877 | 609 |
| 142 | 3300005367 | Ga0070667_100014815 | Ga0070667_1000148152 | 609 |
| 143 | 3300005456 | Ga0070678_100005691 | Ga0070678_1000056915 | 609 |
| 144 | 3300005548 | Ga0070665_100005673 | Ga0070665_1000056732 | 609 |
| 145 | 3300005843 | Ga0068860_100006234 | Ga0068860_1000062342 | 609 |
| 146 | 3300006881 | Ga0068865_100022421 | Ga0068865_1000224212 | 609 |
| 147 | 3300009177 | Ga0105248_10048166 | Ga0105248_100481662 | 609 |
| 148 | 3300013297 | Ga0157378_10005800 | Ga0157378_100058009 | 609 |
| 149 | 3300013306 | Ga0163162_10020412 | Ga0163162_100204125 | 609 |
| 150 | 3300014325 | Ga0163163_10132838 | Ga0163163_101328382 | 609 |
| 151 | 3300014968 | Ga0157379_10009639 | Ga0157379_100096392 | 609 |
| 152 | 3300014969 | Ga0157376_10005676 | Ga0157376_100056765 | 609 |
| 153 | 3300025903 | Ga0207680_10027865 | Ga0207680_100278653 | 609 |
| 154 | 3300025986 | Ga0207658_10006148 | Ga0207658_100061483 | 609 |
| 155 | 3300026121 | Ga0207683_10003105 | Ga0207683_1000310511 | 609 |
| 156 | 3300028379 | Ga0268266_10153431 | Ga0268266_101534311 | 609 |
| 157 | 3300028381 | Ga0268264_10012957 | Ga0268264_100129574 | 609 |
| 158 | 3300032168 | Ga0316593_10001714 | Ga0316593_100017142 | 609 |
| 159 | 3300048908 | Ga0496105_0005362 | Ga0496105_0005362_2758_4695 | 609 |
| 160 | 3300049591 | Ga0501075_0121677 | Ga0501075_0121677_78_1958 | 609 |
| 161 | iso_pu_bacteria | 2916699645 | 2916700264 | 609 |
| 162 | iso_pu_bacteria | 2984568884 | 2984571860 | 609 |
| 163 | 3300025942 | Ga0207689_10069006 | Ga0207689_100690062 | 611 |
| 164 | 3300005548 | Ga0070665_100000769 | Ga0070665_10000076927 | 612 |
| 165 | 3300005719 | Ga0068861_100086813 | Ga0068861_1000868132 | 612 |
| 166 | 3300006881 | Ga0068865_100106120 | Ga0068865_1001061201 | 612 |
| 167 | 3300026118 | Ga0207675_100034845 | Ga0207675_1000348452 | 612 |
| 168 | 3300028379 | Ga0268266_10020216 | Ga0268266_100202165 | 612 |
| 169 | 3300038727 | Ga0400491_25235 | Ga0400491_25235_2625_4535 | 612 |
| 170 | 3300005842 | Ga0068858_100011298 | Ga0068858_1000112985 | 613 |
| 171 | 3300045051 | Ga0451576_0001681 | Ga0451576_0001681_30611_32473 | 613 |
| 172 | iso_pu_bacteria | 2617270889 | 2617912194 | 613 |
| 173 | iso_pu_bacteria | 2831426010 | 2831426065 | 613 |
| 174 | iso_pu_bacteria | 2848694841 | 2848695574 | 613 |
| 175 | iso_pu_bacteria | 2849660919 | 2849665753 | 613 |
| 176 | iso_pu_bacteria | 2886627955 | 2886628413 | 613 |
| 177 | iso_pu_bacteria | 2913844669 | 2913852429 | 613 |
| 178 | iso_pu_bacteria | 2913912277 | 2913914529 | 613 |
| 179 | iso_pu_bacteria | 2913939268 | 2913946883 | 613 |
| 180 | iso_pu_bacteria | 642555144 | 642604389 | 613 |
| 181 | 3300031507 | Ga0307509_10000072 | Ga0307509_1000007295 | 614 |
| 182 | 3300044712 | Ga0453684_0004641 | Ga0453684_0004641_25390_27261 | 614 |
| 183 | 3300045051 | Ga0451576_0011665 | Ga0451576_0011665_6908_8770 | 614 |
| 184 | 3300006195 | Ga0075366_10001852 | Ga0075366_100018524 | 615 |
| 185 | 3300050493 | nmdc:mga0k408_8866_c1 | nmdc:mga0k408_8866_c1_1435_3336 | 615 |
| 186 | 3300005328 | Ga0070676_10055009 | Ga0070676_100550091 | 616 |
| 187 | 3300005347 | Ga0070668_100099464 | Ga0070668_1000994642 | 616 |
| 188 | 3300005436 | Ga0070713_100000049 | Ga0070713_1000000497 | 616 |
| 189 | 3300005456 | Ga0070678_100023815 | Ga0070678_1000238152 | 616 |
| 190 | 3300017792 | Ga0163161_10004806 | Ga0163161_100048062 | 616 |
| 191 | 3300025928 | Ga0207700_10000429 | Ga0207700_100004295 | 616 |
| 192 | 3300025934 | Ga0207686_10074494 | Ga0207686_100744941 | 616 |
| 193 | 3300025972 | Ga0207668_10032458 | Ga0207668_100324582 | 616 |
| 194 | 3300025972 | Ga0207668_10085674 | Ga0207668_100856741 | 616 |
| 195 | 3300026089 | Ga0207648_10051635 | Ga0207648_100516352 | 616 |
| 196 | 3300026121 | Ga0207683_10004720 | Ga0207683_1000472011 | 616 |
| 197 | 3300005328 | Ga0070676_10001034 | Ga0070676_100010344 | 617 |
| 198 | 3300005333 | Ga0070677_10000567 | Ga0070677_1000056712 | 617 |
| 199 | 3300005335 | Ga0070666_10001457 | Ga0070666_1000145712 | 617 |
| 200 | 3300005347 | Ga0070668_100003798 | Ga0070668_1000037989 | 617 |
| 201 | 3300005347 | Ga0070668_100056258 | Ga0070668_1000562582 | 617 |
| 202 | 3300005354 | Ga0070675_100009969 | Ga0070675_1000099692 | 617 |
| 203 | 3300005355 | Ga0070671_100003441 | Ga0070671_1000034419 | 617 |
| 204 | 3300005364 | Ga0070673_100000080 | Ga0070673_10000008016 | 617 |
| 205 | 3300005367 | Ga0070667_100003598 | Ga0070667_1000035981 | 617 |
| 206 | 3300005456 | Ga0070678_100079212 | Ga0070678_1000792121 | 617 |
| 207 | 3300005459 | Ga0068867_100001683 | Ga0068867_10000168312 | 617 |
| 208 | 3300005539 | Ga0068853_100013983 | Ga0068853_1000139834 | 617 |
| 209 | 3300005543 | Ga0070672_100001862 | Ga0070672_10000186212 | 617 |
| 210 | 3300005548 | Ga0070665_100035159 | Ga0070665_1000351595 | 617 |
| 211 | 3300005616 | Ga0068852_100091280 | Ga0068852_1000912801 | 617 |
| 212 | 3300005618 | Ga0068864_100017016 | Ga0068864_1000170161 | 617 |
| 213 | 3300005834 | Ga0068851_10000160 | Ga0068851_100001601 | 617 |
| 214 | 3300005841 | Ga0068863_100012466 | Ga0068863_1000124667 | 617 |
| 215 | 3300005841 | Ga0068863_100032091 | Ga0068863_1000320915 | 617 |
| 216 | 3300005843 | Ga0068860_100018470 | Ga0068860_1000184704 | 617 |
| 217 | 3300006358 | Ga0068871_100008985 | Ga0068871_1000089851 | 617 |
| 218 | 3300006844 | Ga0075428_100176831 | Ga0075428_1001768311 | 617 |
| 219 | 3300007788 | Ga0099795_10000016 | Ga0099795_1000001635 | 617 |
| 220 | 3300010159 | Ga0099796_10000003 | Ga0099796_1000000350 | 617 |
| 221 | 3300013296 | Ga0157374_10153685 | Ga0157374_101536852 | 617 |
| 222 | 3300013306 | Ga0163162_10013843 | Ga0163162_100138435 | 617 |
| 223 | 3300014968 | Ga0157379_10004023 | Ga0157379_100040233 | 617 |
| 224 | 3300017792 | Ga0163161_10061132 | Ga0163161_100611322 | 617 |
| 225 | 3300025321 | Ga0207656_10007034 | Ga0207656_100070343 | 617 |
| 226 | 3300025893 | Ga0207682_10000858 | Ga0207682_1000085812 | 617 |
| 227 | 3300025907 | Ga0207645_10001112 | Ga0207645_100011121 | 617 |
| 228 | 3300025926 | Ga0207659_10004740 | Ga0207659_100047405 | 617 |
| 229 | 3300025931 | Ga0207644_10004529 | Ga0207644_100045295 | 617 |
| 230 | 3300025940 | Ga0207691_10000379 | Ga0207691_1000037935 | 617 |
| 231 | 3300025960 | Ga0207651_10010732 | Ga0207651_100107322 | 617 |
| 232 | 3300025972 | Ga0207668_10011613 | Ga0207668_100116131 | 617 |
| 233 | 3300025986 | Ga0207658_10001175 | Ga0207658_1000117512 | 617 |
| 234 | 3300026023 | Ga0207677_10006771 | Ga0207677_100067715 | 617 |
| 235 | 3300026088 | Ga0207641_10005488 | Ga0207641_100054884 | 617 |
| 236 | 3300026088 | Ga0207641_10036242 | Ga0207641_100362422 | 617 |
| 237 | 3300026089 | Ga0207648_10043921 | Ga0207648_100439211 | 617 |
| 238 | 3300026095 | Ga0207676_10006273 | Ga0207676_100062735 | 617 |
| 239 | 3300026118 | Ga0207675_100019191 | Ga0207675_1000191915 | 617 |
| 240 | 3300026118 | Ga0207675_100021444 | Ga0207675_1000214443 | 617 |
| 241 | 3300026121 | Ga0207683_10001087 | Ga0207683_100010871 | 617 |
| 242 | 3300026142 | Ga0207698_10001048 | Ga0207698_100010488 | 617 |
| 243 | 3300027512 | Ga0209179_1000057 | Ga0209179_100005710 | 617 |
| 244 | 3300028379 | Ga0268266_10026161 | Ga0268266_100261611 | 617 |
| 245 | 3300033524 | Ga0316592_1000745 | Ga0316592_10007453 | 617 |
| 246 | 3300033524 | Ga0316592_1001282 | Ga0316592_10012823 | 617 |
| 247 | 3300033529 | Ga0316587_1002822 | Ga0316587_10028222 | 617 |
| 248 | 3300033541 | Ga0316596_1002002 | Ga0316596_10020023 | 617 |
| 249 | 3300035111 | Ga0373923_0001864 | Ga0373923_0001864_764_2671 | 617 |
| 250 | 3300035695 | Ga0373927_0026377 | Ga0373927_0026377_1620_3524 | 617 |
| 251 | 3300044712 | Ga0453684_0000114 | Ga0453684_0000114_186294_188165 | 617 |
| 252 | 3300045051 | Ga0451576_0024433 | Ga0451576_0024433_3889_5760 | 617 |
| 253 | 3300053146 | Ga0500588_0000119 | Ga0500588_0000119_3895_5784 | 617 |
| 254 | 3300005327 | Ga0070658_10034906 | Ga0070658_100349063 | 618 |
| 255 | 3300005328 | Ga0070676_10000669 | Ga0070676_1000066916 | 618 |
| 256 | 3300005328 | Ga0070676_10023839 | Ga0070676_100238391 | 618 |
| 257 | 3300005329 | Ga0070683_100001269 | Ga0070683_10000126915 | 618 |
| 258 | 3300005329 | Ga0070683_100056513 | Ga0070683_1000565132 | 618 |
| 259 | 3300005331 | Ga0070670_100036095 | Ga0070670_1000360952 | 618 |
| 260 | 3300005338 | Ga0068868_100007835 | Ga0068868_1000078353 | 618 |
| 261 | 3300005338 | Ga0068868_100019673 | Ga0068868_1000196734 | 618 |
| 262 | 3300005339 | Ga0070660_100001725 | Ga0070660_10000172513 | 618 |
| 263 | 3300005339 | Ga0070660_100026101 | Ga0070660_1000261011 | 618 |
| 264 | 3300005340 | Ga0070689_100047646 | Ga0070689_1000476463 | 618 |
| 265 | 3300005344 | Ga0070661_100009780 | Ga0070661_1000097805 | 618 |
| 266 | 3300005347 | Ga0070668_100007290 | Ga0070668_1000072906 | 618 |
| 267 | 3300005353 | Ga0070669_100001481 | Ga0070669_10000148112 | 618 |
| 268 | 3300005354 | Ga0070675_100003903 | Ga0070675_1000039036 | 618 |
| 269 | 3300005355 | Ga0070671_100000593 | Ga0070671_10000059315 | 618 |
| 270 | 3300005355 | Ga0070671_100007129 | Ga0070671_1000071296 | 618 |
| 271 | 3300005355 | Ga0070671_100010109 | Ga0070671_1000101097 | 618 |
| 272 | 3300005355 | Ga0070671_100031073 | Ga0070671_1000310735 | 618 |
| 273 | 3300005364 | Ga0070673_100014064 | Ga0070673_1000140644 | 618 |
| 274 | 3300005366 | Ga0070659_100001068 | Ga0070659_10000106814 | 618 |
| 275 | 3300005367 | Ga0070667_100006553 | Ga0070667_1000065536 | 618 |
| 276 | 3300005367 | Ga0070667_100007540 | Ga0070667_1000075401 | 618 |
| 277 | 3300005434 | Ga0070709_10061892 | Ga0070709_100618921 | 618 |
| 278 | 3300005435 | Ga0070714_100011920 | Ga0070714_1000119201 | 618 |
| 279 | 3300005436 | Ga0070713_100012791 | Ga0070713_1000127914 | 618 |
| 280 | 3300005440 | Ga0070705_100022441 | Ga0070705_1000224412 | 618 |
| 281 | 3300005455 | Ga0070663_100058747 | Ga0070663_1000587472 | 618 |
| 282 | 3300005456 | Ga0070678_100002115 | Ga0070678_1000021151 | 618 |
| 283 | 3300005456 | Ga0070678_100009819 | Ga0070678_1000098195 | 618 |
| 284 | 3300005457 | Ga0070662_100001613 | Ga0070662_1000016132 | 618 |
| 285 | 3300005457 | Ga0070662_100014178 | Ga0070662_1000141784 | 618 |
| 286 | 3300005459 | Ga0068867_100002555 | Ga0068867_10000255512 | 618 |
| 287 | 3300005466 | Ga0070685_10012286 | Ga0070685_100122862 | 618 |
| 288 | 3300005468 | Ga0070707_100049687 | Ga0070707_1000496872 | 618 |
| 289 | 3300005518 | Ga0070699_100004966 | Ga0070699_10000496611 | 618 |
| 290 | 3300005536 | Ga0070697_100011619 | Ga0070697_1000116194 | 618 |
| 291 | 3300005536 | Ga0070697_100036887 | Ga0070697_1000368872 | 618 |
| 292 | 3300005539 | Ga0068853_100000801 | Ga0068853_10000080115 | 618 |
| 293 | 3300005544 | Ga0070686_100023233 | Ga0070686_1000232332 | 618 |
| 294 | 3300005546 | Ga0070696_100022229 | Ga0070696_1000222292 | 618 |
| 295 | 3300005547 | Ga0070693_100001090 | Ga0070693_1000010901 | 618 |
| 296 | 3300005547 | Ga0070693_100010495 | Ga0070693_1000104952 | 618 |
| 297 | 3300005548 | Ga0070665_100090774 | Ga0070665_1000907742 | 618 |
| 298 | 3300005549 | Ga0070704_100010773 | Ga0070704_1000107735 | 618 |
| 299 | 3300005549 | Ga0070704_100094465 | Ga0070704_1000944651 | 618 |
| 300 | 3300005563 | Ga0068855_100004503 | Ga0068855_1000045036 | 618 |
| 301 | 3300005563 | Ga0068855_100074434 | Ga0068855_1000744345 | 618 |
| 302 | 3300005564 | Ga0070664_100002684 | Ga0070664_1000026846 | 618 |
| 303 | 3300005564 | Ga0070664_100139631 | Ga0070664_1001396312 | 618 |
| 304 | 3300005578 | Ga0068854_100007266 | Ga0068854_1000072665 | 618 |
| 305 | 3300005578 | Ga0068854_100029505 | Ga0068854_1000295052 | 618 |
| 306 | 3300005614 | Ga0068856_100000125 | Ga0068856_10000012520 | 618 |
| 307 | 3300005615 | Ga0070702_100001358 | Ga0070702_1000013581 | 618 |
| 308 | 3300005615 | Ga0070702_100019107 | Ga0070702_1000191072 | 618 |
| 309 | 3300005616 | Ga0068852_100083762 | Ga0068852_1000837622 | 618 |
| 310 | 3300005618 | Ga0068864_100046626 | Ga0068864_1000466263 | 618 |
| 311 | 3300005718 | Ga0068866_10001951 | Ga0068866_100019515 | 618 |
| 312 | 3300005834 | Ga0068851_10008106 | Ga0068851_100081066 | 618 |
| 313 | 3300005843 | Ga0068860_100006790 | Ga0068860_1000067905 | 618 |
| 314 | 3300005843 | Ga0068860_100054494 | Ga0068860_1000544944 | 618 |
| 315 | 3300006173 | Ga0070716_100014257 | Ga0070716_1000142573 | 618 |
| 316 | 3300006175 | Ga0070712_100020705 | Ga0070712_1000207052 | 618 |
| 317 | 3300006237 | Ga0097621_100049946 | Ga0097621_1000499461 | 618 |
| 318 | 3300006358 | Ga0068871_100038937 | Ga0068871_1000389372 | 618 |
| 319 | 3300006881 | Ga0068865_100019608 | Ga0068865_1000196081 | 618 |
| 320 | 3300009093 | Ga0105240_10052541 | Ga0105240_100525414 | 618 |
| 321 | 3300009098 | Ga0105245_10019608 | Ga0105245_100196085 | 618 |
| 322 | 3300009174 | Ga0105241_10026924 | Ga0105241_100269245 | 618 |
| 323 | 3300009176 | Ga0105242_10035475 | Ga0105242_100354753 | 618 |
| 324 | 3300009176 | Ga0105242_10107307 | Ga0105242_101073071 | 618 |
| 325 | 3300009553 | Ga0105249_10028407 | Ga0105249_100284071 | 618 |
| 326 | 3300013100 | Ga0157373_10000833 | Ga0157373_100008339 | 618 |
| 327 | 3300013102 | Ga0157371_10002450 | Ga0157371_100024507 | 618 |
| 328 | 3300013105 | Ga0157369_10097566 | Ga0157369_100975663 | 618 |
| 329 | 3300013296 | Ga0157374_10052465 | Ga0157374_100524655 | 618 |
| 330 | 3300013297 | Ga0157378_10005252 | Ga0157378_1000525210 | 618 |
| 331 | 3300013306 | Ga0163162_10025680 | Ga0163162_100256802 | 618 |
| 332 | 3300013307 | Ga0157372_10010634 | Ga0157372_100106348 | 618 |
| 333 | 3300014325 | Ga0163163_10038021 | Ga0163163_100380215 | 618 |
| 334 | 3300014326 | Ga0157380_10058304 | Ga0157380_100583042 | 618 |
| 335 | 3300014745 | Ga0157377_10056704 | Ga0157377_100567042 | 618 |
| 336 | 3300014968 | Ga0157379_10016262 | Ga0157379_100162626 | 618 |
| 337 | 3300014969 | Ga0157376_10024290 | Ga0157376_100242902 | 618 |
| 338 | 3300025315 | Ga0207697_10000114 | Ga0207697_1000011426 | 618 |
| 339 | 3300025321 | Ga0207656_10011601 | Ga0207656_100116012 | 618 |
| 340 | 3300025899 | Ga0207642_10006674 | Ga0207642_100066742 | 618 |
| 341 | 3300025901 | Ga0207688_10002342 | Ga0207688_100023426 | 618 |
| 342 | 3300025907 | Ga0207645_10015746 | Ga0207645_100157462 | 618 |
| 343 | 3300025907 | Ga0207645_10032720 | Ga0207645_100327203 | 618 |
| 344 | 3300025908 | Ga0207643_10005318 | Ga0207643_100053182 | 618 |
| 345 | 3300025910 | Ga0207684_10082656 | Ga0207684_100826562 | 618 |
| 346 | 3300025917 | Ga0207660_10019006 | Ga0207660_100190062 | 618 |
| 347 | 3300025919 | Ga0207657_10001407 | Ga0207657_1000140711 | 618 |
| 348 | 3300025919 | Ga0207657_10024634 | Ga0207657_100246344 | 618 |
| 349 | 3300025920 | Ga0207649_10024324 | Ga0207649_100243242 | 618 |
| 350 | 3300025925 | Ga0207650_10002803 | Ga0207650_100028032 | 618 |
| 351 | 3300025925 | Ga0207650_10058573 | Ga0207650_100585732 | 618 |
| 352 | 3300025926 | Ga0207659_10002324 | Ga0207659_100023242 | 618 |
| 353 | 3300025927 | Ga0207687_10009320 | Ga0207687_100093205 | 618 |
| 354 | 3300025929 | Ga0207664_10001005 | Ga0207664_1000100510 | 618 |
| 355 | 3300025932 | Ga0207690_10003798 | Ga0207690_100037984 | 618 |
| 356 | 3300025933 | Ga0207706_10000133 | Ga0207706_1000013315 | 618 |
| 357 | 3300025933 | Ga0207706_10002930 | Ga0207706_100029308 | 618 |
| 358 | 3300025933 | Ga0207706_10015833 | Ga0207706_100158331 | 618 |
| 359 | 3300025934 | Ga0207686_10001096 | Ga0207686_100010963 | 618 |
| 360 | 3300025938 | Ga0207704_10017552 | Ga0207704_100175521 | 618 |
| 361 | 3300025939 | Ga0207665_10014310 | Ga0207665_100143104 | 618 |
| 362 | 3300025940 | Ga0207691_10045792 | Ga0207691_100457924 | 618 |
| 363 | 3300025941 | Ga0207711_10128161 | Ga0207711_101281611 | 618 |
| 364 | 3300025942 | Ga0207689_10011981 | Ga0207689_100119816 | 618 |
| 365 | 3300025944 | Ga0207661_10009925 | Ga0207661_100099256 | 618 |
| 366 | 3300025945 | Ga0207679_10002124 | Ga0207679_100021246 | 618 |
| 367 | 3300025949 | Ga0207667_10001411 | Ga0207667_1000141127 | 618 |
| 368 | 3300025949 | Ga0207667_10046061 | Ga0207667_100460611 | 618 |
| 369 | 3300025981 | Ga0207640_10009097 | Ga0207640_100090973 | 618 |
| 370 | 3300026023 | Ga0207677_10020735 | Ga0207677_100207352 | 618 |
| 371 | 3300026041 | Ga0207639_10005169 | Ga0207639_100051694 | 618 |
| 372 | 3300026041 | Ga0207639_10087966 | Ga0207639_100879662 | 618 |
| 373 | 3300026067 | Ga0207678_10001121 | Ga0207678_1000112125 | 618 |
| 374 | 3300026075 | Ga0207708_10002496 | Ga0207708_1000249612 | 618 |
| 375 | 3300026078 | Ga0207702_10019447 | Ga0207702_100194475 | 618 |
| 376 | 3300026095 | Ga0207676_10012267 | Ga0207676_100122671 | 618 |
| 377 | 3300026116 | Ga0207674_10010085 | Ga0207674_100100856 | 618 |
| 378 | 3300026116 | Ga0207674_10045963 | Ga0207674_100459634 | 618 |
| 379 | 3300026118 | Ga0207675_100104940 | Ga0207675_1001049402 | 618 |
| 380 | 3300026121 | Ga0207683_10000835 | Ga0207683_100008352 | 618 |
| 381 | 3300026142 | Ga0207698_10058164 | Ga0207698_100581641 | 618 |
| 382 | 3300028381 | Ga0268264_10015059 | Ga0268264_100150595 | 618 |
| 383 | 3300031251 | Ga0265327_10024591 | Ga0265327_100245911 | 618 |
| 384 | 3300031548 | Ga0307408_100007011 | Ga0307408_1000070113 | 618 |
| 385 | 3300031691 | Ga0316579_10011653 | Ga0316579_100116533 | 618 |
| 386 | 3300031731 | Ga0307405_10004332 | Ga0307405_100043325 | 618 |
| 387 | 3300031824 | Ga0307413_10000277 | Ga0307413_100002779 | 618 |
| 388 | 3300031901 | Ga0307406_10001701 | Ga0307406_100017013 | 618 |
| 389 | 3300031903 | Ga0307407_10002689 | Ga0307407_100026896 | 618 |
| 390 | 3300031995 | Ga0307409_100004952 | Ga0307409_1000049525 | 618 |
| 391 | 3300032004 | Ga0307414_10028146 | Ga0307414_100281463 | 618 |
| 392 | 3300032139 | Ga0316580_10003674 | Ga0316580_100036743 | 618 |
| 393 | 3300032168 | Ga0316593_10002926 | Ga0316593_100029262 | 618 |
| 394 | 3300036712 | Ga0316584_0026814 | Ga0316584_0026814_1958_3895 | 618 |
| 395 | 3300037068 | Ga0373925_0049975 | Ga0373925_0049975_453_2342 | 618 |
| 396 | 3300039062 | Ga0400483_267281 | Ga0400483_267281_463_2382 | 618 |
| 397 | 3300044712 | Ga0453684_0000316 | Ga0453684_0000316_141167_143071 | 618 |
| 398 | 3300044712 | Ga0453684_0007378 | Ga0453684_0007378_12150_14060 | 618 |
| 399 | 3300045051 | Ga0451576_0000128 | Ga0451576_0000128_128781_130685 | 618 |
| 400 | 3300045051 | Ga0451576_0011629 | Ga0451576_0011629_1537_3411 | 618 |
| 401 | 3300045051 | Ga0451576_0128366 | Ga0451576_0128366_21_1931 | 618 |
| 402 | 3300046539 | Ga0495621_0000820 | Ga0495621_0000820_3482_5371 | 618 |
| 403 | 3300048904 | Ga0496101_0070880 | Ga0496101_0070880_172_2112 | 618 |
| 404 | 3300048909 | Ga0496106_0001570 | Ga0496106_0001570_2091_3980 | 618 |
| 405 | 3300048909 | Ga0496106_0052453 | Ga0496106_0052453_1073_3013 | 618 |
| 406 | 3300048910 | Ga0496107_0081130 | Ga0496107_0081130_136_2076 | 618 |
| 407 | 3300048912 | Ga0496109_0000601 | Ga0496109_0000601_603_2543 | 618 |
| 408 | 3300048913 | Ga0496110_0034147 | Ga0496110_0034147_424_2364 | 618 |
| 409 | 3300048917 | Ga0496114_0095154 | Ga0496114_0095154_274_2214 | 618 |
| 410 | 3300005543 | Ga0070672_100002490 | Ga0070672_1000024907 | 619 |
| 411 | 3300005548 | Ga0070665_100015080 | Ga0070665_1000150806 | 619 |
| 412 | 3300005617 | Ga0068859_100015900 | Ga0068859_1000159002 | 619 |
| 413 | 3300005842 | Ga0068858_100017415 | Ga0068858_1000174154 | 619 |
| 414 | 3300006237 | Ga0097621_100004956 | Ga0097621_1000049563 | 619 |
| 415 | 3300006881 | Ga0068865_100010605 | Ga0068865_1000106055 | 619 |
| 416 | 3300006931 | Ga0097620_100015901 | Ga0097620_1000159012 | 619 |
| 417 | 3300013306 | Ga0163162_10000874 | Ga0163162_1000087418 | 619 |
| 418 | 3300014969 | Ga0157376_10004890 | Ga0157376_100048908 | 619 |
| 419 | 3300025903 | Ga0207680_10002593 | Ga0207680_100025935 | 619 |
| 420 | 3300025907 | Ga0207645_10002453 | Ga0207645_1000245311 | 619 |
| 421 | 3300025923 | Ga0207681_10006104 | Ga0207681_100061042 | 619 |
| 422 | 3300025926 | Ga0207659_10001621 | Ga0207659_100016218 | 619 |
| 423 | 3300025931 | Ga0207644_10003348 | Ga0207644_100033487 | 619 |
| 424 | 3300025936 | Ga0207670_10010751 | Ga0207670_100107512 | 619 |
| 425 | 3300025938 | Ga0207704_10003876 | Ga0207704_100038765 | 619 |
| 426 | 3300025940 | Ga0207691_10000560 | Ga0207691_1000056033 | 619 |
| 427 | 3300025942 | Ga0207689_10004023 | Ga0207689_100040237 | 619 |
| 428 | 3300025960 | Ga0207651_10015080 | Ga0207651_100150804 | 619 |
| 429 | 3300025972 | Ga0207668_10024395 | Ga0207668_100243951 | 619 |
| 430 | 3300025986 | Ga0207658_10007614 | Ga0207658_100076144 | 619 |
| 431 | 3300026023 | Ga0207677_10024802 | Ga0207677_100248022 | 619 |
| 432 | 3300026035 | Ga0207703_10007993 | Ga0207703_100079936 | 619 |
| 433 | 3300026088 | Ga0207641_10001267 | Ga0207641_100012676 | 619 |
| 434 | 3300026089 | Ga0207648_10000715 | Ga0207648_1000071533 | 619 |
| 435 | 3300026095 | Ga0207676_10006901 | Ga0207676_100069015 | 619 |
| 436 | 3300026121 | Ga0207683_10000219 | Ga0207683_1000021915 | 619 |
| 437 | 3300028381 | Ga0268264_10006919 | Ga0268264_100069199 | 619 |
| 438 | 3300031235 | Ga0265330_10001258 | Ga0265330_100012584 | 619 |
| 439 | 3300031238 | Ga0265332_10001479 | Ga0265332_100014797 | 619 |
| 440 | 3300031242 | Ga0265329_10001661 | Ga0265329_100016614 | 619 |
| 441 | 3300031548 | Ga0307408_100010172 | Ga0307408_1000101721 | 619 |
| 442 | 3300031727 | Ga0316576_10076363 | Ga0316576_100763631 | 619 |
| 443 | 3300031728 | Ga0316578_10024937 | Ga0316578_100249374 | 619 |
| 444 | 3300031731 | Ga0307405_10019417 | Ga0307405_100194173 | 619 |
| 445 | 3300031824 | Ga0307413_10014540 | Ga0307413_100145403 | 619 |
| 446 | 3300031852 | Ga0307410_10003717 | Ga0307410_100037178 | 619 |
| 447 | 3300031901 | Ga0307406_10003217 | Ga0307406_100032171 | 619 |
| 448 | 3300031911 | Ga0307412_10035572 | Ga0307412_100355722 | 619 |
| 449 | 3300032002 | Ga0307416_100022817 | Ga0307416_1000228172 | 619 |
| 450 | 3300032005 | Ga0307411_10004650 | Ga0307411_100046501 | 619 |
| 451 | 3300032126 | Ga0307415_100003057 | Ga0307415_1000030574 | 619 |
| 452 | 3300038725 | Ga0400484_41940 | Ga0400484_41940_23401_25299 | 619 |
| 453 | 3300038726 | Ga0400490_00726 | Ga0400490_00726_2831_4729 | 619 |
| 454 | 3300038726 | Ga0400490_60503 | Ga0400490_60503_3216_5114 | 619 |
| 455 | 3300038735 | Ga0400485_02514 | Ga0400485_02514_2121_4022 | 619 |
| 456 | 3300038741 | Ga0400488_47521 | Ga0400488_47521_2122_4023 | 619 |
| 457 | 3300038742 | Ga0400486_23219 | Ga0400486_23219_1468_3369 | 619 |
| 458 | 3300038742 | Ga0400486_27054 | Ga0400486_27054_1002_2987 | 619 |
| 459 | 3300039062 | Ga0400483_062114 | Ga0400483_062114_11939_13837 | 619 |
| 460 | 3300039062 | Ga0400483_241992 | Ga0400483_241992_2798_4696 | 619 |
| 461 | 3300039093 | Ga0400489_50293 | Ga0400489_50293_1484_3385 | 619 |
| 462 | 3300039110 | Ga0400487_35747 | Ga0400487_35747_1589_3487 | 619 |
| 463 | 3300031727 | Ga0316576_10026869 | Ga0316576_100268693 | 620 |
| 464 | 3300033527 | Ga0316586_1000273 | Ga0316586_10002732 | 620 |
| 465 | 3300005356 | Ga0070674_100017988 | Ga0070674_1000179882 | 621 |
| 466 | 3300026121 | Ga0207683_10050403 | Ga0207683_100504032 | 621 |
| 467 | 3300049586 | Ga0501070_0012854 | Ga0501070_0012854_526_2415 | 621 |
| 468 | 3300049590 | Ga0501074_0003284 | Ga0501074_0003284_5011_6900 | 621 |
| 469 | 3300049742 | Ga0501080_0054341 | Ga0501080_0054341_917_2806 | 621 |
| 470 | 3300053133 | Ga0500655_000856 | Ga0500655_000856_3681_5558 | 621 |
| 471 | 3300053178 | Ga0500637_0000737 | Ga0500637_0000737_9387_11270 | 621 |
| 472 | 3300009093 | Ga0105240_10009479 | Ga0105240_100094794 | 622 |
| 473 | 3300009098 | Ga0105245_10029850 | Ga0105245_100298506 | 622 |
| 474 | 3300014969 | Ga0157376_10035057 | Ga0157376_100350572 | 622 |
| 475 | 3300025927 | Ga0207687_10087385 | Ga0207687_100873852 | 622 |
| 476 | 3300025942 | Ga0207689_10028334 | Ga0207689_100283342 | 622 |
| 477 | 3300031507 | Ga0307509_10005364 | Ga0307509_100053648 | 622 |
| 478 | 3300044673 | Ga0453683_0001668 | Ga0453683_0001668_14472_16358 | 622 |
| 479 | 3300046530 | Ga0495654_0002047 | Ga0495654_0002047_8927_10840 | 622 |
| 480 | 3300048905 | Ga0496102_0167515 | Ga0496102_0167515_168_2045 | 622 |
| 481 | 3300005334 | Ga0068869_100003429 | Ga0068869_1000034292 | 623 |
| 482 | 3300005338 | Ga0068868_100068650 | Ga0068868_1000686502 | 623 |
| 483 | 3300005340 | Ga0070689_100000557 | Ga0070689_10000055719 | 623 |
| 484 | 3300005343 | Ga0070687_100002704 | Ga0070687_1000027042 | 623 |
| 485 | 3300005344 | Ga0070661_100003561 | Ga0070661_10000356111 | 623 |
| 486 | 3300005347 | Ga0070668_100009366 | Ga0070668_1000093663 | 623 |
| 487 | 3300005347 | Ga0070668_100061786 | Ga0070668_1000617862 | 623 |
| 488 | 3300005353 | Ga0070669_100018241 | Ga0070669_1000182413 | 623 |
| 489 | 3300005354 | Ga0070675_100009408 | Ga0070675_1000094086 | 623 |
| 490 | 3300005364 | Ga0070673_100001988 | Ga0070673_1000019885 | 623 |
| 491 | 3300005366 | Ga0070659_100083126 | Ga0070659_1000831262 | 623 |
| 492 | 3300005440 | Ga0070705_100017562 | Ga0070705_1000175622 | 623 |
| 493 | 3300005456 | Ga0070678_100049351 | Ga0070678_1000493512 | 623 |
| 494 | 3300005457 | Ga0070662_100031453 | Ga0070662_1000314533 | 623 |
| 495 | 3300005466 | Ga0070685_10010723 | Ga0070685_100107234 | 623 |
| 496 | 3300005543 | Ga0070672_100002116 | Ga0070672_1000021163 | 623 |
| 497 | 3300005544 | Ga0070686_100005776 | Ga0070686_1000057766 | 623 |
| 498 | 3300005548 | Ga0070665_100006695 | Ga0070665_1000066952 | 623 |
| 499 | 3300005564 | Ga0070664_100056597 | Ga0070664_1000565972 | 623 |
| 500 | 3300005617 | Ga0068859_100019851 | Ga0068859_1000198516 | 623 |
| 501 | 3300005618 | Ga0068864_100021775 | Ga0068864_1000217754 | 623 |
| 502 | 3300005719 | Ga0068861_100000559 | Ga0068861_10000055917 | 623 |
| 503 | 3300005840 | Ga0068870_10013406 | Ga0068870_100134063 | 623 |
| 504 | 3300005842 | Ga0068858_100063456 | Ga0068858_1000634562 | 623 |
| 505 | 3300005844 | Ga0068862_100009782 | Ga0068862_1000097827 | 623 |
| 506 | 3300005844 | Ga0068862_100013173 | Ga0068862_1000131736 | 623 |
| 507 | 3300006237 | Ga0097621_100016840 | Ga0097621_1000168402 | 623 |
| 508 | 3300006844 | Ga0075428_100001774 | Ga0075428_10000177417 | 623 |
| 509 | 3300006844 | Ga0075428_100002700 | Ga0075428_1000027007 | 623 |
| 510 | 3300006844 | Ga0075428_100035286 | Ga0075428_1000352863 | 623 |
| 511 | 3300006846 | Ga0075430_100000749 | Ga0075430_10000074920 | 623 |
| 512 | 3300006846 | Ga0075430_100010346 | Ga0075430_1000103467 | 623 |
| 513 | 3300006847 | Ga0075431_100000091 | Ga0075431_10000009118 | 623 |
| 514 | 3300006847 | Ga0075431_100011736 | Ga0075431_1000117367 | 623 |
| 515 | 3300006880 | Ga0075429_100000742 | Ga0075429_10000074216 | 623 |
| 516 | 3300006931 | Ga0097620_100019851 | Ga0097620_1000198516 | 623 |
| 517 | 3300009094 | Ga0111539_10005451 | Ga0111539_1000545111 | 623 |
| 518 | 3300009094 | Ga0111539_10072061 | Ga0111539_100720613 | 623 |
| 519 | 3300009147 | Ga0114129_10000484 | Ga0114129_1000048423 | 623 |
| 520 | 3300009147 | Ga0114129_10013411 | Ga0114129_100134116 | 623 |
| 521 | 3300009177 | Ga0105248_10002830 | Ga0105248_1000283018 | 623 |
| 522 | 3300009553 | Ga0105249_10006904 | Ga0105249_100069048 | 623 |
| 523 | 3300014325 | Ga0163163_10001444 | Ga0163163_1000144420 | 623 |
| 524 | 3300014745 | Ga0157377_10004789 | Ga0157377_100047897 | 623 |
| 525 | 3300025908 | Ga0207643_10049520 | Ga0207643_100495201 | 623 |
| 526 | 3300025918 | Ga0207662_10009113 | Ga0207662_100091134 | 623 |
| 527 | 3300025933 | Ga0207706_10019927 | Ga0207706_100199275 | 623 |
| 528 | 3300025936 | Ga0207670_10014088 | Ga0207670_100140882 | 623 |
| 529 | 3300025945 | Ga0207679_10009654 | Ga0207679_100096542 | 623 |
| 530 | 3300025960 | Ga0207651_10057921 | Ga0207651_100579212 | 623 |
| 531 | 3300025961 | Ga0207712_10027415 | Ga0207712_100274152 | 623 |
| 532 | 3300025986 | Ga0207658_10060887 | Ga0207658_100608872 | 623 |
| 533 | 3300026088 | Ga0207641_10011486 | Ga0207641_100114867 | 623 |
| 534 | 3300026089 | Ga0207648_10032259 | Ga0207648_100322592 | 623 |
| 535 | 3300026116 | Ga0207674_10062571 | Ga0207674_100625714 | 623 |
| 536 | 3300026118 | Ga0207675_100001230 | Ga0207675_1000012309 | 623 |
| 537 | 3300026118 | Ga0207675_100032655 | Ga0207675_1000326553 | 623 |
| 538 | 3300026121 | Ga0207683_10052835 | Ga0207683_100528352 | 623 |
| 539 | 3300027907 | Ga0207428_10002009 | Ga0207428_100020097 | 623 |
| 540 | 3300027907 | Ga0207428_10028440 | Ga0207428_100284403 | 623 |
| 541 | 3300028379 | Ga0268266_10034107 | Ga0268266_100341073 | 623 |
| 542 | 3300028380 | Ga0268265_10002172 | Ga0268265_100021726 | 623 |
| 543 | 3300028794 | Ga0307515_10126165 | Ga0307515_101261652 | 623 |
| 544 | 3300031456 | Ga0307513_10013861 | Ga0307513_100138614 | 623 |
| 545 | 3300031456 | Ga0307513_10050276 | Ga0307513_100502763 | 623 |
| 546 | 3300032002 | Ga0307416_100029829 | Ga0307416_1000298293 | 623 |
| 547 | 3300045051 | Ga0451576_0019403 | Ga0451576_0019403_396_2285 | 623 |
| 548 | 3300048911 | Ga0496108_0044597 | Ga0496108_0044597_1642_3531 | 623 |
| 549 | 3300049570 | Ga0501033_0018722 | Ga0501033_0018722_1113_2993 | 623 |
| 550 | 3300049575 | Ga0501039_0030938 | Ga0501039_0030938_1987_3867 | 623 |
| 551 | 3300049577 | Ga0501041_0017807 | Ga0501041_0017807_204_2084 | 623 |
| 552 | 3300049578 | Ga0501042_0007861 | Ga0501042_0007861_777_2657 | 623 |
| 553 | 3300049591 | Ga0501075_0001026 | Ga0501075_0001026_3659_5539 | 623 |
| 554 | 3300049592 | Ga0501076_0000823 | Ga0501076_0000823_7764_9644 | 623 |
| 555 | 3300049741 | Ga0501079_0002741 | Ga0501079_0002741_3662_5542 | 623 |
| 556 | 3300049743 | Ga0501081_0001676 | Ga0501081_0001676_8390_10270 | 623 |
| 557 | 3300049824 | Ga0501045_0002996 | Ga0501045_0002996_3666_5546 | 623 |
| 558 | 3300050507 | nmdc:mga05p37_16088_c1 | nmdc:mga05p37_16088_c1_3467_5356 | 623 |
| 559 | 3300050507 | nmdc:mga05p37_889_c1 | nmdc:mga05p37_889_c1_6880_8769 | 623 |
| 560 | 3300050508 | nmdc:mga09592_128990_c1 | nmdc:mga09592_128990_c1_21_1910 | 623 |
| 561 | 3300050508 | nmdc:mga09592_360_c1 | nmdc:mga09592_360_c1_12241_14130 | 623 |
| 562 | 3300050509 | nmdc:mga0qj67_11168_c1 | nmdc:mga0qj67_11168_c1_3989_5878 | 623 |
| 563 | 3300050510 | nmdc:mga06r32_1015_c1 | nmdc:mga06r32_1015_c1_19537_21426 | 623 |
| 564 | 3300050510 | nmdc:mga06r32_29_c1 | nmdc:mga06r32_29_c1_49100_50989 | 623 |
| 565 | 3300050510 | nmdc:mga06r32_9332_c1 | nmdc:mga06r32_9332_c1_3995_5884 | 623 |
| 566 | 3300050511 | nmdc:mga08y16_1764_c1 | nmdc:mga08y16_1764_c1_5884_7773 | 623 |
| 567 | 3300054114 | Ga0501084_0030606 | Ga0501084_0030606_729_2609 | 623 |
| 568 | 3300060353 | Ga0501082_0001772 | Ga0501082_0001772_5067_6947 | 623 |
| 569 | 3300061734 | Ga0530510_0003511 | Ga0530510_0003511_7962_9842 | 623 |
| 570 | 3300025916 | Ga0207663_10014918 | Ga0207663_100149182 | 624 |
| 571 | iso_pu_bacteria | 2585428057 | 2587724858 | 624 |
| 572 | iso_pu_bacteria | 2585428058 | 2587736735 | 624 |
| 573 | iso_pu_bacteria | 2643221592 | 2643970217 | 624 |
| 574 | iso_pu_bacteria | 2643221625 | 2644142385 | 624 |
| 575 | iso_pu_bacteria | 2643221648 | 2644275149 | 624 |
| 576 | 3300005719 | Ga0068861_100000502 | Ga0068861_10000050221 | 625 |
| 577 | 3300005937 | Ga0081455_10001787 | Ga0081455_1000178714 | 625 |
| 578 | 3300026118 | Ga0207675_100005405 | Ga0207675_1000054054 | 625 |
| 579 | 3300031995 | Ga0307409_100000588 | Ga0307409_1000005884 | 625 |
| 580 | 3300032168 | Ga0316593_10018752 | Ga0316593_100187521 | 625 |
| 581 | 3300047472 | Ga0495686_0004579 | Ga0495686_0004579_2645_4525 | 625 |
| 582 | 3300005333 | Ga0070677_10000838 | Ga0070677_100008384 | 626 |
| 583 | 3300005333 | Ga0070677_10003738 | Ga0070677_100037384 | 626 |
| 584 | 3300005340 | Ga0070689_100006704 | Ga0070689_1000067042 | 626 |
| 585 | 3300005354 | Ga0070675_100020283 | Ga0070675_1000202834 | 626 |
| 586 | 3300005354 | Ga0070675_100054286 | Ga0070675_1000542862 | 626 |
| 587 | 3300005354 | Ga0070675_100092379 | Ga0070675_1000923792 | 626 |
| 588 | 3300005440 | Ga0070705_100033576 | Ga0070705_1000335762 | 626 |
| 589 | 3300005444 | Ga0070694_100017694 | Ga0070694_1000176941 | 626 |
| 590 | 3300005543 | Ga0070672_100002100 | Ga0070672_1000021005 | 626 |
| 591 | 3300005564 | Ga0070664_100016106 | Ga0070664_1000161062 | 626 |
| 592 | 3300005615 | Ga0070702_100022379 | Ga0070702_1000223793 | 626 |
| 593 | 3300005617 | Ga0068859_100022664 | Ga0068859_1000226645 | 626 |
| 594 | 3300005719 | Ga0068861_100000511 | Ga0068861_10000051111 | 626 |
| 595 | 3300005843 | Ga0068860_100015014 | Ga0068860_1000150145 | 626 |
| 596 | 3300006237 | Ga0097621_100005297 | Ga0097621_10000529710 | 626 |
| 597 | 3300006358 | Ga0068871_100088568 | Ga0068871_1000885682 | 626 |
| 598 | 3300006931 | Ga0097620_100022664 | Ga0097620_1000226643 | 626 |
| 599 | 3300013296 | Ga0157374_10075254 | Ga0157374_100752542 | 626 |
| 600 | 3300014325 | Ga0163163_10010745 | Ga0163163_100107459 | 626 |
| 601 | 3300014326 | Ga0157380_10005809 | Ga0157380_100058094 | 626 |
| 602 | 3300014326 | Ga0157380_10015362 | Ga0157380_100153622 | 626 |
| 603 | 3300025893 | Ga0207682_10008312 | Ga0207682_100083122 | 626 |
| 604 | 3300025893 | Ga0207682_10009031 | Ga0207682_100090312 | 626 |
| 605 | 3300025908 | Ga0207643_10009326 | Ga0207643_100093263 | 626 |
| 606 | 3300025936 | Ga0207670_10004746 | Ga0207670_100047464 | 626 |
| 607 | 3300025940 | Ga0207691_10003982 | Ga0207691_100039827 | 626 |
| 608 | 3300025940 | Ga0207691_10008726 | Ga0207691_100087262 | 626 |
| 609 | 3300025942 | Ga0207689_10010086 | Ga0207689_100100862 | 626 |
| 610 | 3300025960 | Ga0207651_10095514 | Ga0207651_100955142 | 626 |
| 611 | 3300026075 | Ga0207708_10035340 | Ga0207708_100353402 | 626 |
| 612 | 3300026075 | Ga0207708_10037070 | Ga0207708_100370702 | 626 |
| 613 | 3300026118 | Ga0207675_100002626 | Ga0207675_1000026265 | 626 |
| 614 | 3300026121 | Ga0207683_10007647 | Ga0207683_100076473 | 626 |
| 615 | 3300028794 | Ga0307515_10000090 | Ga0307515_10000090131 | 626 |
| 616 | 3300028794 | Ga0307515_10000889 | Ga0307515_1000088952 | 626 |
| 617 | 3300031616 | Ga0307508_10000007 | Ga0307508_1000000714 | 626 |
| 618 | 3300031730 | Ga0307516_10000398 | Ga0307516_100003984 | 626 |
| 619 | 3300031824 | Ga0307413_10000910 | Ga0307413_1000091011 | 626 |
| 620 | 3300031852 | Ga0307410_10005461 | Ga0307410_100054611 | 626 |
| 621 | 3300031995 | Ga0307409_100025708 | Ga0307409_1000257082 | 626 |
| 622 | 3300044712 | Ga0453684_0064017 | Ga0453684_0064017_2424_4325 | 626 |
| 623 | 3300049588 | Ga0501072_0037294 | Ga0501072_0037294_669_2570 | 626 |
| 624 | 3300049589 | Ga0501073_0002745 | Ga0501073_0002745_10340_12241 | 626 |
| 625 | 3300049741 | Ga0501079_0000163 | Ga0501079_0000163_21357_23258 | 626 |
| 626 | 3300049742 | Ga0501080_0061130 | Ga0501080_0061130_1449_3350 | 626 |
| 627 | 3300053154 | Ga0500619_000325 | Ga0500619_000325_2791_4674 | 626 |
| 628 | 3300054114 | Ga0501084_0047376 | Ga0501084_0047376_1688_3589 | 626 |
| 629 | 3300060353 | Ga0501082_0023235 | Ga0501082_0023235_99_2000 | 626 |
| 630 | 3300031727 | Ga0316576_10000968 | Ga0316576_100009683 | 627 |
| 631 | 3300031728 | Ga0316578_10000827 | Ga0316578_100008273 | 627 |
| 632 | 3300031733 | Ga0316577_10002878 | Ga0316577_100028782 | 627 |
| 633 | 3300032126 | Ga0307415_100017578 | Ga0307415_1000175783 | 627 |
| 634 | 3300033541 | Ga0316596_1002895 | Ga0316596_10028953 | 627 |
| 635 | 3300036647 | Ga0316582_0026694 | Ga0316582_0026694_1415_3400 | 627 |
| 636 | 3300036712 | Ga0316584_0000396 | Ga0316584_0000396_2105_4090 | 627 |
| 637 | 3300005262 | Ga0065165_1000967 | Ga0065165_100096716 | 628 |
| 638 | 3300006353 | Ga0075370_10019906 | Ga0075370_100199062 | 628 |
| 639 | 3300025298 | Ga0209050_1000980 | Ga0209050_10009802 | 628 |
| 640 | 3300046519 | Ga0495632_0002939 | Ga0495632_0002939_1051_2937 | 628 |
| 641 | 3300053086 | Ga0500578_0000213 | Ga0500578_0000213_21561_23450 | 628 |
| 642 | 3300053093 | Ga0500651_0032774 | Ga0500651_0032774_19_1905 | 628 |
| 643 | 3300053130 | Ga0500642_0016576 | Ga0500642_0016576_255_2141 | 628 |
| 644 | 3300053131 | Ga0500652_000839 | Ga0500652_000839_7323_9209 | 628 |
| 645 | 3300053156 | Ga0500622_0003145 | Ga0500622_0003145_7893_9779 | 628 |
| 646 | 3300003215 | JGI25153J46596_10015059 | JGI25153J46596_100150592 | 629 |
| 647 | 3300025297 | Ga0209758_1000146 | Ga0209758_100014613 | 629 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a29-assembly3.cif.gz_F | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9881 | 1 | 613 |
| 8a45-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.987 | 1 | 614 |
| 8a45-assembly1.cif.gz_F | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9868 | 1 | 614 |
| 8a5k-assembly1.cif.gz_F | structural analysis of 1-deoxy-d-xylulose 5-phosphate synthase from pseudomonas aeruginosa and klebsiella pneumoniae reveals conformational changes upon cofactor binding | 0.9867 | 1 | 614 |
| 8a5k-assembly1.cif.gz_A | structural analysis of 1-deoxy-d-xylulose 5-phosphate synthase from pseudomonas aeruginosa and klebsiella pneumoniae reveals conformational changes upon cofactor binding | 0.9865 | 1 | 614 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2o1sC03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.987 | 490 | 613 | 3.40.50.920 |
| af_O50408_212_377_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9843 | 314 | 474 | 3.40.50.970 |
| af_A0A0R0G7H4_1_143_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9792 | 341 | 482 | 3.40.50.970 |
| af_I1M1A4_399_568_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9791 | 314 | 481 | 3.40.50.970 |
| af_A0A0R0G7H4_1_143_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9658 | 341 | 482 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A365VNH1-F1-model_v4 | deleted | 0.9923 | 527 | 613 |
|
| AF-A0A257N978-F1-model_v4 | 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) | 0.9892 | 420 | 612 |
GO:0005829
GO:0008661 GO:0009228 GO:0016114 GO:0019288 GO:0046872 GO:0052865 |
| AF-A0A482S328-F1-model_v4 | deleted | 0.9882 | 2 | 171 |
|
| AF-A0A7X4XMH6-F1-model_v4 | 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) | 0.9873 | 298 | 612 |
GO:0005829
GO:0008661 GO:0009228 GO:0016114 GO:0019288 GO:0046872 GO:0052865 |
| AF-A0A377RN01-F1-model_v4 | 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) | 0.9869 | 5 | 171 |
GO:0005829
GO:0008661 GO:0016114 GO:0019288 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar