F472297

General Info

Members Datasets Scaffolds Average Seq Length
647 296 629 625

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10000968|Ga0316576_100009683
Length 661
Sequence MLNMPDRPSSFSGPTLHRHPLLASIDSPADLRALPEHQLAAVANELRSFLVDTVAQTGGHLAAGLGVVELTIGLHYVFDTPEDRLIWDVGHQAYPHKILTGRRERMRTLRQQDGLSGFPKRSESEYDCFGVGHSSTSISAALGMSLAAMQRGERRNVVAVIGDGALSAGMAFEALNHAGSMDVDLTVILNDNEMSISPPVGAITNHLARLLSGKFYTTMREGSKSALRGMPQLRHLVGRWEEHMKGMLMPSTLFEELGFNYIGPIDGHDVHAVVKTLRNIKEMCGQRFLHVVTQKGHGYEPAEGHPVTYHGVTPFDRRTGELRKGGSKGPTYTQVFGGWLCDTAEKDPRLVGITPAMCEGSGLTVFSKRFPERYYDVGIAEQHAVTLAAGMACEGLKPVVAIYSSFLQRAYDQLVHDVCLQDLDVTFAVDRGGLVGADGPTHAGSFDLSFGRPLPRLVIMAPSDENECRRMLRTAYEYPGPAMVRYPRGSGLGVAIDPDAPVLPIGCGEVVRRGRQVALLAFGSMVAPALAAAEGLGATVANMRFVKPLDGALVRELAEGHELLVTIEENSIAGGAGSGVAEWLSSQGLTLPCVHLGLPDRYVEHAEHAQQLAACGLDAPGILTSVRDALSRCFPDRASPGAATTSPAEVMQERHQGIGAA

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
7 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
8 2831426010 Nostoc sp. 106C Isolate Unclassified
9 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
10 2849660919 Nostoc sp. T09 Isolate Unclassified
11 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
12 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
13 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
14 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
15 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
16 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
17 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
186 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
187 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
194 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
195 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
196 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
210 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
219 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
226 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
227 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
228 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
229 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
230 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
231 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
232 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
233 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
234 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
235 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
236 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
265 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
266 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
269 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
270 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
271 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
279 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
285 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
286 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
287 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
288 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
289 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
290 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
291 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
292 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
296 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.83
Metatranscriptomes 1.39
Isolates 2.78

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 2.47
Nodule 0
Rhizoplane 1.55
Rhizosphere 89.49
Stem 0
Stem Tuber 0
Unclassified 6.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10015059 3300003215 Bacteria 3173
2 Ga0065165_1000967 3300005262 Bacteria 36011
3 Ga0070658_10034906 3300005327 Bacteria 4048
4 Ga0070676_10000669 3300005328 Bacteria 16700
5 Ga0070676_10001034 3300005328 Bacteria 13850
6 Ga0070676_10023839 3300005328 Bacteria 3442
7 Ga0070676_10055009 3300005328 Bacteria 2347
8 Ga0070683_100001269 3300005329 Bacteria 19223
9 Ga0070683_100017092 3300005329 Bacteria 6404
10 Ga0070683_100056513 3300005329 Bacteria 3645
11 Ga0070670_100025573 3300005331 Bacteria 5078
12 Ga0070670_100036095 3300005331 Bacteria 4255
13 Ga0070677_10000567 3300005333 Bacteria 12596
14 Ga0070677_10000838 3300005333 Bacteria 10102
15 Ga0070677_10003738 3300005333 Bacteria 4924
16 Ga0068869_100003429 3300005334 Bacteria 9692
17 Ga0070666_10001457 3300005335 Bacteria 14355
18 Ga0070682_100048817 3300005337 Bacteria 2637
19 Ga0068868_100007835 3300005338 Bacteria 7624
20 Ga0068868_100019673 3300005338 Bacteria 5063
21 Ga0068868_100068650 3300005338 Bacteria 2823
22 Ga0070660_100001725 3300005339 Bacteria 14990
23 Ga0070660_100026101 3300005339 Bacteria 4348
24 Ga0070660_100083946 3300005339 Bacteria 2503
25 Ga0070689_100000557 3300005340 Bacteria 22315
26 Ga0070689_100006704 3300005340 Bacteria 8003
27 Ga0070689_100047646 3300005340 Bacteria 3304
28 Ga0070687_100002704 3300005343 Bacteria 6710
29 Ga0070661_100001819 3300005344 Bacteria 14786
30 Ga0070661_100003561 3300005344 Bacteria 10721
31 Ga0070661_100009780 3300005344 Bacteria 6651
32 Ga0070668_100001724 3300005347 Bacteria 15891
33 Ga0070668_100003798 3300005347 Bacteria 11164
34 Ga0070668_100007290 3300005347 Bacteria 8205
35 Ga0070668_100009366 3300005347 Bacteria 7265
36 Ga0070668_100056258 3300005347 Bacteria 3037
37 Ga0070668_100061786 3300005347 Bacteria 2903
38 Ga0070668_100099464 3300005347 Bacteria 2303
39 Ga0070669_100001481 3300005353 Bacteria 16988
40 Ga0070669_100011126 3300005353 Bacteria 6386
41 Ga0070669_100018241 3300005353 Bacteria 5014
42 Ga0070675_100003903 3300005354 Bacteria 11300
43 Ga0070675_100009408 3300005354 Bacteria 7603
44 Ga0070675_100009969 3300005354 Bacteria 7410
45 Ga0070675_100020283 3300005354 Bacteria 5304
46 Ga0070675_100026322 3300005354 Bacteria 4669
47 Ga0070675_100054286 3300005354 Bacteria 3296
48 Ga0070675_100092379 3300005354 Bacteria 2537
49 Ga0070671_100000593 3300005355 Bacteria 25873
50 Ga0070671_100003441 3300005355 Bacteria 12354
51 Ga0070671_100005776 3300005355 Bacteria 9855
52 Ga0070671_100007129 3300005355 Bacteria 8931
53 Ga0070671_100010109 3300005355 Bacteria 7579
54 Ga0070671_100012314 3300005355 Bacteria 6887
55 Ga0070671_100031073 3300005355 Bacteria 4409
56 Ga0070671_100049905 3300005355 Bacteria 3481
57 Ga0070674_100001635 3300005356 Bacteria 12065
58 Ga0070674_100017988 3300005356 Bacteria 4459
59 Ga0070673_100000080 3300005364 Bacteria 41486
60 Ga0070673_100001988 3300005364 Bacteria 12328
61 Ga0070673_100014064 3300005364 Bacteria 5559
62 Ga0070673_100104679 3300005364 Bacteria 2337
63 Ga0070659_100001068 3300005366 Bacteria 20045
64 Ga0070659_100083126 3300005366 Bacteria 2559
65 Ga0070667_100003598 3300005367 Bacteria 13182
66 Ga0070667_100006553 3300005367 Bacteria 9678
67 Ga0070667_100007287 3300005367 Bacteria 9195
68 Ga0070667_100007540 3300005367 Bacteria 9025
69 Ga0070667_100014815 3300005367 Bacteria 6441
70 Ga0070667_100034829 3300005367 Bacteria 4215
71 Ga0070667_100133459 3300005367 Bacteria 2169
72 Ga0070709_10061892 3300005434 Bacteria 2384
73 Ga0070714_100011920 3300005435 Bacteria 6913
74 Ga0070714_100047637 3300005435 Bacteria 3642
75 Ga0070713_100000049 3300005436 Bacteria 74072
76 Ga0070713_100012791 3300005436 Bacteria 6169
77 Ga0070705_100017562 3300005440 Bacteria 3736
78 Ga0070705_100022441 3300005440 Bacteria 3373
79 Ga0070705_100033576 3300005440 Bacteria 2861
80 Ga0070694_100017694 3300005444 Bacteria 4505
81 Ga0070708_100000012 3300005445 Bacteria 133550
82 Ga0070663_100058747 3300005455 Bacteria 2763
83 Ga0070678_100002115 3300005456 Bacteria 10765
84 Ga0070678_100005691 3300005456 Bacteria 7240
85 Ga0070678_100009819 3300005456 Bacteria 5819
86 Ga0070678_100023815 3300005456 Bacteria 4087
87 Ga0070678_100049351 3300005456 Bacteria 3037
88 Ga0070678_100079212 3300005456 Bacteria 2484
89 Ga0070662_100001613 3300005457 Bacteria 13924
90 Ga0070662_100014178 3300005457 Bacteria 5318
91 Ga0070662_100031453 3300005457 Bacteria 3724
92 Ga0070662_100044204 3300005457 Bacteria 3190
93 Ga0070681_10002261 3300005458 Bacteria 17589
94 Ga0068867_100001683 3300005459 Bacteria 15420
95 Ga0068867_100002555 3300005459 Bacteria 12829
96 Ga0068867_100007906 3300005459 Bacteria 7514
97 Ga0070685_10010723 3300005466 Bacteria 4771
98 Ga0070685_10012286 3300005466 Bacteria 4496
99 Ga0070707_100049687 3300005468 Bacteria 4020
100 Ga0070699_100004966 3300005518 Bacteria 11730
101 Ga0070697_100011619 3300005536 Bacteria 6882
102 Ga0070697_100036887 3300005536 Bacteria 3948
103 Ga0068853_100000801 3300005539 Bacteria 21847
104 Ga0068853_100013983 3300005539 Bacteria 6565
105 Ga0070672_100001862 3300005543 Bacteria 13173
106 Ga0070672_100002100 3300005543 Bacteria 12567
107 Ga0070672_100002116 3300005543 Bacteria 12536
108 Ga0070672_100002490 3300005543 Bacteria 11720
109 Ga0070672_100054868 3300005543 Bacteria 3120
110 Ga0070686_100005776 3300005544 Bacteria 6858
111 Ga0070686_100023233 3300005544 Bacteria 3703
112 Ga0070696_100022229 3300005546 Bacteria 4308
113 Ga0070693_100001090 3300005547 Bacteria 12181
114 Ga0070693_100010495 3300005547 Bacteria 4644
115 Ga0070665_100000769 3300005548 Bacteria 42290
116 Ga0070665_100005673 3300005548 Bacteria 12825
117 Ga0070665_100006695 3300005548 Bacteria 11713
118 Ga0070665_100015080 3300005548 Bacteria 7759
119 Ga0070665_100035159 3300005548 Bacteria 5037
120 Ga0070665_100090774 3300005548 Bacteria 3061
121 Ga0070704_100010773 3300005549 Bacteria 5574
122 Ga0070704_100094465 3300005549 Bacteria 2237
123 Ga0068855_100004503 3300005563 Bacteria 17022
124 Ga0068855_100064429 3300005563 Bacteria 4274
125 Ga0068855_100074434 3300005563 Bacteria 3944
126 Ga0068855_100111679 3300005563 Bacteria 3138
127 Ga0070664_100000855 3300005564 Bacteria 23547
128 Ga0070664_100002684 3300005564 Bacteria 14358
129 Ga0070664_100016106 3300005564 Bacteria 6128
130 Ga0070664_100056597 3300005564 Bacteria 3332
131 Ga0070664_100139631 3300005564 Bacteria 2133
132 Ga0068854_100007266 3300005578 Bacteria 7073
133 Ga0068854_100014053 3300005578 Bacteria 5270
134 Ga0068854_100029505 3300005578 Bacteria 3798
135 Ga0068856_100000125 3300005614 Bacteria 77301
136 Ga0068856_100003705 3300005614 Bacteria 15335
137 Ga0070702_100001358 3300005615 Bacteria 9970
138 Ga0070702_100019107 3300005615 Bacteria 3566
139 Ga0070702_100022379 3300005615 Bacteria 3339
140 Ga0068852_100083762 3300005616 Bacteria 2836
141 Ga0068852_100091280 3300005616 Bacteria 2725
142 Ga0068859_100015900 3300005617 Bacteria 7563
143 Ga0068859_100019851 3300005617 Bacteria 6746
144 Ga0068859_100022664 3300005617 Bacteria 6296
145 Ga0068864_100002543 3300005618 Bacteria 15058
146 Ga0068864_100017016 3300005618 Bacteria 6059
147 Ga0068864_100021775 3300005618 Bacteria 5370
148 Ga0068864_100046626 3300005618 Bacteria 3719
149 Ga0068866_10001951 3300005718 Bacteria 8595
150 Ga0068861_100000502 3300005719 Bacteria 22776
151 Ga0068861_100000511 3300005719 Bacteria 22624
152 Ga0068861_100000559 3300005719 Bacteria 22056
153 Ga0068861_100069869 3300005719 Bacteria 2718
154 Ga0068861_100086813 3300005719 Bacteria 2460
155 Ga0068851_10000160 3300005834 Bacteria 35442
156 Ga0068851_10008106 3300005834 Bacteria 4847
157 Ga0068870_10013406 3300005840 Bacteria 3850
158 Ga0068863_100012466 3300005841 Bacteria 8206
159 Ga0068863_100032091 3300005841 Bacteria 5008
160 Ga0068858_100011298 3300005842 Bacteria 8438
161 Ga0068858_100017415 3300005842 Bacteria 6739
162 Ga0068858_100026879 3300005842 Bacteria 5345
163 Ga0068858_100063456 3300005842 Bacteria 3419
164 Ga0068860_100006234 3300005843 Bacteria 11984
165 Ga0068860_100006790 3300005843 Bacteria 11470
166 Ga0068860_100015014 3300005843 Bacteria 7569
167 Ga0068860_100018470 3300005843 Bacteria 6782
168 Ga0068860_100054494 3300005843 Bacteria 3801
169 Ga0068862_100004088 3300005844 Bacteria 12372
170 Ga0068862_100009782 3300005844 Bacteria 7926
171 Ga0068862_100013173 3300005844 Bacteria 6840
172 Ga0068862_100014504 3300005844 Bacteria 6540
173 Ga0081455_10001787 3300005937 Bacteria 25984
174 Ga0070716_100014257 3300006173 Bacteria 4070
175 Ga0070712_100020705 3300006175 Bacteria 4306
176 Ga0075366_10001852 3300006195 Bacteria 10665
177 Ga0097621_100004956 3300006237 Bacteria 9334
178 Ga0097621_100005297 3300006237 Bacteria 9084
179 Ga0097621_100016840 3300006237 Bacteria 5538
180 Ga0097621_100049946 3300006237 Bacteria 3400
181 Ga0075370_10019906 3300006353 Bacteria 3658
182 Ga0068871_100008985 3300006358 Bacteria 7215
183 Ga0068871_100038937 3300006358 Bacteria 3801
184 Ga0068871_100088568 3300006358 Bacteria 2575
185 Ga0075428_100001689 3300006844 Bacteria 23548
186 Ga0075428_100001774 3300006844 Bacteria 23035
187 Ga0075428_100002700 3300006844 Bacteria 19312
188 Ga0075428_100035286 3300006844 Bacteria 5513
189 Ga0075428_100176831 3300006844 Bacteria 2311
190 Ga0075430_100000749 3300006846 Bacteria 24969
191 Ga0075430_100010346 3300006846 Bacteria 7899
192 Ga0075430_100090366 3300006846 Bacteria 2562
193 Ga0075431_100000091 3300006847 Bacteria 55827
194 Ga0075431_100011736 3300006847 Bacteria 8840
195 Ga0075434_100000391 3300006871 Bacteria 32055
196 Ga0075429_100000742 3300006880 Bacteria 25591
197 Ga0075429_100043811 3300006880 Bacteria 3893
198 Ga0068865_100010605 3300006881 Bacteria 5743
199 Ga0068865_100019608 3300006881 Bacteria 4378
200 Ga0068865_100022421 3300006881 Bacteria 4119
201 Ga0068865_100106120 3300006881 Bacteria 2065
202 Ga0075436_100010289 3300006914 Bacteria 6404
203 Ga0097620_100015901 3300006931 Bacteria 7563
204 Ga0097620_100019851 3300006931 Bacteria 6746
205 Ga0097620_100022664 3300006931 Bacteria 6296
206 Ga0075435_100006842 3300007076 Bacteria 8090
207 Ga0099795_10000016 3300007788 Bacteria 63930
208 Ga0105240_10009479 3300009093 Bacteria 13784
209 Ga0105240_10052541 3300009093 Bacteria 5122
210 Ga0111539_10000486 3300009094 Bacteria 50337
211 Ga0111539_10005451 3300009094 Bacteria 16460
212 Ga0111539_10072061 3300009094 Bacteria 4075
213 Ga0105245_10019608 3300009098 Bacteria 5925
214 Ga0105245_10029850 3300009098 Bacteria 4820
215 Ga0114129_10000484 3300009147 Bacteria 48049
216 Ga0114129_10013411 3300009147 Bacteria 11679
217 Ga0105241_10004734 3300009174 Bacteria 10031
218 Ga0105241_10026924 3300009174 Bacteria 4280
219 Ga0105242_10035475 3300009176 Bacteria 4000
220 Ga0105242_10107307 3300009176 Bacteria 2375
221 Ga0105248_10002830 3300009177 Bacteria 19252
222 Ga0105248_10048166 3300009177 Bacteria 4780
223 Ga0105248_10048405 3300009177 Bacteria 4769
224 Ga0105238_10016470 3300009551 Bacteria 7483
225 Ga0105249_10006904 3300009553 Bacteria 9897
226 Ga0105249_10028407 3300009553 Bacteria 5048
227 Ga0099796_10000003 3300010159 Bacteria 81717
228 Ga0105239_10008175 3300010375 Bacteria 11935
229 Ga0157373_10000833 3300013100 Bacteria 23948
230 Ga0157373_10006811 3300013100 Bacteria 8512
231 Ga0157373_10053654 3300013100 Bacteria 2866
232 Ga0157371_10002450 3300013102 Bacteria 17681
233 Ga0157371_10031715 3300013102 Bacteria 3807
234 Ga0157370_10002271 3300013104 Bacteria 23325
235 Ga0157370_10003286 3300013104 Bacteria 19065
236 Ga0157369_10004230 3300013105 Bacteria 17004
237 Ga0157369_10097566 3300013105 Bacteria 3135
238 Ga0157369_10136427 3300013105 Bacteria 2598
239 Ga0157374_10052465 3300013296 Bacteria 3798
240 Ga0157374_10075254 3300013296 Bacteria 3191
241 Ga0157374_10153685 3300013296 Bacteria 2239
242 Ga0157378_10005252 3300013297 Bacteria 11376
243 Ga0157378_10005800 3300013297 Bacteria 10821
244 Ga0157378_10009642 3300013297 Bacteria 8406
245 Ga0163162_10000874 3300013306 Bacteria 28091
246 Ga0163162_10013843 3300013306 Bacteria 7880
247 Ga0163162_10020412 3300013306 Bacteria 6510
248 Ga0163162_10025680 3300013306 Bacteria 5824
249 Ga0157372_10010634 3300013307 Bacteria 9793
250 Ga0157375_10004266 3300013308 Bacteria 12398
251 Ga0163163_10001444 3300014325 Bacteria 20077
252 Ga0163163_10010745 3300014325 Bacteria 8257
253 Ga0163163_10038021 3300014325 Bacteria 4686
254 Ga0163163_10039604 3300014325 Bacteria 4600
255 Ga0163163_10132838 3300014325 Bacteria 2529
256 Ga0157380_10005809 3300014326 Bacteria 8637
257 Ga0157380_10015362 3300014326 Bacteria 5627
258 Ga0157380_10058304 3300014326 Bacteria 3077
259 Ga0157377_10004789 3300014745 Bacteria 6275
260 Ga0157377_10056704 3300014745 Bacteria 2226
261 Ga0157379_10004023 3300014968 Bacteria 12525
262 Ga0157379_10009639 3300014968 Bacteria 8407
263 Ga0157379_10016262 3300014968 Bacteria 6546
264 Ga0157379_10017483 3300014968 Bacteria 6313
265 Ga0157376_10004890 3300014969 Bacteria 9337
266 Ga0157376_10005676 3300014969 Bacteria 8739
267 Ga0157376_10024290 3300014969 Bacteria 4756
268 Ga0157376_10035057 3300014969 Bacteria 4056
269 Ga0163161_10004806 3300017792 Bacteria 9411
270 Ga0163161_10061132 3300017792 Bacteria 2742
271 Ga0209758_1000146 3300025297 Bacteria 169246
272 Ga0209050_1000980 3300025298 Bacteria 36398
273 Ga0207697_10000114 3300025315 Bacteria 37714
274 Ga0207656_10007034 3300025321 Bacteria 4083
275 Ga0207656_10011601 3300025321 Bacteria 3334
276 Ga0207682_10000858 3300025893 Bacteria 14097
277 Ga0207682_10008312 3300025893 Bacteria 4106
278 Ga0207682_10009031 3300025893 Bacteria 3939
279 Ga0207642_10006674 3300025899 Bacteria 3852
280 Ga0207688_10002342 3300025901 Bacteria 10177
281 Ga0207680_10002593 3300025903 Bacteria 8431
282 Ga0207680_10027865 3300025903 Bacteria 3153
283 Ga0207645_10001112 3300025907 Bacteria 22233
284 Ga0207645_10002453 3300025907 Bacteria 14596
285 Ga0207645_10015746 3300025907 Bacteria 5014
286 Ga0207645_10032720 3300025907 Bacteria 3343
287 Ga0207643_10005318 3300025908 Bacteria 6887
288 Ga0207643_10009326 3300025908 Bacteria 5274
289 Ga0207643_10014470 3300025908 Bacteria 4287
290 Ga0207643_10049520 3300025908 Bacteria 2381
291 Ga0207684_10082656 3300025910 Bacteria 2735
292 Ga0207707_10046708 3300025912 Bacteria 3772
293 Ga0207695_10079514 3300025913 Bacteria 3323
294 Ga0207663_10014918 3300025916 Bacteria 4271
295 Ga0207660_10010375 3300025917 Bacteria 6044
296 Ga0207660_10019006 3300025917 Bacteria 4590
297 Ga0207662_10009113 3300025918 Bacteria 5454
298 Ga0207657_10000193 3300025919 Bacteria 63264
299 Ga0207657_10001407 3300025919 Bacteria 25663
300 Ga0207657_10024634 3300025919 Bacteria 5566
301 Ga0207649_10024324 3300025920 Bacteria 3519
302 Ga0207649_10033316 3300025920 Bacteria 3077
303 Ga0207681_10006104 3300025923 Bacteria 7389
304 Ga0207650_10002803 3300025925 Bacteria 12028
305 Ga0207650_10058573 3300025925 Bacteria 2868
306 Ga0207659_10001621 3300025926 Bacteria 13334
307 Ga0207659_10002324 3300025926 Bacteria 11326
308 Ga0207659_10004740 3300025926 Bacteria 8247
309 Ga0207659_10031686 3300025926 Bacteria 3623
310 Ga0207687_10009320 3300025927 Bacteria 6421
311 Ga0207687_10087385 3300025927 Bacteria 2265
312 Ga0207700_10000429 3300025928 Bacteria 24686
313 Ga0207664_10001005 3300025929 Bacteria 18899
314 Ga0207644_10003348 3300025931 Bacteria 10340
315 Ga0207644_10004529 3300025931 Bacteria 9028
316 Ga0207644_10012407 3300025931 Bacteria 5659
317 Ga0207690_10003798 3300025932 Bacteria 8940
318 Ga0207706_10000133 3300025933 Bacteria 80935
319 Ga0207706_10002930 3300025933 Bacteria 16489
320 Ga0207706_10015833 3300025933 Bacteria 6819
321 Ga0207706_10019927 3300025933 Bacteria 6028
322 Ga0207686_10001096 3300025934 Bacteria 15845
323 Ga0207686_10074494 3300025934 Bacteria 2194
324 Ga0207670_10004746 3300025936 Bacteria 7370
325 Ga0207670_10010751 3300025936 Bacteria 5284
326 Ga0207670_10014088 3300025936 Bacteria 4735
327 Ga0207669_10037626 3300025937 Bacteria 2778
328 Ga0207704_10003876 3300025938 Bacteria 6799
329 Ga0207704_10017552 3300025938 Bacteria 3714
330 Ga0207665_10014310 3300025939 Bacteria 5224
331 Ga0207691_10000379 3300025940 Bacteria 44711
332 Ga0207691_10000560 3300025940 Bacteria 37165
333 Ga0207691_10002611 3300025940 Bacteria 17592
334 Ga0207691_10003982 3300025940 Bacteria 14348
335 Ga0207691_10008726 3300025940 Bacteria 9724
336 Ga0207691_10012018 3300025940 Bacteria 8304
337 Ga0207691_10045792 3300025940 Bacteria 4021
338 Ga0207711_10128161 3300025941 Bacteria 2272
339 Ga0207689_10000354 3300025942 Bacteria 42996
340 Ga0207689_10004023 3300025942 Bacteria 13366
341 Ga0207689_10010086 3300025942 Bacteria 8142
342 Ga0207689_10011981 3300025942 Bacteria 7433
343 Ga0207689_10028334 3300025942 Bacteria 4685
344 Ga0207689_10069006 3300025942 Bacteria 2905
345 Ga0207661_10009925 3300025944 Bacteria 6837
346 Ga0207661_10012689 3300025944 Bacteria 6134
347 Ga0207679_10002124 3300025945 Bacteria 12288
348 Ga0207679_10009654 3300025945 Bacteria 6186
349 Ga0207679_10012210 3300025945 Bacteria 5595
350 Ga0207667_10001411 3300025949 Bacteria 30087
351 Ga0207667_10004399 3300025949 Bacteria 17263
352 Ga0207667_10015930 3300025949 Bacteria 8513
353 Ga0207667_10046061 3300025949 Bacteria 4617
354 Ga0207667_10088662 3300025949 Bacteria 3199
355 Ga0207651_10010732 3300025960 Bacteria 5090
356 Ga0207651_10015080 3300025960 Bacteria 4480
357 Ga0207651_10057921 3300025960 Bacteria 2675
358 Ga0207651_10095514 3300025960 Bacteria 2189
359 Ga0207712_10027415 3300025961 Bacteria 3804
360 Ga0207668_10011613 3300025972 Bacteria 5357
361 Ga0207668_10020947 3300025972 Bacteria 4163
362 Ga0207668_10024395 3300025972 Bacteria 3902
363 Ga0207668_10032458 3300025972 Bacteria 3450
364 Ga0207668_10085674 3300025972 Bacteria 2300
365 Ga0207640_10009097 3300025981 Bacteria 5547
366 Ga0207640_10013089 3300025981 Bacteria 4745
367 Ga0207658_10001175 3300025986 Bacteria 20875
368 Ga0207658_10006148 3300025986 Bacteria 8196
369 Ga0207658_10007614 3300025986 Bacteria 7376
370 Ga0207658_10060887 3300025986 Bacteria 2819
371 Ga0207658_10103885 3300025986 Bacteria 2231
372 Ga0207677_10006771 3300026023 Bacteria 6296
373 Ga0207677_10020735 3300026023 Bacteria 3998
374 Ga0207677_10021813 3300026023 Bacteria 3923
375 Ga0207677_10024802 3300026023 Bacteria 3732
376 Ga0207703_10000804 3300026035 Bacteria 30944
377 Ga0207703_10007993 3300026035 Bacteria 8357
378 Ga0207639_10005169 3300026041 Bacteria 8804
379 Ga0207639_10087966 3300026041 Bacteria 2478
380 Ga0207678_10001121 3300026067 Bacteria 24571
381 Ga0207708_10002496 3300026075 Bacteria 13538
382 Ga0207708_10035340 3300026075 Bacteria 3802
383 Ga0207708_10037070 3300026075 Bacteria 3714
384 Ga0207702_10019447 3300026078 Bacteria 5618
385 Ga0207641_10001267 3300026088 Bacteria 25148
386 Ga0207641_10005488 3300026088 Bacteria 10819
387 Ga0207641_10011486 3300026088 Bacteria 7270
388 Ga0207641_10036242 3300026088 Bacteria 4117
389 Ga0207648_10000715 3300026089 Bacteria 37217
390 Ga0207648_10004748 3300026089 Bacteria 13886
391 Ga0207648_10032259 3300026089 Bacteria 4625
392 Ga0207648_10043921 3300026089 Bacteria 3922
393 Ga0207648_10051635 3300026089 Bacteria 3594
394 Ga0207676_10006273 3300026095 Bacteria 8396
395 Ga0207676_10006901 3300026095 Bacteria 8047
396 Ga0207676_10012267 3300026095 Bacteria 6133
397 Ga0207676_10062421 3300026095 Bacteria 2955
398 Ga0207674_10001508 3300026116 Bacteria 30031
399 Ga0207674_10010085 3300026116 Bacteria 10741
400 Ga0207674_10045963 3300026116 Bacteria 4487
401 Ga0207674_10062571 3300026116 Bacteria 3759
402 Ga0207675_100001230 3300026118 Bacteria 25559
403 Ga0207675_100002626 3300026118 Bacteria 17775
404 Ga0207675_100003866 3300026118 Bacteria 14554
405 Ga0207675_100005405 3300026118 Bacteria 12238
406 Ga0207675_100019191 3300026118 Bacteria 6380
407 Ga0207675_100021444 3300026118 Bacteria 6017
408 Ga0207675_100032655 3300026118 Bacteria 4848
409 Ga0207675_100034845 3300026118 Bacteria 4695
410 Ga0207675_100104940 3300026118 Bacteria 2663
411 Ga0207683_10000219 3300026121 Bacteria 50089
412 Ga0207683_10000835 3300026121 Bacteria 28207
413 Ga0207683_10001087 3300026121 Bacteria 24715
414 Ga0207683_10003105 3300026121 Bacteria 14515
415 Ga0207683_10004720 3300026121 Bacteria 11743
416 Ga0207683_10007647 3300026121 Bacteria 9254
417 Ga0207683_10050403 3300026121 Bacteria 3646
418 Ga0207683_10052835 3300026121 Bacteria 3561
419 Ga0207698_10001048 3300026142 Bacteria 16094
420 Ga0207698_10058164 3300026142 Bacteria 2995
421 Ga0209179_1000057 3300027512 Bacteria 20795
422 Ga0207428_10002009 3300027907 Bacteria 20590
423 Ga0207428_10002833 3300027907 Bacteria 17208
424 Ga0207428_10028440 3300027907 Bacteria 4645
425 Ga0268266_10020216 3300028379 Bacteria 5676
426 Ga0268266_10026161 3300028379 Bacteria 4965
427 Ga0268266_10034107 3300028379 Bacteria 4327
428 Ga0268266_10153431 3300028379 Bacteria 2078
429 Ga0268265_10002172 3300028380 Bacteria 15171
430 Ga0268265_10004875 3300028380 Bacteria 9248
431 Ga0268264_10006919 3300028381 Bacteria 9517
432 Ga0268264_10012957 3300028381 Bacteria 6856
433 Ga0268264_10015059 3300028381 Bacteria 6344
434 Ga0265334_10001186 3300028573 Bacteria 12763
435 Ga0307515_10000090 3300028794 Bacteria 215043
436 Ga0307515_10000889 3300028794 Bacteria 68865
437 Ga0307515_10126165 3300028794 Bacteria 2857
438 Ga0265330_10001258 3300031235 Bacteria 14845
439 Ga0265332_10001479 3300031238 Bacteria 13111
440 Ga0265329_10001661 3300031242 Bacteria 10655
441 Ga0265327_10024591 3300031251 Bacteria 3532
442 Ga0307513_10013861 3300031456 Bacteria 9881
443 Ga0307513_10050276 3300031456 Bacteria 4508
444 Ga0307509_10000072 3300031507 Bacteria 140566
445 Ga0307509_10005364 3300031507 Bacteria 17877
446 Ga0307408_100007011 3300031548 Bacteria 7451
447 Ga0307408_100010172 3300031548 Bacteria 6206
448 Ga0307508_10000007 3300031616 Bacteria 268359
449 Ga0316579_10011653 3300031691 Bacteria 3742
450 Ga0316576_10000968 3300031727 Bacteria 14735
451 Ga0316576_10011841 3300031727 Bacteria 5736
452 Ga0316576_10026869 3300031727 Bacteria 4042
453 Ga0316576_10076363 3300031727 Bacteria 2479
454 Ga0316578_10000827 3300031728 Bacteria 11549
455 Ga0316578_10024937 3300031728 Bacteria 3358
456 Ga0307516_10000398 3300031730 Bacteria 56825
457 Ga0307405_10004332 3300031731 Bacteria 6689
458 Ga0307405_10019417 3300031731 Bacteria 3774
459 Ga0316577_10002878 3300031733 Bacteria 8602
460 Ga0307413_10000277 3300031824 Bacteria 15683
461 Ga0307413_10000910 3300031824 Bacteria 10480
462 Ga0307413_10014540 3300031824 Bacteria 4002
463 Ga0307410_10003717 3300031852 Bacteria 7725
464 Ga0307410_10005461 3300031852 Bacteria 6734
465 Ga0307406_10001701 3300031901 Bacteria 12094
466 Ga0307406_10003217 3300031901 Bacteria 8889
467 Ga0307407_10002689 3300031903 Bacteria 7047
468 Ga0307412_10035572 3300031911 Bacteria 3183
469 Ga0307409_100000588 3300031995 Bacteria 15873
470 Ga0307409_100004952 3300031995 Bacteria 7583
471 Ga0307409_100025708 3300031995 Bacteria 4136
472 Ga0307416_100022817 3300032002 Bacteria 4527
473 Ga0307416_100029829 3300032002 Bacteria 4082
474 Ga0307414_10028146 3300032004 Bacteria 3641
475 Ga0307411_10004650 3300032005 Bacteria 6613
476 Ga0307415_100003057 3300032126 Bacteria 8442
477 Ga0307415_100017578 3300032126 Bacteria 4292
478 Ga0316580_10003674 3300032139 Bacteria 4388
479 Ga0316593_10001714 3300032168 Bacteria 4953
480 Ga0316593_10002926 3300032168 Bacteria 4149
481 Ga0316593_10018752 3300032168 Bacteria 2131
482 Ga0316592_1000745 3300033524 Bacteria 4824
483 Ga0316592_1001282 3300033524 Bacteria 3991
484 Ga0316586_1000273 3300033527 Bacteria 4597
485 Ga0316587_1002822 3300033529 Bacteria 2369
486 Ga0316596_1002002 3300033541 Bacteria 4279
487 Ga0316596_1002895 3300033541 Bacteria 3715
488 Ga0373923_0001864 3300035111 Bacteria 6270
489 Ga0316574_0010119 3300035398 Bacteria 5312
490 Ga0316574_0010424 3300035398 Bacteria 5253
491 Ga0316574_0020330 3300035398 Bacteria 3929
492 Ga0316574_0053359 3300035398 Bacteria 2523
493 Ga0373927_0026377 3300035695 Bacteria 3797
494 Ga0316582_0026694 3300036647 Bacteria 3479
495 Ga0316584_0000396 3300036712 Bacteria 22652
496 Ga0316584_0021320 3300036712 Bacteria 4708
497 Ga0316584_0026814 3300036712 Bacteria 4237
498 Ga0373925_0049975 3300037068 Bacteria 3118
499 Ga0395899_0098529 3300037312 Bacteria 2112
500 Ga0395900_0012104 3300037418 Bacteria 8815
501 Ga0395900_0084789 3300037418 Bacteria 3256
502 Ga0436364_1334883 3300037853 Bacteria 4161
503 Ga0395901_0033643 3300038443 Bacteria 5293
504 Ga0400484_41940 3300038725 Bacteria 27044
505 Ga0400490_00726 3300038726 Bacteria 6234
506 Ga0400490_60503 3300038726 Bacteria 6717
507 Ga0400491_25235 3300038727 Bacteria 5901
508 Ga0400485_02514 3300038735 Bacteria 5283
509 Ga0400488_47521 3300038741 Bacteria 5089
510 Ga0400486_23219 3300038742 Bacteria 5768
511 Ga0400486_27054 3300038742 Bacteria 4176
512 Ga0400483_010229 3300039062 Bacteria 3460
513 Ga0400483_062114 3300039062 Bacteria 16677
514 Ga0400483_097543 3300039062 Bacteria 4607
515 Ga0400483_241992 3300039062 Bacteria 4984
516 Ga0400483_267281 3300039062 Bacteria 3196
517 Ga0400489_50293 3300039093 Bacteria 5458
518 Ga0400487_35747 3300039110 Bacteria 7300
519 Ga0439443_000740 3300042003 Bacteria 3191
520 Ga0439435_0000630 3300042436 Bacteria 5770
521 Ga0453683_0001668 3300044673 Bacteria 18578
522 Ga0453684_0000114 3300044712 Bacteria 356610
523 Ga0453684_0000316 3300044712 Bacteria 204457
524 Ga0453684_0004641 3300044712 Bacteria 28551
525 Ga0453684_0007378 3300044712 Bacteria 20264
526 Ga0453684_0064017 3300044712 Bacteria 4699
527 Ga0451576_0000128 3300045051 Bacteria 192071
528 Ga0451576_0001681 3300045051 Bacteria 36675
529 Ga0451576_0011629 3300045051 Bacteria 9971
530 Ga0451576_0011665 3300045051 Bacteria 9956
531 Ga0451576_0019403 3300045051 Bacteria 7422
532 Ga0451576_0024433 3300045051 Bacteria 6527
533 Ga0451576_0128366 3300045051 Bacteria 2642
534 Ga0495632_0002939 3300046519 Bacteria 12506
535 Ga0495654_0002047 3300046530 Bacteria 13234
536 Ga0495621_0000820 3300046539 Bacteria 7869
537 Ga0495669_0002648 3300046684 Bacteria 7329
538 Ga0495686_0004579 3300047472 Bacteria 11287
539 Ga0496101_0070880 3300048904 Bacteria 2553
540 Ga0496102_0167515 3300048905 Bacteria 2068
541 Ga0496105_0005362 3300048908 Bacteria 9720
542 Ga0496106_0001570 3300048909 Bacteria 17186
543 Ga0496106_0052453 3300048909 Bacteria 3077
544 Ga0496107_0081130 3300048910 Bacteria 2366
545 Ga0496108_0044597 3300048911 Bacteria 3701
546 Ga0496109_0000601 3300048912 Bacteria 30117
547 Ga0496110_0034147 3300048913 Bacteria 4404
548 Ga0496114_0095154 3300048917 Bacteria 2534
549 Ga0496126_0037486 3300048929 Bacteria 4523
550 Ga0501033_0014643 3300049570 Bacteria 5954
551 Ga0501033_0018722 3300049570 Bacteria 5234
552 Ga0501036_0001716 3300049572 Bacteria 17030
553 Ga0501038_0006982 3300049574 Bacteria 10428
554 Ga0501038_0073747 3300049574 Bacteria 2889
555 Ga0501039_0003439 3300049575 Bacteria 11823
556 Ga0501039_0014801 3300049575 Bacteria 5967
557 Ga0501039_0030938 3300049575 Bacteria 4127
558 Ga0501040_0001049 3300049576 Bacteria 17492
559 Ga0501040_0053539 3300049576 Bacteria 2764
560 Ga0501041_0001962 3300049577 Bacteria 11561
561 Ga0501041_0017807 3300049577 Bacteria 4227
562 Ga0501042_0007861 3300049578 Bacteria 7012
563 Ga0501046_0006823 3300049580 Bacteria 10072
564 Ga0501046_0056197 3300049580 Bacteria 3090
565 Ga0501048_0002611 3300049582 Bacteria 13796
566 Ga0501048_0046369 3300049582 Bacteria 3103
567 Ga0501070_0012854 3300049586 Bacteria 7054
568 Ga0501070_0020472 3300049586 Bacteria 5548
569 Ga0501071_0003792 3300049587 Bacteria 9499
570 Ga0501071_0026106 3300049587 Bacteria 4098
571 Ga0501072_0002996 3300049588 Bacteria 12733
572 Ga0501072_0015981 3300049588 Bacteria 5755
573 Ga0501072_0037294 3300049588 Bacteria 3812
574 Ga0501073_0002745 3300049589 Bacteria 13190
575 Ga0501074_0003284 3300049590 Bacteria 11437
576 Ga0501075_0001026 3300049591 Bacteria 17906
577 Ga0501075_0002537 3300049591 Bacteria 12169
578 Ga0501075_0031098 3300049591 Bacteria 3960
579 Ga0501075_0033905 3300049591 Bacteria 3799
580 Ga0501075_0121677 3300049591 Bacteria 1986
581 Ga0501076_0000185 3300049592 Bacteria 37179
582 Ga0501076_0000823 3300049592 Bacteria 20155
583 Ga0501076_0002196 3300049592 Bacteria 13366
584 Ga0501077_0002232 3300049593 Bacteria 11685
585 Ga0501077_0108165 3300049593 Bacteria 1761
586 Ga0501079_0000163 3300049741 Bacteria 36976
587 Ga0501079_0002265 3300049741 Bacteria 13891
588 Ga0501079_0002741 3300049741 Bacteria 12841
589 Ga0501079_0185183 3300049741 Bacteria 1625
590 Ga0501080_0035819 3300049742 Bacteria 4632
591 Ga0501080_0054341 3300049742 Bacteria 3729
592 Ga0501080_0061130 3300049742 Bacteria 3507
593 Ga0501081_0001515 3300049743 Bacteria 14277
594 Ga0501081_0001676 3300049743 Bacteria 13709
595 Ga0501081_0015342 3300049743 Bacteria 5054
596 Ga0501035_0023915 3300049822 Bacteria 5606
597 Ga0501045_0002002 3300049824 Bacteria 13762
598 Ga0501045_0002996 3300049824 Bacteria 11559
599 nmdc:mga0k408_8866_c1 3300050493 Bacteria 5410
600 nmdc:mga05p37_16088_c1 3300050507 Bacteria 9005
601 nmdc:mga05p37_889_c1 3300050507 Bacteria 33704
602 nmdc:mga09592_128990_c1 3300050508 Bacteria 2175
603 nmdc:mga09592_16436_c1 3300050508 Bacteria 6053
604 nmdc:mga09592_360_c1 3300050508 Bacteria 33201
605 nmdc:mga0qj67_11168_c1 3300050509 Bacteria 6725
606 nmdc:mga06r32_1015_c1 3300050510 Bacteria 25208
607 nmdc:mga06r32_29_c1 3300050510 Bacteria 85620
608 nmdc:mga06r32_9332_c1 3300050510 Bacteria 8847
609 nmdc:mga08y16_1764_c1 3300050511 Bacteria 21920
610 nmdc:mga08y16_6277_c1 3300050511 Bacteria 12462
611 nmdc:mga0n895_2992_c1 3300050512 Bacteria 13414
612 nmdc:mga0rr50_16025_c1 3300050513 Bacteria 4965
613 Ga0500578_0000213 3300053086 Bacteria 71211
614 Ga0500651_0032774 3300053093 Bacteria 3275
615 Ga0500642_0016576 3300053130 Bacteria 2803
616 Ga0500652_000839 3300053131 Bacteria 10178
617 Ga0500655_000856 3300053133 Bacteria 5909
618 Ga0500588_0000119 3300053146 Bacteria 10440
619 Ga0500619_000325 3300053154 Bacteria 9276
620 Ga0500622_0003145 3300053156 Bacteria 11307
621 Ga0500637_0000737 3300053178 Bacteria 13089
622 Ga0501084_0030606 3300054114 Bacteria 4500
623 Ga0501084_0047376 3300054114 Bacteria 3600
624 Ga0501082_0001772 3300060353 Bacteria 18993
625 Ga0501082_0003981 3300060353 Bacteria 12898
626 Ga0501082_0005109 3300060353 Bacteria 11430
627 Ga0501082_0023235 3300060353 Bacteria 5349
628 Ga0530510_0001291 3300061734 Bacteria 16737
629 Ga0530510_0003511 3300061734 Bacteria 10780

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0185183 Ga0501079_0185183_45_1613 509
2 3300039062 Ga0400483_010229 Ga0400483_010229_1771_3378 525
3 3300039062 Ga0400483_097543 Ga0400483_097543_76_1683 525
4 3300049593 Ga0501077_0108165 Ga0501077_0108165_29_1636 532
5 iso_pu_bacteria 2687453129 2687577391 576
6 3300025926 Ga0207659_10031686 Ga0207659_100316863 578
7 3300025972 Ga0207668_10020947 Ga0207668_100209472 578
8 3300005331 Ga0070670_100025573 Ga0070670_1000255734 579
9 3300005347 Ga0070668_100001724 Ga0070668_1000017244 579
10 3300005353 Ga0070669_100011126 Ga0070669_1000111263 579
11 3300005364 Ga0070673_100104679 Ga0070673_1001046791 579
12 3300005367 Ga0070667_100034829 Ga0070667_1000348293 579
13 3300005459 Ga0068867_100007906 Ga0068867_1000079063 579
14 3300005618 Ga0068864_100002543 Ga0068864_1000025433 579
15 3300005719 Ga0068861_100069869 Ga0068861_1000698692 579
16 3300005842 Ga0068858_100026879 Ga0068858_1000268795 579
17 3300005844 Ga0068862_100004088 Ga0068862_1000040886 579
18 3300009177 Ga0105248_10048405 Ga0105248_100484053 579
19 3300014325 Ga0163163_10039604 Ga0163163_100396042 579
20 3300014968 Ga0157379_10017483 Ga0157379_100174832 579
21 3300025908 Ga0207643_10014470 Ga0207643_100144703 579
22 3300025942 Ga0207689_10000354 Ga0207689_1000035414 579
23 3300025986 Ga0207658_10103885 Ga0207658_101038852 579
24 3300026023 Ga0207677_10021813 Ga0207677_100218133 579
25 3300026035 Ga0207703_10000804 Ga0207703_100008043 579
26 3300026089 Ga0207648_10004748 Ga0207648_100047485 579
27 3300026095 Ga0207676_10062421 Ga0207676_100624212 579
28 3300026118 Ga0207675_100003866 Ga0207675_1000038661 579
29 3300028380 Ga0268265_10004875 Ga0268265_100048756 579
30 3300005329 Ga0070683_100017092 Ga0070683_1000170923 580
31 3300005337 Ga0070682_100048817 Ga0070682_1000488172 580
32 3300005344 Ga0070661_100001819 Ga0070661_10000181912 580
33 3300005435 Ga0070714_100047637 Ga0070714_1000476373 580
34 3300005564 Ga0070664_100000855 Ga0070664_10000085521 580
35 3300005578 Ga0068854_100014053 Ga0068854_1000140533 580
36 3300005614 Ga0068856_100003705 Ga0068856_10000370513 580
37 3300009174 Ga0105241_10004734 Ga0105241_100047344 580
38 3300009551 Ga0105238_10016470 Ga0105238_100164703 580
39 3300010375 Ga0105239_10008175 Ga0105239_100081757 580
40 3300013100 Ga0157373_10006811 Ga0157373_100068113 580
41 3300013102 Ga0157371_10031715 Ga0157371_100317153 580
42 3300013104 Ga0157370_10003286 Ga0157370_1000328610 580
43 3300013105 Ga0157369_10136427 Ga0157369_101364272 580
44 3300025913 Ga0207695_10079514 Ga0207695_100795142 580
45 3300025919 Ga0207657_10000193 Ga0207657_1000019328 580
46 3300025920 Ga0207649_10033316 Ga0207649_100333162 580
47 3300025944 Ga0207661_10012689 Ga0207661_100126894 580
48 3300025945 Ga0207679_10012210 Ga0207679_100122102 580
49 3300025949 Ga0207667_10004399 Ga0207667_100043995 580
50 3300025949 Ga0207667_10088662 Ga0207667_100886622 580
51 3300025981 Ga0207640_10013089 Ga0207640_100130893 580
52 3300026116 Ga0207674_10001508 Ga0207674_100015087 580
53 3300048929 Ga0496126_0037486 Ga0496126_0037486_1207_3066 580
54 3300005354 Ga0070675_100026322 Ga0070675_1000263224 581
55 3300005367 Ga0070667_100133459 Ga0070667_1001334591 581
56 3300005457 Ga0070662_100044204 Ga0070662_1000442043 581
57 3300005543 Ga0070672_100054868 Ga0070672_1000548683 581
58 3300025940 Ga0207691_10002611 Ga0207691_100026114 581
59 3300028573 Ga0265334_10001186 Ga0265334_100011868 581
60 3300037312 Ga0395899_0098529 Ga0395899_0098529_153_2042 582
61 3300037418 Ga0395900_0084789 Ga0395900_0084789_1099_2988 582
62 3300038443 Ga0395901_0033643 Ga0395901_0033643_1507_3396 582
63 3300005339 Ga0070660_100083946 Ga0070660_1000839462 587
64 3300005458 Ga0070681_10002261 Ga0070681_100022616 587
65 3300005563 Ga0068855_100111679 Ga0068855_1001116792 587
66 3300005844 Ga0068862_100014504 Ga0068862_1000145042 587
67 3300013100 Ga0157373_10053654 Ga0157373_100536542 587
68 3300013105 Ga0157369_10004230 Ga0157369_1000423014 587
69 3300025912 Ga0207707_10046708 Ga0207707_100467082 587
70 3300025917 Ga0207660_10010375 Ga0207660_100103753 587
71 3300046684 Ga0495669_0002648 Ga0495669_0002648_2278_4164 587
72 3300005563 Ga0068855_100064429 Ga0068855_1000644294 590
73 3300013104 Ga0157370_10002271 Ga0157370_1000227115 590
74 3300025949 Ga0207667_10015930 Ga0207667_100159302 590
75 3300035398 Ga0316574_0053359 Ga0316574_0053359_516_2306 590
76 3300049588 Ga0501072_0015981 Ga0501072_0015981_1124_2905 590
77 3300005355 Ga0070671_100049905 Ga0070671_1000499051 591
78 3300005356 Ga0070674_100001635 Ga0070674_1000016351 591
79 3300013308 Ga0157375_10004266 Ga0157375_100042668 591
80 3300025937 Ga0207669_10037626 Ga0207669_100376261 591
81 3300025940 Ga0207691_10012018 Ga0207691_100120184 591
82 3300035398 Ga0316574_0020330 Ga0316574_0020330_1035_2978 591
83 3300006844 Ga0075428_100001689 Ga0075428_10000168918 592
84 3300006880 Ga0075429_100043811 Ga0075429_1000438113 592
85 3300009094 Ga0111539_10000486 Ga0111539_1000048618 592
86 3300027907 Ga0207428_10002833 Ga0207428_1000283314 592
87 3300050508 nmdc:mga09592_16436_c1 nmdc:mga09592_16436_c1_995_2905 592
88 3300050511 nmdc:mga08y16_6277_c1 nmdc:mga08y16_6277_c1_1392_3302 592
89 3300035398 Ga0316574_0010424 Ga0316574_0010424_1580_3430 596
90 3300006846 Ga0075430_100090366 Ga0075430_1000903662 597
91 3300042003 Ga0439443_000740 Ga0439443_000740_451_2331 598
92 3300042436 Ga0439435_0000630 Ga0439435_0000630_2728_4608 598
93 3300049574 Ga0501038_0073747 Ga0501038_0073747_285_2165 598
94 3300049575 Ga0501039_0014801 Ga0501039_0014801_65_1945 598
95 3300049576 Ga0501040_0053539 Ga0501040_0053539_592_2472 598
96 3300049580 Ga0501046_0056197 Ga0501046_0056197_655_2535 598
97 3300049582 Ga0501048_0046369 Ga0501048_0046369_860_2740 598
98 3300049587 Ga0501071_0026106 Ga0501071_0026106_616_2496 598
99 3300049591 Ga0501075_0031098 Ga0501075_0031098_1098_2978 598
100 3300049592 Ga0501076_0000185 Ga0501076_0000185_32254_34134 598
101 3300049743 Ga0501081_0015342 Ga0501081_0015342_671_2551 598
102 3300060353 Ga0501082_0003981 Ga0501082_0003981_1837_3717 598
103 3300061734 Ga0530510_0001291 Ga0530510_0001291_14701_16581 598
104 3300006871 Ga0075434_100000391 Ga0075434_10000039125 600
105 3300006914 Ga0075436_100010289 Ga0075436_1000102895 600
106 3300037853 Ga0436364_1334883 Ga0436364_1334883_1062_2969 600
107 3300050512 nmdc:mga0n895_2992_c1 nmdc:mga0n895_2992_c1_8248_10146 600
108 3300007076 Ga0075435_100006842 Ga0075435_1000068424 601
109 3300049570 Ga0501033_0014643 Ga0501033_0014643_1244_3136 601
110 3300049572 Ga0501036_0001716 Ga0501036_0001716_10957_12849 601
111 3300049574 Ga0501038_0006982 Ga0501038_0006982_5695_7587 601
112 3300049575 Ga0501039_0003439 Ga0501039_0003439_9830_11722 601
113 3300049576 Ga0501040_0001049 Ga0501040_0001049_11890_13782 601
114 3300049577 Ga0501041_0001962 Ga0501041_0001962_2712_4604 601
115 3300049580 Ga0501046_0006823 Ga0501046_0006823_5878_7770 601
116 3300049582 Ga0501048_0002611 Ga0501048_0002611_9443_11335 601
117 3300049587 Ga0501071_0003792 Ga0501071_0003792_1377_3266 601
118 3300049588 Ga0501072_0002996 Ga0501072_0002996_7132_9024 601
119 3300049591 Ga0501075_0002537 Ga0501075_0002537_6907_8799 601
120 3300049591 Ga0501075_0033905 Ga0501075_0033905_448_2337 601
121 3300049592 Ga0501076_0002196 Ga0501076_0002196_7034_8926 601
122 3300049593 Ga0501077_0002232 Ga0501077_0002232_7332_9224 601
123 3300049741 Ga0501079_0002265 Ga0501079_0002265_2757_4649 601
124 3300049743 Ga0501081_0001515 Ga0501081_0001515_7178_9070 601
125 3300049822 Ga0501035_0023915 Ga0501035_0023915_2693_4585 601
126 3300049824 Ga0501045_0002002 Ga0501045_0002002_4696_6588 601
127 3300050513 nmdc:mga0rr50_16025_c1 nmdc:mga0rr50_16025_c1_1788_3668 601
128 3300060353 Ga0501082_0005109 Ga0501082_0005109_7201_9093 601
129 3300031727 Ga0316576_10011841 Ga0316576_100118415 603
130 3300037418 Ga0395900_0012104 Ga0395900_0012104_1756_3645 604
131 3300005355 Ga0070671_100005776 Ga0070671_1000057764 606
132 3300013297 Ga0157378_10009642 Ga0157378_100096425 606
133 3300025931 Ga0207644_10012407 Ga0207644_100124072 606
134 3300005445 Ga0070708_100000012 Ga0070708_10000001218 607
135 3300035398 Ga0316574_0010119 Ga0316574_0010119_1063_2946 608
136 3300036712 Ga0316584_0021320 Ga0316584_0021320_1005_2888 608
137 3300049586 Ga0501070_0020472 Ga0501070_0020472_784_2670 608
138 3300049742 Ga0501080_0035819 Ga0501080_0035819_1451_3337 608
139 iso_pu_bacteria 2919506607 2919507570 608
140 3300005355 Ga0070671_100012314 Ga0070671_1000123143 609
141 3300005367 Ga0070667_100007287 Ga0070667_1000072877 609
142 3300005367 Ga0070667_100014815 Ga0070667_1000148152 609
143 3300005456 Ga0070678_100005691 Ga0070678_1000056915 609
144 3300005548 Ga0070665_100005673 Ga0070665_1000056732 609
145 3300005843 Ga0068860_100006234 Ga0068860_1000062342 609
146 3300006881 Ga0068865_100022421 Ga0068865_1000224212 609
147 3300009177 Ga0105248_10048166 Ga0105248_100481662 609
148 3300013297 Ga0157378_10005800 Ga0157378_100058009 609
149 3300013306 Ga0163162_10020412 Ga0163162_100204125 609
150 3300014325 Ga0163163_10132838 Ga0163163_101328382 609
151 3300014968 Ga0157379_10009639 Ga0157379_100096392 609
152 3300014969 Ga0157376_10005676 Ga0157376_100056765 609
153 3300025903 Ga0207680_10027865 Ga0207680_100278653 609
154 3300025986 Ga0207658_10006148 Ga0207658_100061483 609
155 3300026121 Ga0207683_10003105 Ga0207683_1000310511 609
156 3300028379 Ga0268266_10153431 Ga0268266_101534311 609
157 3300028381 Ga0268264_10012957 Ga0268264_100129574 609
158 3300032168 Ga0316593_10001714 Ga0316593_100017142 609
159 3300048908 Ga0496105_0005362 Ga0496105_0005362_2758_4695 609
160 3300049591 Ga0501075_0121677 Ga0501075_0121677_78_1958 609
161 iso_pu_bacteria 2916699645 2916700264 609
162 iso_pu_bacteria 2984568884 2984571860 609
163 3300025942 Ga0207689_10069006 Ga0207689_100690062 611
164 3300005548 Ga0070665_100000769 Ga0070665_10000076927 612
165 3300005719 Ga0068861_100086813 Ga0068861_1000868132 612
166 3300006881 Ga0068865_100106120 Ga0068865_1001061201 612
167 3300026118 Ga0207675_100034845 Ga0207675_1000348452 612
168 3300028379 Ga0268266_10020216 Ga0268266_100202165 612
169 3300038727 Ga0400491_25235 Ga0400491_25235_2625_4535 612
170 3300005842 Ga0068858_100011298 Ga0068858_1000112985 613
171 3300045051 Ga0451576_0001681 Ga0451576_0001681_30611_32473 613
172 iso_pu_bacteria 2617270889 2617912194 613
173 iso_pu_bacteria 2831426010 2831426065 613
174 iso_pu_bacteria 2848694841 2848695574 613
175 iso_pu_bacteria 2849660919 2849665753 613
176 iso_pu_bacteria 2886627955 2886628413 613
177 iso_pu_bacteria 2913844669 2913852429 613
178 iso_pu_bacteria 2913912277 2913914529 613
179 iso_pu_bacteria 2913939268 2913946883 613
180 iso_pu_bacteria 642555144 642604389 613
181 3300031507 Ga0307509_10000072 Ga0307509_1000007295 614
182 3300044712 Ga0453684_0004641 Ga0453684_0004641_25390_27261 614
183 3300045051 Ga0451576_0011665 Ga0451576_0011665_6908_8770 614
184 3300006195 Ga0075366_10001852 Ga0075366_100018524 615
185 3300050493 nmdc:mga0k408_8866_c1 nmdc:mga0k408_8866_c1_1435_3336 615
186 3300005328 Ga0070676_10055009 Ga0070676_100550091 616
187 3300005347 Ga0070668_100099464 Ga0070668_1000994642 616
188 3300005436 Ga0070713_100000049 Ga0070713_1000000497 616
189 3300005456 Ga0070678_100023815 Ga0070678_1000238152 616
190 3300017792 Ga0163161_10004806 Ga0163161_100048062 616
191 3300025928 Ga0207700_10000429 Ga0207700_100004295 616
192 3300025934 Ga0207686_10074494 Ga0207686_100744941 616
193 3300025972 Ga0207668_10032458 Ga0207668_100324582 616
194 3300025972 Ga0207668_10085674 Ga0207668_100856741 616
195 3300026089 Ga0207648_10051635 Ga0207648_100516352 616
196 3300026121 Ga0207683_10004720 Ga0207683_1000472011 616
197 3300005328 Ga0070676_10001034 Ga0070676_100010344 617
198 3300005333 Ga0070677_10000567 Ga0070677_1000056712 617
199 3300005335 Ga0070666_10001457 Ga0070666_1000145712 617
200 3300005347 Ga0070668_100003798 Ga0070668_1000037989 617
201 3300005347 Ga0070668_100056258 Ga0070668_1000562582 617
202 3300005354 Ga0070675_100009969 Ga0070675_1000099692 617
203 3300005355 Ga0070671_100003441 Ga0070671_1000034419 617
204 3300005364 Ga0070673_100000080 Ga0070673_10000008016 617
205 3300005367 Ga0070667_100003598 Ga0070667_1000035981 617
206 3300005456 Ga0070678_100079212 Ga0070678_1000792121 617
207 3300005459 Ga0068867_100001683 Ga0068867_10000168312 617
208 3300005539 Ga0068853_100013983 Ga0068853_1000139834 617
209 3300005543 Ga0070672_100001862 Ga0070672_10000186212 617
210 3300005548 Ga0070665_100035159 Ga0070665_1000351595 617
211 3300005616 Ga0068852_100091280 Ga0068852_1000912801 617
212 3300005618 Ga0068864_100017016 Ga0068864_1000170161 617
213 3300005834 Ga0068851_10000160 Ga0068851_100001601 617
214 3300005841 Ga0068863_100012466 Ga0068863_1000124667 617
215 3300005841 Ga0068863_100032091 Ga0068863_1000320915 617
216 3300005843 Ga0068860_100018470 Ga0068860_1000184704 617
217 3300006358 Ga0068871_100008985 Ga0068871_1000089851 617
218 3300006844 Ga0075428_100176831 Ga0075428_1001768311 617
219 3300007788 Ga0099795_10000016 Ga0099795_1000001635 617
220 3300010159 Ga0099796_10000003 Ga0099796_1000000350 617
221 3300013296 Ga0157374_10153685 Ga0157374_101536852 617
222 3300013306 Ga0163162_10013843 Ga0163162_100138435 617
223 3300014968 Ga0157379_10004023 Ga0157379_100040233 617
224 3300017792 Ga0163161_10061132 Ga0163161_100611322 617
225 3300025321 Ga0207656_10007034 Ga0207656_100070343 617
226 3300025893 Ga0207682_10000858 Ga0207682_1000085812 617
227 3300025907 Ga0207645_10001112 Ga0207645_100011121 617
228 3300025926 Ga0207659_10004740 Ga0207659_100047405 617
229 3300025931 Ga0207644_10004529 Ga0207644_100045295 617
230 3300025940 Ga0207691_10000379 Ga0207691_1000037935 617
231 3300025960 Ga0207651_10010732 Ga0207651_100107322 617
232 3300025972 Ga0207668_10011613 Ga0207668_100116131 617
233 3300025986 Ga0207658_10001175 Ga0207658_1000117512 617
234 3300026023 Ga0207677_10006771 Ga0207677_100067715 617
235 3300026088 Ga0207641_10005488 Ga0207641_100054884 617
236 3300026088 Ga0207641_10036242 Ga0207641_100362422 617
237 3300026089 Ga0207648_10043921 Ga0207648_100439211 617
238 3300026095 Ga0207676_10006273 Ga0207676_100062735 617
239 3300026118 Ga0207675_100019191 Ga0207675_1000191915 617
240 3300026118 Ga0207675_100021444 Ga0207675_1000214443 617
241 3300026121 Ga0207683_10001087 Ga0207683_100010871 617
242 3300026142 Ga0207698_10001048 Ga0207698_100010488 617
243 3300027512 Ga0209179_1000057 Ga0209179_100005710 617
244 3300028379 Ga0268266_10026161 Ga0268266_100261611 617
245 3300033524 Ga0316592_1000745 Ga0316592_10007453 617
246 3300033524 Ga0316592_1001282 Ga0316592_10012823 617
247 3300033529 Ga0316587_1002822 Ga0316587_10028222 617
248 3300033541 Ga0316596_1002002 Ga0316596_10020023 617
249 3300035111 Ga0373923_0001864 Ga0373923_0001864_764_2671 617
250 3300035695 Ga0373927_0026377 Ga0373927_0026377_1620_3524 617
251 3300044712 Ga0453684_0000114 Ga0453684_0000114_186294_188165 617
252 3300045051 Ga0451576_0024433 Ga0451576_0024433_3889_5760 617
253 3300053146 Ga0500588_0000119 Ga0500588_0000119_3895_5784 617
254 3300005327 Ga0070658_10034906 Ga0070658_100349063 618
255 3300005328 Ga0070676_10000669 Ga0070676_1000066916 618
256 3300005328 Ga0070676_10023839 Ga0070676_100238391 618
257 3300005329 Ga0070683_100001269 Ga0070683_10000126915 618
258 3300005329 Ga0070683_100056513 Ga0070683_1000565132 618
259 3300005331 Ga0070670_100036095 Ga0070670_1000360952 618
260 3300005338 Ga0068868_100007835 Ga0068868_1000078353 618
261 3300005338 Ga0068868_100019673 Ga0068868_1000196734 618
262 3300005339 Ga0070660_100001725 Ga0070660_10000172513 618
263 3300005339 Ga0070660_100026101 Ga0070660_1000261011 618
264 3300005340 Ga0070689_100047646 Ga0070689_1000476463 618
265 3300005344 Ga0070661_100009780 Ga0070661_1000097805 618
266 3300005347 Ga0070668_100007290 Ga0070668_1000072906 618
267 3300005353 Ga0070669_100001481 Ga0070669_10000148112 618
268 3300005354 Ga0070675_100003903 Ga0070675_1000039036 618
269 3300005355 Ga0070671_100000593 Ga0070671_10000059315 618
270 3300005355 Ga0070671_100007129 Ga0070671_1000071296 618
271 3300005355 Ga0070671_100010109 Ga0070671_1000101097 618
272 3300005355 Ga0070671_100031073 Ga0070671_1000310735 618
273 3300005364 Ga0070673_100014064 Ga0070673_1000140644 618
274 3300005366 Ga0070659_100001068 Ga0070659_10000106814 618
275 3300005367 Ga0070667_100006553 Ga0070667_1000065536 618
276 3300005367 Ga0070667_100007540 Ga0070667_1000075401 618
277 3300005434 Ga0070709_10061892 Ga0070709_100618921 618
278 3300005435 Ga0070714_100011920 Ga0070714_1000119201 618
279 3300005436 Ga0070713_100012791 Ga0070713_1000127914 618
280 3300005440 Ga0070705_100022441 Ga0070705_1000224412 618
281 3300005455 Ga0070663_100058747 Ga0070663_1000587472 618
282 3300005456 Ga0070678_100002115 Ga0070678_1000021151 618
283 3300005456 Ga0070678_100009819 Ga0070678_1000098195 618
284 3300005457 Ga0070662_100001613 Ga0070662_1000016132 618
285 3300005457 Ga0070662_100014178 Ga0070662_1000141784 618
286 3300005459 Ga0068867_100002555 Ga0068867_10000255512 618
287 3300005466 Ga0070685_10012286 Ga0070685_100122862 618
288 3300005468 Ga0070707_100049687 Ga0070707_1000496872 618
289 3300005518 Ga0070699_100004966 Ga0070699_10000496611 618
290 3300005536 Ga0070697_100011619 Ga0070697_1000116194 618
291 3300005536 Ga0070697_100036887 Ga0070697_1000368872 618
292 3300005539 Ga0068853_100000801 Ga0068853_10000080115 618
293 3300005544 Ga0070686_100023233 Ga0070686_1000232332 618
294 3300005546 Ga0070696_100022229 Ga0070696_1000222292 618
295 3300005547 Ga0070693_100001090 Ga0070693_1000010901 618
296 3300005547 Ga0070693_100010495 Ga0070693_1000104952 618
297 3300005548 Ga0070665_100090774 Ga0070665_1000907742 618
298 3300005549 Ga0070704_100010773 Ga0070704_1000107735 618
299 3300005549 Ga0070704_100094465 Ga0070704_1000944651 618
300 3300005563 Ga0068855_100004503 Ga0068855_1000045036 618
301 3300005563 Ga0068855_100074434 Ga0068855_1000744345 618
302 3300005564 Ga0070664_100002684 Ga0070664_1000026846 618
303 3300005564 Ga0070664_100139631 Ga0070664_1001396312 618
304 3300005578 Ga0068854_100007266 Ga0068854_1000072665 618
305 3300005578 Ga0068854_100029505 Ga0068854_1000295052 618
306 3300005614 Ga0068856_100000125 Ga0068856_10000012520 618
307 3300005615 Ga0070702_100001358 Ga0070702_1000013581 618
308 3300005615 Ga0070702_100019107 Ga0070702_1000191072 618
309 3300005616 Ga0068852_100083762 Ga0068852_1000837622 618
310 3300005618 Ga0068864_100046626 Ga0068864_1000466263 618
311 3300005718 Ga0068866_10001951 Ga0068866_100019515 618
312 3300005834 Ga0068851_10008106 Ga0068851_100081066 618
313 3300005843 Ga0068860_100006790 Ga0068860_1000067905 618
314 3300005843 Ga0068860_100054494 Ga0068860_1000544944 618
315 3300006173 Ga0070716_100014257 Ga0070716_1000142573 618
316 3300006175 Ga0070712_100020705 Ga0070712_1000207052 618
317 3300006237 Ga0097621_100049946 Ga0097621_1000499461 618
318 3300006358 Ga0068871_100038937 Ga0068871_1000389372 618
319 3300006881 Ga0068865_100019608 Ga0068865_1000196081 618
320 3300009093 Ga0105240_10052541 Ga0105240_100525414 618
321 3300009098 Ga0105245_10019608 Ga0105245_100196085 618
322 3300009174 Ga0105241_10026924 Ga0105241_100269245 618
323 3300009176 Ga0105242_10035475 Ga0105242_100354753 618
324 3300009176 Ga0105242_10107307 Ga0105242_101073071 618
325 3300009553 Ga0105249_10028407 Ga0105249_100284071 618
326 3300013100 Ga0157373_10000833 Ga0157373_100008339 618
327 3300013102 Ga0157371_10002450 Ga0157371_100024507 618
328 3300013105 Ga0157369_10097566 Ga0157369_100975663 618
329 3300013296 Ga0157374_10052465 Ga0157374_100524655 618
330 3300013297 Ga0157378_10005252 Ga0157378_1000525210 618
331 3300013306 Ga0163162_10025680 Ga0163162_100256802 618
332 3300013307 Ga0157372_10010634 Ga0157372_100106348 618
333 3300014325 Ga0163163_10038021 Ga0163163_100380215 618
334 3300014326 Ga0157380_10058304 Ga0157380_100583042 618
335 3300014745 Ga0157377_10056704 Ga0157377_100567042 618
336 3300014968 Ga0157379_10016262 Ga0157379_100162626 618
337 3300014969 Ga0157376_10024290 Ga0157376_100242902 618
338 3300025315 Ga0207697_10000114 Ga0207697_1000011426 618
339 3300025321 Ga0207656_10011601 Ga0207656_100116012 618
340 3300025899 Ga0207642_10006674 Ga0207642_100066742 618
341 3300025901 Ga0207688_10002342 Ga0207688_100023426 618
342 3300025907 Ga0207645_10015746 Ga0207645_100157462 618
343 3300025907 Ga0207645_10032720 Ga0207645_100327203 618
344 3300025908 Ga0207643_10005318 Ga0207643_100053182 618
345 3300025910 Ga0207684_10082656 Ga0207684_100826562 618
346 3300025917 Ga0207660_10019006 Ga0207660_100190062 618
347 3300025919 Ga0207657_10001407 Ga0207657_1000140711 618
348 3300025919 Ga0207657_10024634 Ga0207657_100246344 618
349 3300025920 Ga0207649_10024324 Ga0207649_100243242 618
350 3300025925 Ga0207650_10002803 Ga0207650_100028032 618
351 3300025925 Ga0207650_10058573 Ga0207650_100585732 618
352 3300025926 Ga0207659_10002324 Ga0207659_100023242 618
353 3300025927 Ga0207687_10009320 Ga0207687_100093205 618
354 3300025929 Ga0207664_10001005 Ga0207664_1000100510 618
355 3300025932 Ga0207690_10003798 Ga0207690_100037984 618
356 3300025933 Ga0207706_10000133 Ga0207706_1000013315 618
357 3300025933 Ga0207706_10002930 Ga0207706_100029308 618
358 3300025933 Ga0207706_10015833 Ga0207706_100158331 618
359 3300025934 Ga0207686_10001096 Ga0207686_100010963 618
360 3300025938 Ga0207704_10017552 Ga0207704_100175521 618
361 3300025939 Ga0207665_10014310 Ga0207665_100143104 618
362 3300025940 Ga0207691_10045792 Ga0207691_100457924 618
363 3300025941 Ga0207711_10128161 Ga0207711_101281611 618
364 3300025942 Ga0207689_10011981 Ga0207689_100119816 618
365 3300025944 Ga0207661_10009925 Ga0207661_100099256 618
366 3300025945 Ga0207679_10002124 Ga0207679_100021246 618
367 3300025949 Ga0207667_10001411 Ga0207667_1000141127 618
368 3300025949 Ga0207667_10046061 Ga0207667_100460611 618
369 3300025981 Ga0207640_10009097 Ga0207640_100090973 618
370 3300026023 Ga0207677_10020735 Ga0207677_100207352 618
371 3300026041 Ga0207639_10005169 Ga0207639_100051694 618
372 3300026041 Ga0207639_10087966 Ga0207639_100879662 618
373 3300026067 Ga0207678_10001121 Ga0207678_1000112125 618
374 3300026075 Ga0207708_10002496 Ga0207708_1000249612 618
375 3300026078 Ga0207702_10019447 Ga0207702_100194475 618
376 3300026095 Ga0207676_10012267 Ga0207676_100122671 618
377 3300026116 Ga0207674_10010085 Ga0207674_100100856 618
378 3300026116 Ga0207674_10045963 Ga0207674_100459634 618
379 3300026118 Ga0207675_100104940 Ga0207675_1001049402 618
380 3300026121 Ga0207683_10000835 Ga0207683_100008352 618
381 3300026142 Ga0207698_10058164 Ga0207698_100581641 618
382 3300028381 Ga0268264_10015059 Ga0268264_100150595 618
383 3300031251 Ga0265327_10024591 Ga0265327_100245911 618
384 3300031548 Ga0307408_100007011 Ga0307408_1000070113 618
385 3300031691 Ga0316579_10011653 Ga0316579_100116533 618
386 3300031731 Ga0307405_10004332 Ga0307405_100043325 618
387 3300031824 Ga0307413_10000277 Ga0307413_100002779 618
388 3300031901 Ga0307406_10001701 Ga0307406_100017013 618
389 3300031903 Ga0307407_10002689 Ga0307407_100026896 618
390 3300031995 Ga0307409_100004952 Ga0307409_1000049525 618
391 3300032004 Ga0307414_10028146 Ga0307414_100281463 618
392 3300032139 Ga0316580_10003674 Ga0316580_100036743 618
393 3300032168 Ga0316593_10002926 Ga0316593_100029262 618
394 3300036712 Ga0316584_0026814 Ga0316584_0026814_1958_3895 618
395 3300037068 Ga0373925_0049975 Ga0373925_0049975_453_2342 618
396 3300039062 Ga0400483_267281 Ga0400483_267281_463_2382 618
397 3300044712 Ga0453684_0000316 Ga0453684_0000316_141167_143071 618
398 3300044712 Ga0453684_0007378 Ga0453684_0007378_12150_14060 618
399 3300045051 Ga0451576_0000128 Ga0451576_0000128_128781_130685 618
400 3300045051 Ga0451576_0011629 Ga0451576_0011629_1537_3411 618
401 3300045051 Ga0451576_0128366 Ga0451576_0128366_21_1931 618
402 3300046539 Ga0495621_0000820 Ga0495621_0000820_3482_5371 618
403 3300048904 Ga0496101_0070880 Ga0496101_0070880_172_2112 618
404 3300048909 Ga0496106_0001570 Ga0496106_0001570_2091_3980 618
405 3300048909 Ga0496106_0052453 Ga0496106_0052453_1073_3013 618
406 3300048910 Ga0496107_0081130 Ga0496107_0081130_136_2076 618
407 3300048912 Ga0496109_0000601 Ga0496109_0000601_603_2543 618
408 3300048913 Ga0496110_0034147 Ga0496110_0034147_424_2364 618
409 3300048917 Ga0496114_0095154 Ga0496114_0095154_274_2214 618
410 3300005543 Ga0070672_100002490 Ga0070672_1000024907 619
411 3300005548 Ga0070665_100015080 Ga0070665_1000150806 619
412 3300005617 Ga0068859_100015900 Ga0068859_1000159002 619
413 3300005842 Ga0068858_100017415 Ga0068858_1000174154 619
414 3300006237 Ga0097621_100004956 Ga0097621_1000049563 619
415 3300006881 Ga0068865_100010605 Ga0068865_1000106055 619
416 3300006931 Ga0097620_100015901 Ga0097620_1000159012 619
417 3300013306 Ga0163162_10000874 Ga0163162_1000087418 619
418 3300014969 Ga0157376_10004890 Ga0157376_100048908 619
419 3300025903 Ga0207680_10002593 Ga0207680_100025935 619
420 3300025907 Ga0207645_10002453 Ga0207645_1000245311 619
421 3300025923 Ga0207681_10006104 Ga0207681_100061042 619
422 3300025926 Ga0207659_10001621 Ga0207659_100016218 619
423 3300025931 Ga0207644_10003348 Ga0207644_100033487 619
424 3300025936 Ga0207670_10010751 Ga0207670_100107512 619
425 3300025938 Ga0207704_10003876 Ga0207704_100038765 619
426 3300025940 Ga0207691_10000560 Ga0207691_1000056033 619
427 3300025942 Ga0207689_10004023 Ga0207689_100040237 619
428 3300025960 Ga0207651_10015080 Ga0207651_100150804 619
429 3300025972 Ga0207668_10024395 Ga0207668_100243951 619
430 3300025986 Ga0207658_10007614 Ga0207658_100076144 619
431 3300026023 Ga0207677_10024802 Ga0207677_100248022 619
432 3300026035 Ga0207703_10007993 Ga0207703_100079936 619
433 3300026088 Ga0207641_10001267 Ga0207641_100012676 619
434 3300026089 Ga0207648_10000715 Ga0207648_1000071533 619
435 3300026095 Ga0207676_10006901 Ga0207676_100069015 619
436 3300026121 Ga0207683_10000219 Ga0207683_1000021915 619
437 3300028381 Ga0268264_10006919 Ga0268264_100069199 619
438 3300031235 Ga0265330_10001258 Ga0265330_100012584 619
439 3300031238 Ga0265332_10001479 Ga0265332_100014797 619
440 3300031242 Ga0265329_10001661 Ga0265329_100016614 619
441 3300031548 Ga0307408_100010172 Ga0307408_1000101721 619
442 3300031727 Ga0316576_10076363 Ga0316576_100763631 619
443 3300031728 Ga0316578_10024937 Ga0316578_100249374 619
444 3300031731 Ga0307405_10019417 Ga0307405_100194173 619
445 3300031824 Ga0307413_10014540 Ga0307413_100145403 619
446 3300031852 Ga0307410_10003717 Ga0307410_100037178 619
447 3300031901 Ga0307406_10003217 Ga0307406_100032171 619
448 3300031911 Ga0307412_10035572 Ga0307412_100355722 619
449 3300032002 Ga0307416_100022817 Ga0307416_1000228172 619
450 3300032005 Ga0307411_10004650 Ga0307411_100046501 619
451 3300032126 Ga0307415_100003057 Ga0307415_1000030574 619
452 3300038725 Ga0400484_41940 Ga0400484_41940_23401_25299 619
453 3300038726 Ga0400490_00726 Ga0400490_00726_2831_4729 619
454 3300038726 Ga0400490_60503 Ga0400490_60503_3216_5114 619
455 3300038735 Ga0400485_02514 Ga0400485_02514_2121_4022 619
456 3300038741 Ga0400488_47521 Ga0400488_47521_2122_4023 619
457 3300038742 Ga0400486_23219 Ga0400486_23219_1468_3369 619
458 3300038742 Ga0400486_27054 Ga0400486_27054_1002_2987 619
459 3300039062 Ga0400483_062114 Ga0400483_062114_11939_13837 619
460 3300039062 Ga0400483_241992 Ga0400483_241992_2798_4696 619
461 3300039093 Ga0400489_50293 Ga0400489_50293_1484_3385 619
462 3300039110 Ga0400487_35747 Ga0400487_35747_1589_3487 619
463 3300031727 Ga0316576_10026869 Ga0316576_100268693 620
464 3300033527 Ga0316586_1000273 Ga0316586_10002732 620
465 3300005356 Ga0070674_100017988 Ga0070674_1000179882 621
466 3300026121 Ga0207683_10050403 Ga0207683_100504032 621
467 3300049586 Ga0501070_0012854 Ga0501070_0012854_526_2415 621
468 3300049590 Ga0501074_0003284 Ga0501074_0003284_5011_6900 621
469 3300049742 Ga0501080_0054341 Ga0501080_0054341_917_2806 621
470 3300053133 Ga0500655_000856 Ga0500655_000856_3681_5558 621
471 3300053178 Ga0500637_0000737 Ga0500637_0000737_9387_11270 621
472 3300009093 Ga0105240_10009479 Ga0105240_100094794 622
473 3300009098 Ga0105245_10029850 Ga0105245_100298506 622
474 3300014969 Ga0157376_10035057 Ga0157376_100350572 622
475 3300025927 Ga0207687_10087385 Ga0207687_100873852 622
476 3300025942 Ga0207689_10028334 Ga0207689_100283342 622
477 3300031507 Ga0307509_10005364 Ga0307509_100053648 622
478 3300044673 Ga0453683_0001668 Ga0453683_0001668_14472_16358 622
479 3300046530 Ga0495654_0002047 Ga0495654_0002047_8927_10840 622
480 3300048905 Ga0496102_0167515 Ga0496102_0167515_168_2045 622
481 3300005334 Ga0068869_100003429 Ga0068869_1000034292 623
482 3300005338 Ga0068868_100068650 Ga0068868_1000686502 623
483 3300005340 Ga0070689_100000557 Ga0070689_10000055719 623
484 3300005343 Ga0070687_100002704 Ga0070687_1000027042 623
485 3300005344 Ga0070661_100003561 Ga0070661_10000356111 623
486 3300005347 Ga0070668_100009366 Ga0070668_1000093663 623
487 3300005347 Ga0070668_100061786 Ga0070668_1000617862 623
488 3300005353 Ga0070669_100018241 Ga0070669_1000182413 623
489 3300005354 Ga0070675_100009408 Ga0070675_1000094086 623
490 3300005364 Ga0070673_100001988 Ga0070673_1000019885 623
491 3300005366 Ga0070659_100083126 Ga0070659_1000831262 623
492 3300005440 Ga0070705_100017562 Ga0070705_1000175622 623
493 3300005456 Ga0070678_100049351 Ga0070678_1000493512 623
494 3300005457 Ga0070662_100031453 Ga0070662_1000314533 623
495 3300005466 Ga0070685_10010723 Ga0070685_100107234 623
496 3300005543 Ga0070672_100002116 Ga0070672_1000021163 623
497 3300005544 Ga0070686_100005776 Ga0070686_1000057766 623
498 3300005548 Ga0070665_100006695 Ga0070665_1000066952 623
499 3300005564 Ga0070664_100056597 Ga0070664_1000565972 623
500 3300005617 Ga0068859_100019851 Ga0068859_1000198516 623
501 3300005618 Ga0068864_100021775 Ga0068864_1000217754 623
502 3300005719 Ga0068861_100000559 Ga0068861_10000055917 623
503 3300005840 Ga0068870_10013406 Ga0068870_100134063 623
504 3300005842 Ga0068858_100063456 Ga0068858_1000634562 623
505 3300005844 Ga0068862_100009782 Ga0068862_1000097827 623
506 3300005844 Ga0068862_100013173 Ga0068862_1000131736 623
507 3300006237 Ga0097621_100016840 Ga0097621_1000168402 623
508 3300006844 Ga0075428_100001774 Ga0075428_10000177417 623
509 3300006844 Ga0075428_100002700 Ga0075428_1000027007 623
510 3300006844 Ga0075428_100035286 Ga0075428_1000352863 623
511 3300006846 Ga0075430_100000749 Ga0075430_10000074920 623
512 3300006846 Ga0075430_100010346 Ga0075430_1000103467 623
513 3300006847 Ga0075431_100000091 Ga0075431_10000009118 623
514 3300006847 Ga0075431_100011736 Ga0075431_1000117367 623
515 3300006880 Ga0075429_100000742 Ga0075429_10000074216 623
516 3300006931 Ga0097620_100019851 Ga0097620_1000198516 623
517 3300009094 Ga0111539_10005451 Ga0111539_1000545111 623
518 3300009094 Ga0111539_10072061 Ga0111539_100720613 623
519 3300009147 Ga0114129_10000484 Ga0114129_1000048423 623
520 3300009147 Ga0114129_10013411 Ga0114129_100134116 623
521 3300009177 Ga0105248_10002830 Ga0105248_1000283018 623
522 3300009553 Ga0105249_10006904 Ga0105249_100069048 623
523 3300014325 Ga0163163_10001444 Ga0163163_1000144420 623
524 3300014745 Ga0157377_10004789 Ga0157377_100047897 623
525 3300025908 Ga0207643_10049520 Ga0207643_100495201 623
526 3300025918 Ga0207662_10009113 Ga0207662_100091134 623
527 3300025933 Ga0207706_10019927 Ga0207706_100199275 623
528 3300025936 Ga0207670_10014088 Ga0207670_100140882 623
529 3300025945 Ga0207679_10009654 Ga0207679_100096542 623
530 3300025960 Ga0207651_10057921 Ga0207651_100579212 623
531 3300025961 Ga0207712_10027415 Ga0207712_100274152 623
532 3300025986 Ga0207658_10060887 Ga0207658_100608872 623
533 3300026088 Ga0207641_10011486 Ga0207641_100114867 623
534 3300026089 Ga0207648_10032259 Ga0207648_100322592 623
535 3300026116 Ga0207674_10062571 Ga0207674_100625714 623
536 3300026118 Ga0207675_100001230 Ga0207675_1000012309 623
537 3300026118 Ga0207675_100032655 Ga0207675_1000326553 623
538 3300026121 Ga0207683_10052835 Ga0207683_100528352 623
539 3300027907 Ga0207428_10002009 Ga0207428_100020097 623
540 3300027907 Ga0207428_10028440 Ga0207428_100284403 623
541 3300028379 Ga0268266_10034107 Ga0268266_100341073 623
542 3300028380 Ga0268265_10002172 Ga0268265_100021726 623
543 3300028794 Ga0307515_10126165 Ga0307515_101261652 623
544 3300031456 Ga0307513_10013861 Ga0307513_100138614 623
545 3300031456 Ga0307513_10050276 Ga0307513_100502763 623
546 3300032002 Ga0307416_100029829 Ga0307416_1000298293 623
547 3300045051 Ga0451576_0019403 Ga0451576_0019403_396_2285 623
548 3300048911 Ga0496108_0044597 Ga0496108_0044597_1642_3531 623
549 3300049570 Ga0501033_0018722 Ga0501033_0018722_1113_2993 623
550 3300049575 Ga0501039_0030938 Ga0501039_0030938_1987_3867 623
551 3300049577 Ga0501041_0017807 Ga0501041_0017807_204_2084 623
552 3300049578 Ga0501042_0007861 Ga0501042_0007861_777_2657 623
553 3300049591 Ga0501075_0001026 Ga0501075_0001026_3659_5539 623
554 3300049592 Ga0501076_0000823 Ga0501076_0000823_7764_9644 623
555 3300049741 Ga0501079_0002741 Ga0501079_0002741_3662_5542 623
556 3300049743 Ga0501081_0001676 Ga0501081_0001676_8390_10270 623
557 3300049824 Ga0501045_0002996 Ga0501045_0002996_3666_5546 623
558 3300050507 nmdc:mga05p37_16088_c1 nmdc:mga05p37_16088_c1_3467_5356 623
559 3300050507 nmdc:mga05p37_889_c1 nmdc:mga05p37_889_c1_6880_8769 623
560 3300050508 nmdc:mga09592_128990_c1 nmdc:mga09592_128990_c1_21_1910 623
561 3300050508 nmdc:mga09592_360_c1 nmdc:mga09592_360_c1_12241_14130 623
562 3300050509 nmdc:mga0qj67_11168_c1 nmdc:mga0qj67_11168_c1_3989_5878 623
563 3300050510 nmdc:mga06r32_1015_c1 nmdc:mga06r32_1015_c1_19537_21426 623
564 3300050510 nmdc:mga06r32_29_c1 nmdc:mga06r32_29_c1_49100_50989 623
565 3300050510 nmdc:mga06r32_9332_c1 nmdc:mga06r32_9332_c1_3995_5884 623
566 3300050511 nmdc:mga08y16_1764_c1 nmdc:mga08y16_1764_c1_5884_7773 623
567 3300054114 Ga0501084_0030606 Ga0501084_0030606_729_2609 623
568 3300060353 Ga0501082_0001772 Ga0501082_0001772_5067_6947 623
569 3300061734 Ga0530510_0003511 Ga0530510_0003511_7962_9842 623
570 3300025916 Ga0207663_10014918 Ga0207663_100149182 624
571 iso_pu_bacteria 2585428057 2587724858 624
572 iso_pu_bacteria 2585428058 2587736735 624
573 iso_pu_bacteria 2643221592 2643970217 624
574 iso_pu_bacteria 2643221625 2644142385 624
575 iso_pu_bacteria 2643221648 2644275149 624
576 3300005719 Ga0068861_100000502 Ga0068861_10000050221 625
577 3300005937 Ga0081455_10001787 Ga0081455_1000178714 625
578 3300026118 Ga0207675_100005405 Ga0207675_1000054054 625
579 3300031995 Ga0307409_100000588 Ga0307409_1000005884 625
580 3300032168 Ga0316593_10018752 Ga0316593_100187521 625
581 3300047472 Ga0495686_0004579 Ga0495686_0004579_2645_4525 625
582 3300005333 Ga0070677_10000838 Ga0070677_100008384 626
583 3300005333 Ga0070677_10003738 Ga0070677_100037384 626
584 3300005340 Ga0070689_100006704 Ga0070689_1000067042 626
585 3300005354 Ga0070675_100020283 Ga0070675_1000202834 626
586 3300005354 Ga0070675_100054286 Ga0070675_1000542862 626
587 3300005354 Ga0070675_100092379 Ga0070675_1000923792 626
588 3300005440 Ga0070705_100033576 Ga0070705_1000335762 626
589 3300005444 Ga0070694_100017694 Ga0070694_1000176941 626
590 3300005543 Ga0070672_100002100 Ga0070672_1000021005 626
591 3300005564 Ga0070664_100016106 Ga0070664_1000161062 626
592 3300005615 Ga0070702_100022379 Ga0070702_1000223793 626
593 3300005617 Ga0068859_100022664 Ga0068859_1000226645 626
594 3300005719 Ga0068861_100000511 Ga0068861_10000051111 626
595 3300005843 Ga0068860_100015014 Ga0068860_1000150145 626
596 3300006237 Ga0097621_100005297 Ga0097621_10000529710 626
597 3300006358 Ga0068871_100088568 Ga0068871_1000885682 626
598 3300006931 Ga0097620_100022664 Ga0097620_1000226643 626
599 3300013296 Ga0157374_10075254 Ga0157374_100752542 626
600 3300014325 Ga0163163_10010745 Ga0163163_100107459 626
601 3300014326 Ga0157380_10005809 Ga0157380_100058094 626
602 3300014326 Ga0157380_10015362 Ga0157380_100153622 626
603 3300025893 Ga0207682_10008312 Ga0207682_100083122 626
604 3300025893 Ga0207682_10009031 Ga0207682_100090312 626
605 3300025908 Ga0207643_10009326 Ga0207643_100093263 626
606 3300025936 Ga0207670_10004746 Ga0207670_100047464 626
607 3300025940 Ga0207691_10003982 Ga0207691_100039827 626
608 3300025940 Ga0207691_10008726 Ga0207691_100087262 626
609 3300025942 Ga0207689_10010086 Ga0207689_100100862 626
610 3300025960 Ga0207651_10095514 Ga0207651_100955142 626
611 3300026075 Ga0207708_10035340 Ga0207708_100353402 626
612 3300026075 Ga0207708_10037070 Ga0207708_100370702 626
613 3300026118 Ga0207675_100002626 Ga0207675_1000026265 626
614 3300026121 Ga0207683_10007647 Ga0207683_100076473 626
615 3300028794 Ga0307515_10000090 Ga0307515_10000090131 626
616 3300028794 Ga0307515_10000889 Ga0307515_1000088952 626
617 3300031616 Ga0307508_10000007 Ga0307508_1000000714 626
618 3300031730 Ga0307516_10000398 Ga0307516_100003984 626
619 3300031824 Ga0307413_10000910 Ga0307413_1000091011 626
620 3300031852 Ga0307410_10005461 Ga0307410_100054611 626
621 3300031995 Ga0307409_100025708 Ga0307409_1000257082 626
622 3300044712 Ga0453684_0064017 Ga0453684_0064017_2424_4325 626
623 3300049588 Ga0501072_0037294 Ga0501072_0037294_669_2570 626
624 3300049589 Ga0501073_0002745 Ga0501073_0002745_10340_12241 626
625 3300049741 Ga0501079_0000163 Ga0501079_0000163_21357_23258 626
626 3300049742 Ga0501080_0061130 Ga0501080_0061130_1449_3350 626
627 3300053154 Ga0500619_000325 Ga0500619_000325_2791_4674 626
628 3300054114 Ga0501084_0047376 Ga0501084_0047376_1688_3589 626
629 3300060353 Ga0501082_0023235 Ga0501082_0023235_99_2000 626
630 3300031727 Ga0316576_10000968 Ga0316576_100009683 627
631 3300031728 Ga0316578_10000827 Ga0316578_100008273 627
632 3300031733 Ga0316577_10002878 Ga0316577_100028782 627
633 3300032126 Ga0307415_100017578 Ga0307415_1000175783 627
634 3300033541 Ga0316596_1002895 Ga0316596_10028953 627
635 3300036647 Ga0316582_0026694 Ga0316582_0026694_1415_3400 627
636 3300036712 Ga0316584_0000396 Ga0316584_0000396_2105_4090 627
637 3300005262 Ga0065165_1000967 Ga0065165_100096716 628
638 3300006353 Ga0075370_10019906 Ga0075370_100199062 628
639 3300025298 Ga0209050_1000980 Ga0209050_10009802 628
640 3300046519 Ga0495632_0002939 Ga0495632_0002939_1051_2937 628
641 3300053086 Ga0500578_0000213 Ga0500578_0000213_21561_23450 628
642 3300053093 Ga0500651_0032774 Ga0500651_0032774_19_1905 628
643 3300053130 Ga0500642_0016576 Ga0500642_0016576_255_2141 628
644 3300053131 Ga0500652_000839 Ga0500652_000839_7323_9209 628
645 3300053156 Ga0500622_0003145 Ga0500622_0003145_7893_9779 628
646 3300003215 JGI25153J46596_10015059 JGI25153J46596_100150592 629
647 3300025297 Ga0209758_1000146 Ga0209758_100014613 629

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13292

DXP_synthase_N

1-deoxy-D-xylulose-5-phosphate synthase

22

293

0.99

PF02779

Transket_pyr

Transketolase, pyrimidine binding domain

328

491

0.98

PF02780

Transketolase_C

Transketolase, C-terminal domain

506

622

0.96

PF00676

E1_dh

Dehydrogenase E1 component

120

206

0.86

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

117

196

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a29-assembly3.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9881 1 613
8a45-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.987 1 614
8a45-assembly1.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9868 1 614
8a5k-assembly1.cif.gz_F structural analysis of 1-deoxy-d-xylulose 5-phosphate synthase from pseudomonas aeruginosa and klebsiella pneumoniae reveals conformational changes upon cofactor binding 0.9867 1 614
8a5k-assembly1.cif.gz_A structural analysis of 1-deoxy-d-xylulose 5-phosphate synthase from pseudomonas aeruginosa and klebsiella pneumoniae reveals conformational changes upon cofactor binding 0.9865 1 614
ID Description Score Start End Superfamily
2o1sC03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.987 490 613 3.40.50.920
af_O50408_212_377_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9843 314 474 3.40.50.970
af_A0A0R0G7H4_1_143_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9792 341 482 3.40.50.970
af_I1M1A4_399_568_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9791 314 481 3.40.50.970
af_A0A0R0G7H4_1_143_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9658 341 482 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A365VNH1-F1-model_v4 deleted 0.9923 527 613
AF-A0A257N978-F1-model_v4 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) 0.9892 420 612 GO:0005829
GO:0008661
GO:0009228
GO:0016114
GO:0019288
GO:0046872
GO:0052865
AF-A0A482S328-F1-model_v4 deleted 0.9882 2 171
AF-A0A7X4XMH6-F1-model_v4 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) 0.9873 298 612 GO:0005829
GO:0008661
GO:0009228
GO:0016114
GO:0019288
GO:0046872
GO:0052865
AF-A0A377RN01-F1-model_v4 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) 0.9869 5 171 GO:0005829
GO:0008661
GO:0016114
GO:0019288
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.28 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map