F472159

General Info

Members Datasets Scaffolds Average Seq Length
645 277 1290 336

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0006567|Ga0501031_0006567_2703_3818
Length 371
Sequence LNHRDGQRGGEVFGILEPAFAPPANVCYDNATMSNSIKAYAASAPGAKLQPFEYNPGPLRDEQVEIAVEYCGICHSDLSMLDNDWGQTVYPFVPGHEVAGRVALVGDKVKGLKVGQRVGLGWFSESCMACPQCLSGHHNLCASAEQTIVKRHGGFANRVRCHWAWAVPLPEALDTQKSGPLFCGGITVFNPILQCNVQPMDRVGVIGIGGLGHIALQFLNKWGCEVTAFTSSDSKREEAMKLGAHHVVNSRDAEQLKKIAGSLDFILCTANVSLPWDAIISSLAPRGKLHIVGAVLEPIPVAAFSLITGAKSISGSPLGSPFNTARMLDFSARHRIGPRIEVFPMSQVNEALEHLRAGKARYRIVLANDLK

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
84 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
85 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
86 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
151 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
159 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
160 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
163 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
164 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
170 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
171 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
172 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
178 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
179 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
180 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
190 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
191 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
192 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
193 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
194 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
195 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
196 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
197 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
198 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
199 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
200 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
201 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
202 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
203 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
204 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
205 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
206 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
209 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
273 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
274 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
275 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
276 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
277 2919688452 Pararheinheimera soli 4138 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 0.93
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 0.93
Rhizosphere 96.74
Stem 0
Stem Tuber 0
Unclassified 9.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0006567 3300049568 Bacteria 7589
2 SwRhRL2b_contig_2367793 2162886007 Archaea 1393
3 ARcpr5yngRDRAFT_c003195 3300000043 Archaea 1636
4 ARSoilOldRDRAFT_c001680 3300000044 Archaea 2033
5 JGI24736J21556_1003840 3300001904 Archaea 2593
6 JGI24746J21847_1001954 3300001977 Archaea 3282
7 JGI24739J22299_10012842 3300001989 Archaea 3068
8 JGI24033J26618_1002699 3300002155 Archaea 1830
9 JGI24033J26618_1004632 3300002155 Archaea 1489
10 rootH2_10182878 3300003320 Bacteria 2295
11 rootL2_10054505 3300003322 Bacteria 4127
12 rootH1_10053731 3300003323 Bacteria 9425
13 Ga0065704_10008222 3300005289 Archaea 5279
14 Ga0065704_10008344 3300005289 Unclassified 3076
15 Ga0065704_10012137 3300005289 Archaea 4096
16 Ga0065704_10163727 3300005289 Archaea 1288
17 Ga0065715_10001363 3300005293 Archaea 6757
18 Ga0065707_10002152 3300005295 Archaea 4950
19 Ga0065707_10006821 3300005295 Archaea 5675
20 Ga0065707_10120943 3300005295 Unclassified 2120
21 Ga0070676_10002391 3300005328 Archaea 9609
22 Ga0070676_10010667 3300005328 Archaea 4986
23 Ga0070676_10023736 3300005328 Archaea 3448
24 Ga0070670_100034341 3300005331 Archaea 4364
25 Ga0070670_100083547 3300005331 Archaea 2744
26 Ga0070670_100240053 3300005331 Archaea 1578
27 Ga0068869_100000601 3300005334 Archaea 20254
28 Ga0068869_100019381 3300005334 Archaea 4647
29 Ga0068869_100076262 3300005334 Archaea 2492
30 Ga0070680_100087132 3300005336 Archaea 2582
31 Ga0070680_100173018 3300005336 Archaea 1817
32 Ga0070680_100264088 3300005336 Archaea 1457
33 Ga0068868_100017091 3300005338 Archaea 5398
34 Ga0070687_100001605 3300005343 Archaea 8052
35 Ga0070687_100003314 3300005343 Archaea 6228
36 Ga0070687_100098221 3300005343 Unclassified 1634
37 Ga0070692_10003870 3300005345 Archaea 6163
38 Ga0070692_10010183 3300005345 Archaea 4270
39 Ga0070692_10023958 3300005345 Archaea 2995
40 Ga0070668_100122262 3300005347 Archaea 2082
41 Ga0070669_100003546 3300005353 Archaea 11255
42 Ga0070669_100067935 3300005353 Archaea 2630
43 Ga0070669_100113730 3300005353 Archaea 2057
44 Ga0070669_100130243 3300005353 Archaea 1929
45 Ga0070675_100019080 3300005354 Archaea 5463
46 Ga0070671_100142555 3300005355 Unclassified 2022
47 Ga0070671_100348733 3300005355 Archaea 1263
48 Ga0070673_100006123 3300005364 Archaea 7796
49 Ga0070710_10113960 3300005437 Bacteria 1628
50 Ga0070701_10031999 3300005438 Archaea 2615
51 Ga0070701_10033371 3300005438 Archaea 2571
52 Ga0070705_100004076 3300005440 Archaea 7135
53 Ga0070700_100015656 3300005441 Unclassified 4305
54 Ga0070694_100007626 3300005444 Archaea 6607
55 Ga0070694_100027811 3300005444 Archaea 3675
56 Ga0070694_100029682 3300005444 Archaea 3570
57 Ga0070694_100143749 3300005444 Archaea 1735
58 Ga0070662_100023699 3300005457 Archaea 4219
59 Ga0070662_100042742 3300005457 Archaea 3238
60 Ga0070662_100104050 3300005457 Archaea 2153
61 Ga0070662_100271935 3300005457 Archaea 1368
62 Ga0070681_10019748 3300005458 Archaea 6748
63 Ga0070681_10044428 3300005458 Archaea 4447
64 Ga0070681_10362104 3300005458 Archaea 1360
65 Ga0068867_100011842 3300005459 Archaea 6161
66 Ga0068867_100048620 3300005459 Archaea 3121
67 Ga0068867_100162820 3300005459 Archaea 1760
68 Ga0068867_100192359 3300005459 Archaea 1629
69 Ga0070698_100120126 3300005471 Unclassified 2588
70 Ga0070698_100366582 3300005471 Unclassified 1372
71 Ga0070679_100110516 3300005530 Archaea 2735
72 Ga0068853_100000199 3300005539 Bacteria 42238
73 Ga0068853_100147725 3300005539 Unclassified 2114
74 Ga0070672_100003830 3300005543 Archaea 9793
75 Ga0070672_100059851 3300005543 Archaea 2998
76 Ga0070686_100018805 3300005544 Unclassified 4062
77 Ga0070695_100028111 3300005545 Archaea 3488
78 Ga0070696_100024360 3300005546 Archaea 4113
79 Ga0070696_100062708 3300005546 Archaea 2602
80 Ga0070696_100163411 3300005546 Archaea 1642
81 Ga0070693_100025377 3300005547 Archaea 3189
82 Ga0070665_100139285 3300005548 Bacteria 2430
83 Ga0070704_100076309 3300005549 Archaea 2451
84 Ga0068855_100017845 3300005563 Bacteria 8529
85 Ga0070664_100013255 3300005564 Archaea 6716
86 Ga0070664_100059691 3300005564 Archaea 3245
87 Ga0068857_100058233 3300005577 Archaea 3430
88 Ga0068857_100252766 3300005577 Archaea 1616
89 Ga0068856_100000034 3300005614 Bacteria 124288
90 Ga0068856_100069965 3300005614 Bacteria 3471
91 Ga0070702_100014299 3300005615 Archaea 4025
92 Ga0070702_100159508 3300005615 Bacteria 1456
93 Ga0068852_100205130 3300005616 Archaea 1867
94 Ga0068859_100077290 3300005617 Archaea 3370
95 Ga0068859_100256871 3300005617 Bacteria 1838
96 Ga0068864_100031607 3300005618 Archaea 4493
97 Ga0068864_100310025 3300005618 Archaea 1479
98 Ga0068866_10085873 3300005718 Archaea 1701
99 Ga0068861_100399535 3300005719 Archaea 1219
100 Ga0068870_10002062 3300005840 Archaea 8311
101 Ga0068870_10004612 3300005840 Archaea 5944
102 Ga0068870_10018699 3300005840 Archaea 3350
103 Ga0068858_100223444 3300005842 Archaea 1784
104 Ga0068858_100563967 3300005842 Bacteria 1103
105 Ga0068860_100000541 3300005843 Bacteria 46054
106 Ga0068860_100051622 3300005843 Archaea 3912
107 Ga0068860_100386223 3300005843 Archaea 1383
108 Ga0068862_100022253 3300005844 Archaea 5302
109 Ga0068862_100076630 3300005844 Archaea 2894
110 Ga0068862_100112532 3300005844 Archaea 2391
111 Ga0081455_10002865 3300005937 Bacteria 20315
112 Ga0081538_10090696 3300005981 Archaea 1581
113 Ga0075432_10004767 3300006058 Unclassified 4616
114 Ga0075427_10001741 3300006194 Archaea 2834
115 Ga0097621_100075923 3300006237 Unclassified 2787
116 Ga0068871_100085880 3300006358 Bacteria 2614
117 Ga0075428_100022119 3300006844 Archaea 7039
118 Ga0075428_100038060 3300006844 Bacteria 5294
119 Ga0075428_100053455 3300006844 Archaea 4425
120 Ga0075428_100076228 3300006844 Bacteria 3661
121 Ga0075428_100133714 3300006844 Bacteria 2697
122 Ga0075428_100148578 3300006844 Archaea 2546
123 Ga0075431_100084081 3300006847 Bacteria 3285
124 Ga0075431_100099350 3300006847 Archaea 3003
125 Ga0075431_100116937 3300006847 Bacteria 2751
126 Ga0075431_100329225 3300006847 Archaea 1539
127 Ga0075431_100334153 3300006847 Archaea 1526
128 Ga0075433_10004169 3300006852 Bacteria 11221
129 Ga0075433_10082961 3300006852 Archaea 2828
130 Ga0075433_10236347 3300006852 Bacteria 1622
131 Ga0075434_100177916 3300006871 Bacteria 2147
132 Ga0075434_100183779 3300006871 Bacteria 2111
133 Ga0075434_100418748 3300006871 Unclassified 1361
134 Ga0075429_100015389 3300006880 Archaea 6630
135 Ga0075429_100018090 3300006880 Archaea 6097
136 Ga0075429_100022954 3300006880 Bacteria 5409
137 Ga0075429_100054171 3300006880 Archaea 3489
138 Ga0075429_100112592 3300006880 Archaea 2378
139 Ga0075429_100163529 3300006880 Archaea 1949
140 Ga0075436_100086708 3300006914 Archaea 2174
141 Ga0097620_100077288 3300006931 Archaea 3370
142 Ga0097620_100256875 3300006931 Bacteria 1838
143 Ga0075435_100305442 3300007076 Bacteria 1361
144 Ga0111539_10010939 3300009094 Archaea 11422
145 Ga0111539_10058887 3300009094 Archaea 4556
146 Ga0111539_10077009 3300009094 Archaea 3926
147 Ga0111539_10156317 3300009094 Unclassified 2668
148 Ga0105245_10065235 3300009098 Archaea 3293
149 Ga0105247_10099960 3300009101 Unclassified 1853
150 Ga0114129_10039580 3300009147 Archaea 6647
151 Ga0114129_10050708 3300009147 Bacteria 5829
152 Ga0114129_10077846 3300009147 Archaea 4612
153 Ga0114129_10124477 3300009147 Bacteria 3545
154 Ga0114129_10190997 3300009147 Archaea 2781
155 Ga0114129_10269253 3300009147 Archaea 2280
156 Ga0105241_10133743 3300009174 Archaea 2011
157 Ga0105242_10020085 3300009176 Archaea 5235
158 Ga0105242_10050396 3300009176 Archaea 3390
159 Ga0105237_10069143 3300009545 Archaea 3526
160 Ga0105249_10010727 3300009553 Archaea 8049
161 Ga0105249_10070172 3300009553 Archaea 3234
162 Ga0105249_10174039 3300009553 Archaea 2089
163 Ga0105239_10254196 3300010375 Archaea 1974
164 Ga0105246_10025168 3300011119 Archaea 3878
165 Ga0105246_10080099 3300011119 Archaea 2324
166 Ga0105246_10144955 3300011119 Unclassified 1791
167 Ga0157341_1001535 3300012494 Archaea 1415
168 Ga0157319_1000463 3300012497 Archaea 1861
169 Ga0157314_1003168 3300012500 Archaea 1160
170 Ga0157327_1003001 3300012512 Archaea 1213
171 Ga0157371_10017664 3300013102 Archaea 5292
172 Ga0157371_10173212 3300013102 Archaea 1542
173 Ga0157374_10005815 3300013296 Bacteria 10418
174 Ga0157374_10016187 3300013296 Archaea 6552
175 Ga0157378_10013746 3300013297 Archaea 7080
176 Ga0157378_10082474 3300013297 Bacteria 2907
177 Ga0157378_10257298 3300013297 Archaea 1673
178 Ga0163162_10100136 3300013306 Archaea 2989
179 Ga0157372_10203069 3300013307 Unclassified 2296
180 Ga0157375_10018965 3300013308 Bacteria 6245
181 Ga0157377_10009152 3300014745 Archaea 4850
182 Ga0157379_10054048 3300014968 Archaea 3588
183 Ga0163161_10024426 3300017792 Unclassified 4269
184 Ga0213873_10007667 3300021358 Unclassified 2171
185 Ga0213876_10017591 3300021384 Bacteria 3772
186 Ga0207673_1000921 3300025290 Archaea 3168
187 Ga0207697_10000379 3300025315 Archaea 24935
188 Ga0207682_10023626 3300025893 Archaea 2429
189 Ga0207642_10107084 3300025899 Unclassified 1416
190 Ga0207688_10005645 3300025901 Archaea 6804
191 Ga0207688_10031681 3300025901 Bacteria 2921
192 Ga0207647_10001306 3300025904 Archaea 19191
193 Ga0207647_10008480 3300025904 Archaea 7366
194 Ga0207645_10001665 3300025907 Archaea 18091
195 Ga0207645_10003325 3300025907 Archaea 12271
196 Ga0207643_10000731 3300025908 Archaea 20164
197 Ga0207643_10001601 3300025908 Archaea 12795
198 Ga0207643_10003647 3300025908 Archaea 8297
199 Ga0207707_10194218 3300025912 Archaea 1770
200 Ga0207693_10259038 3300025915 Unclassified 1364
201 Ga0207660_10063110 3300025917 Archaea 2670
202 Ga0207660_10222985 3300025917 Archaea 1480
203 Ga0207662_10000610 3300025918 Archaea 16042
204 Ga0207662_10004384 3300025918 Archaea 7412
205 Ga0207649_10000385 3300025920 Bacteria 33024
206 Ga0207649_10256254 3300025920 Archaea 1262
207 Ga0207646_10327832 3300025922 Bacteria 1383
208 Ga0207681_10009198 3300025923 Archaea 6037
209 Ga0207681_10056302 3300025923 Archaea 2681
210 Ga0207650_10112887 3300025925 Bacteria 2106
211 Ga0207650_10152875 3300025925 Archaea 1822
212 Ga0207650_10179112 3300025925 Archaea 1688
213 Ga0207659_10007461 3300025926 Archaea 6726
214 Ga0207687_10059683 3300025927 Archaea 2688
215 Ga0207706_10013739 3300025933 Archaea 7348
216 Ga0207706_10036783 3300025933 Archaea 4348
217 Ga0207670_10120975 3300025936 Bacteria 1903
218 Ga0207691_10009637 3300025940 Archaea 9265
219 Ga0207691_10014411 3300025940 Archaea 7539
220 Ga0207691_10089602 3300025940 Archaea 2758
221 Ga0207689_10001717 3300025942 Archaea 20747
222 Ga0207689_10054222 3300025942 Archaea 3303
223 Ga0207689_10094096 3300025942 Archaea 2461
224 Ga0207679_10211111 3300025945 Archaea 1628
225 Ga0207667_10005563 3300025949 Bacteria 15379
226 Ga0207712_10001734 3300025961 Bacteria 14592
227 Ga0207712_10012230 3300025961 Archaea 5484
228 Ga0207712_10052709 3300025961 Archaea 2851
229 Ga0207668_10048331 3300025972 Archaea 2919
230 Ga0207668_10118684 3300025972 Unclassified 1999
231 Ga0207677_10002331 3300026023 Archaea 9961
232 Ga0207703_10003856 3300026035 Bacteria 12457
233 Ga0207703_10122122 3300026035 Bacteria 2237
234 Ga0207639_10000235 3300026041 Bacteria 41429
235 Ga0207639_10353628 3300026041 Unclassified 1313
236 Ga0207708_10035267 3300026075 Unclassified 3807
237 Ga0207708_10041291 3300026075 Archaea 3517
238 Ga0207702_10000924 3300026078 Bacteria 30296
239 Ga0207648_10002870 3300026089 Archaea 18243
240 Ga0207648_10008095 3300026089 Archaea 10235
241 Ga0207648_10050746 3300026089 Archaea 3627
242 Ga0207676_10025088 3300026095 Archaea 4421
243 Ga0207676_10121248 3300026095 Archaea 2206
244 Ga0207676_10254177 3300026095 Archaea 1583
245 Ga0207674_10119741 3300026116 Archaea 2601
246 Ga0207674_10303825 3300026116 Archaea 1545
247 Ga0207675_100515648 3300026118 Archaea 1191
248 Ga0207683_10017986 3300026121 Bacteria 6028
249 Ga0209969_1000229 3300027360 Archaea 7571
250 Ga0209967_1000367 3300027364 Archaea 5976
251 Ga0209967_1000580 3300027364 Archaea 4794
252 Ga0209967_1006308 3300027364 Archaea 1607
253 Ga0209996_1002844 3300027395 Archaea 2153
254 Ga0209996_1011718 3300027395 Archaea 1173
255 Ga0209984_1001384 3300027424 Archaea 2624
256 Ga0209984_1002984 3300027424 Archaea 1914
257 Ga0210000_1001246 3300027462 Archaea 3584
258 Ga0210000_1002076 3300027462 Archaea 2836
259 Ga0209968_1001681 3300027526 Archaea 3341
260 Ga0209999_1000999 3300027543 Archaea 4780
261 Ga0209999_1010987 3300027543 Archaea 1637
262 Ga0209982_1001346 3300027552 Archaea 3335
263 Ga0209982_1002666 3300027552 Archaea 2510
264 Ga0209970_1004838 3300027614 Archaea 2227
265 Ga0209970_1011192 3300027614 Archaea 1474
266 Ga0210002_1001108 3300027617 Archaea 3744
267 Ga0210002_1003115 3300027617 Archaea 2436
268 Ga0210002_1004774 3300027617 Archaea 2024
269 Ga0209983_1007101 3300027665 Archaea 2299
270 Ga0209971_1012364 3300027682 Archaea 2020
271 Ga0209971_1018556 3300027682 Archaea 1651
272 Ga0209998_10001071 3300027717 Archaea 6826
273 Ga0209998_10008187 3300027717 Archaea 2170
274 Ga0207428_10000225 3300027907 Archaea 78396
275 Ga0207428_10000999 3300027907 Archaea 31379
276 Ga0207428_10039195 3300027907 Archaea 3847
277 Ga0207428_10098156 3300027907 Archaea 2267
278 Ga0268265_10005877 3300028380 Archaea 8362
279 Ga0268265_10018810 3300028380 Archaea 4792
280 Ga0268265_10289791 3300028380 Bacteria 1469
281 Ga0268265_10323655 3300028380 Archaea 1397
282 Ga0268264_10000513 3300028381 Bacteria 49812
283 Ga0268264_10005582 3300028381 Bacteria 10655
284 Ga0265337_1011697 3300028556 Bacteria 3012
285 Ga0265323_10006598 3300028653 Bacteria 4869
286 Ga0265323_10039083 3300028653 Bacteria 1731
287 Ga0265338_10000028 3300028800 Bacteria 279132
288 Ga0265338_10044775 3300028800 Bacteria 4079
289 Ga0265330_10012388 3300031235 Bacteria 3989
290 Ga0265330_10050405 3300031235 Bacteria 1826
291 Ga0265320_10000064 3300031240 Bacteria 97262
292 Ga0265339_10072560 3300031249 Bacteria 1832
293 Ga0265327_10018703 3300031251 Bacteria 4284
294 Ga0265316_10053323 3300031344 Bacteria 3169
295 Ga0265316_10173777 3300031344 Bacteria 1606
296 Ga0265313_10043193 3300031595 Bacteria 2208
297 Ga0316575_10003979 3300031665 Bacteria 5173
298 Ga0316575_10067006 3300031665 Unclassified 1438
299 Ga0316575_10074090 3300031665 Bacteria 1370
300 Ga0316579_10006464 3300031691 Unclassified 4785
301 Ga0316579_10057439 3300031691 Bacteria 1828
302 Ga0316579_10060675 3300031691 Unclassified 1779
303 Ga0265342_10058443 3300031712 Bacteria 2279
304 Ga0316576_10000301 3300031727 Bacteria 21814
305 Ga0316576_10000803 3300031727 Bacteria 15845
306 Ga0316576_10028239 3300031727 Unclassified 3953
307 Ga0316576_10064140 3300031727 Bacteria 2698
308 Ga0316576_10105281 3300031727 Unclassified 2111
309 Ga0316576_10112288 3300031727 Bacteria 2043
310 Ga0316576_10116739 3300031727 Bacteria 2002
311 Ga0316576_10216137 3300031727 Bacteria 1442
312 Ga0316576_10244535 3300031727 Bacteria 1347
313 Ga0316578_10012162 3300031728 Bacteria 4532
314 Ga0316578_10032837 3300031728 Bacteria 2968
315 Ga0316578_10073213 3300031728 Bacteria 2030
316 Ga0316578_10079322 3300031728 Bacteria 1952
317 Ga0316578_10095232 3300031728 Bacteria 1781
318 Ga0316578_10112243 3300031728 Bacteria 1637
319 Ga0316578_10173715 3300031728 Unclassified 1298
320 Ga0316577_10159182 3300031733 Bacteria 1274
321 Ga0307413_10145628 3300031824 Unclassified 1644
322 Ga0307410_10255280 3300031852 Bacteria 1365
323 Ga0307406_10055409 3300031901 Bacteria 2535
324 Ga0307416_100308748 3300032002 Archaea 1577
325 Ga0316583_10002551 3300032133 Bacteria 6345
326 Ga0316583_10013150 3300032133 Unclassified 2987
327 Ga0316583_10015290 3300032133 Bacteria 2762
328 Ga0316583_10050303 3300032133 Unclassified 1467
329 Ga0316583_10094809 3300032133 Bacteria 1040
330 Ga0316585_10056169 3300032137 Bacteria 1267
331 Ga0316580_10001837 3300032139 Bacteria 5691
332 Ga0316580_10005038 3300032139 Bacteria 3843
333 Ga0316580_10010779 3300032139 Bacteria 2768
334 Ga0316593_10000768 3300032168 Bacteria 6357
335 Ga0316593_10026090 3300032168 Bacteria 1865
336 Ga0316593_10047983 3300032168 Unclassified 1437
337 Ga0316592_1014660 3300033524 Bacteria 1627
338 Ga0316588_1020768 3300033528 Unclassified 1490
339 Ga0316596_1003846 3300033541 Unclassified 3323
340 Ga0373940_0015128 3300035088 Archaea 1894
341 Ga0373952_0015117 3300035092 Archaea 1555
342 Ga0373932_0008364 3300035112 Unclassified 2473
343 Ga0316574_0009701 3300035398 Bacteria 5406
344 Ga0316574_0093602 3300035398 Unclassified 1918
345 Ga0316574_0165427 3300035398 Bacteria 1424
346 Ga0316582_0062584 3300036647 Bacteria 2389
347 Ga0316582_0065681 3300036647 Bacteria 2336
348 Ga0316582_0067708 3300036647 Unclassified 2304
349 Ga0316582_0085428 3300036647 Bacteria 2068
350 Ga0316582_0138175 3300036647 Bacteria 1641
351 Ga0316582_0204487 3300036647 Unclassified 1348
352 Ga0316582_0249264 3300036647 Bacteria 1217
353 Ga0316584_0005301 3300036712 Bacteria 8634
354 Ga0316584_0006411 3300036712 Bacteria 7966
355 Ga0316584_0008435 3300036712 Bacteria 7101
356 Ga0316584_0040331 3300036712 Bacteria 3478
357 Ga0316584_0050666 3300036712 Unclassified 3104
358 Ga0316584_0148559 3300036712 Unclassified 1745
359 Ga0316584_0150781 3300036712 Bacteria 1731
360 Ga0395899_0000032 3300037312 Bacteria 312705
361 Ga0395900_0007484 3300037418 Bacteria 11278
362 Ga0395900_0118736 3300037418 Bacteria 2714
363 Ga0395898_0000012 3300037466 Bacteria 480882
364 Ga0395905_0006555 3300037471 Bacteria 11694
365 Ga0395905_0078994 3300037471 Bacteria 3083
366 Ga0395905_0085917 3300037471 Bacteria 2948
367 Ga0395901_0142486 3300038443 Bacteria 2519
368 Ga0395901_0208693 3300038443 Bacteria 2045
369 Ga0395901_0476918 3300038443 Bacteria 1273
370 Ga0436365_0167594 3300039437 Bacteria 9256
371 Ga0436365_1720376 3300039437 Bacteria 1548
372 Ga0436362_0328787 3300039453 Bacteria 1241
373 Ga0436362_0447478 3300039453 Bacteria 5059
374 Ga0439453_0001649 3300041408 Archaea 2917
375 Ga0439466_0008005 3300041411 Unclassified 3986
376 Ga0451843_0941248 3300041509 Bacteria 1593
377 Ga0439431_0005230 3300041997 Unclassified 2861
378 Ga0439437_002828 3300042000 Archaea 1866
379 Ga0439441_000304 3300042001 Archaea 4941
380 Ga0439432_017179 3300042006 Archaea 2431
381 Ga0439450_000251 3300042008 Archaea 6504
382 Ga0439451_025372 3300042009 Archaea 1195
383 Ga0439454_008861 3300042011 Archaea 1294
384 Ga0439455_0008436 3300042012 Archaea 2210
385 Ga0439456_006314 3300042013 Archaea 2419
386 Ga0439434_0030899 3300042435 Archaea 1627
387 Ga0439435_0014319 3300042436 Archaea 1958
388 Ga0439444_0002146 3300042437 Archaea 2664
389 Ga0439444_0028025 3300042437 Archaea 1041
390 Ga0439464_0001176 3300042439 Archaea 6055
391 Ga0439460_0016592 3300042461 Archaea 1963
392 Ga0439460_0061932 3300042461 Archaea 1143
393 Ga0450893_0004916 3300042532 Archaea 2134
394 Ga0451577_0009415 3300042876 Bacteria 9416
395 Ga0451577_0061295 3300042876 Bacteria 3354
396 Ga0451577_0189692 3300042876 Bacteria 1854
397 Ga0439440_0000516 3300042993 Archaea 6499
398 Ga0439440_0042395 3300042993 Archaea 1113
399 Ga0453683_0009178 3300044673 Bacteria 6607
400 Ga0466964_0011670 3300044706 Bacteria 3323
401 Ga0453684_0000185 3300044712 Bacteria 274418
402 Ga0453684_0000702 3300044712 Bacteria 118936
403 Ga0453684_0001222 3300044712 Bacteria 78832
404 Ga0453684_0050369 3300044712 Bacteria 5480
405 Ga0453684_0137268 3300044712 Bacteria 2925
406 Ga0453684_0312637 3300044712 Bacteria 1782
407 Ga0453684_0355087 3300044712 Bacteria 1652
408 Ga0466971_0000075 3300044719 Bacteria 36467
409 Ga0466957_0004450 3300044842 Bacteria 7809
410 Ga0451576_0000266 3300045051 Bacteria 127813
411 Ga0451576_0001622 3300045051 Bacteria 37702
412 Ga0451576_0030346 3300045051 Bacteria 5778
413 Ga0466967_0014174 3300045976 Bacteria 6197
414 Ga0495621_0041076 3300046539 Bacteria 1623
415 Ga0495656_0003937 3300046615 Bacteria 5045
416 Ga0495668_0006308 3300046616 Bacteria 7807
417 Ga0495659_0103472 3300046664 Bacteria 1105
418 Ga0495636_0000200 3300047318 Bacteria 23352
419 Ga0495636_0003457 3300047318 Bacteria 6131
420 Ga0495674_0045342 3300047319 Bacteria 3904
421 Ga0496100_0215144 3300048903 Archaea 1408
422 Ga0496106_0012930 3300048909 Archaea 6160
423 Ga0496108_0054268 3300048911 Bacteria 3363
424 Ga0496109_0088594 3300048912 Bacteria 2860
425 Ga0496112_0156015 3300048915 Bacteria 2249
426 Ga0496113_0018021 3300048916 Bacteria 4912
427 Ga0501031_0022565 3300049568 Bacteria 4101
428 Ga0501031_0025338 3300049568 Bacteria 3870
429 Ga0501031_0035548 3300049568 Archaea 3250
430 Ga0501031_0061184 3300049568 Archaea 2454
431 Ga0501031_0181374 3300049568 Archaea 1375
432 Ga0501032_0000058 3300049569 Bacteria 98163
433 Ga0501032_0012640 3300049569 Bacteria 6024
434 Ga0501032_0033042 3300049569 Archaea 3546
435 Ga0501033_0000001 3300049570 Bacteria 795921
436 Ga0501033_0028548 3300049570 Bacteria 4191
437 Ga0501033_0049310 3300049570 Bacteria 3125
438 Ga0501033_0168928 3300049570 Archaea 1571
439 Ga0501034_0020851 3300049571 Archaea 6688
440 Ga0501034_0032006 3300049571 Bacteria 5343
441 Ga0501036_0022157 3300049572 Archaea 5344
442 Ga0501036_0063587 3300049572 Archaea 3124
443 Ga0501036_0094046 3300049572 Archaea 2533
444 Ga0501036_0108595 3300049572 Archaea 2345
445 Ga0501036_0128831 3300049572 Archaea 2137
446 Ga0501036_0142666 3300049572 Archaea 2021
447 Ga0501036_0241956 3300049572 Archaea 1513
448 Ga0501036_0314343 3300049572 Bacteria 1309
449 Ga0501037_0000019 3300049573 Bacteria 155790
450 Ga0501037_0014274 3300049573 Archaea 5853
451 Ga0501037_0024953 3300049573 Archaea 4419
452 Ga0501037_0054592 3300049573 Archaea 2922
453 Ga0501037_0064029 3300049573 Archaea 2680
454 Ga0501037_0065954 3300049573 Archaea 2637
455 Ga0501037_0091750 3300049573 Bacteria 2197
456 Ga0501037_0233943 3300049573 Archaea 1289
457 Ga0501038_0050843 3300049574 Archaea 3580
458 Ga0501038_0064361 3300049574 Archaea 3127
459 Ga0501038_0094363 3300049574 Bacteria 2501
460 Ga0501038_0099188 3300049574 Archaea 2428
461 Ga0501038_0127572 3300049574 Archaea 2092
462 Ga0501038_0159596 3300049574 Bacteria 1833
463 Ga0501038_0351264 3300049574 Unclassified 1148
464 Ga0501038_0388645 3300049574 Archaea 1081
465 Ga0501039_0000537 3300049575 Archaea 27529
466 Ga0501039_0000857 3300049575 Bacteria 21993
467 Ga0501039_0001005 3300049575 Archaea 20551
468 Ga0501039_0047683 3300049575 Archaea 3311
469 Ga0501039_0166820 3300049575 Archaea 1731
470 Ga0501039_0241956 3300049575 Unclassified 1419
471 Ga0501040_0000508 3300049576 Archaea 23295
472 Ga0501040_0034072 3300049576 Archaea 3450
473 Ga0501041_0007419 3300049577 Archaea 6438
474 Ga0501041_0008471 3300049577 Archaea 6049
475 Ga0501041_0028624 3300049577 Archaea 3361
476 Ga0501041_0029828 3300049577 Archaea 3291
477 Ga0501041_0069550 3300049577 Archaea 2159
478 Ga0501041_0086215 3300049577 Archaea 1937
479 Ga0501042_0096363 3300049578 Archaea 2125
480 Ga0501042_0097646 3300049578 Archaea 2111
481 Ga0501042_0129218 3300049578 Archaea 1820
482 Ga0501042_0167464 3300049578 Archaea 1585
483 Ga0501043_0002115 3300049579 Bacteria 16938
484 Ga0501043_0006100 3300049579 Archaea 9681
485 Ga0501043_0016384 3300049579 Bacteria 5811
486 Ga0501043_0020144 3300049579 Archaea 5236
487 Ga0501043_0024942 3300049579 Bacteria 4691
488 Ga0501043_0032503 3300049579 Archaea 4103
489 Ga0501043_0119557 3300049579 Bacteria 2066
490 Ga0501043_0148966 3300049579 Archaea 1831
491 Ga0501046_0012517 3300049580 Archaea 7219
492 Ga0501046_0049415 3300049580 Archaea 3326
493 Ga0501046_0113103 3300049580 Archaea 2072
494 Ga0501046_0347577 3300049580 Archaea 1077
495 Ga0501047_0005756 3300049581 Bacteria 11670
496 Ga0501047_0034043 3300049581 Bacteria 4919
497 Ga0501047_0057904 3300049581 Archaea 3746
498 Ga0501047_0122048 3300049581 Bacteria 2487
499 Ga0501047_0251442 3300049581 Bacteria 1616
500 Ga0501048_0000444 3300049582 Archaea 29093
501 Ga0501048_0000921 3300049582 Archaea 21646
502 Ga0501048_0005160 3300049582 Archaea 9953
503 Ga0501048_0209240 3300049582 Archaea 1383
504 Ga0501048_0233696 3300049582 Archaea 1304
505 Ga0501068_0048444 3300049584 Archaea 2566
506 Ga0501070_0002048 3300049586 Bacteria 17723
507 Ga0501070_0404370 3300049586 Unclassified 1104
508 Ga0501071_0001768 3300049587 Archaea 12739
509 Ga0501071_0006617 3300049587 Archaea 7530
510 Ga0501071_0008409 3300049587 Archaea 6822
511 Ga0501071_0044066 3300049587 Archaea 3200
512 Ga0501071_0069559 3300049587 Archaea 2563
513 Ga0501071_0133619 3300049587 Unclassified 1845
514 Ga0501071_0190217 3300049587 Archaea 1539
515 Ga0501071_0359213 3300049587 Unclassified 1109
516 Ga0501072_0000206 3300049588 Archaea 42975
517 Ga0501072_0007223 3300049588 Bacteria 8432
518 Ga0501072_0088126 3300049588 Archaea 2463
519 Ga0501072_0126698 3300049588 Archaea 2035
520 Ga0501072_0150654 3300049588 Archaea 1854
521 Ga0501072_0161874 3300049588 Archaea 1785
522 Ga0501072_0238145 3300049588 Unclassified 1449
523 Ga0501074_0023757 3300049590 Archaea 4456
524 Ga0501074_0026547 3300049590 Archaea 4199
525 Ga0501074_0216644 3300049590 Unclassified 1363
526 Ga0501074_0233699 3300049590 Archaea 1309
527 Ga0501075_0004565 3300049591 Archaea 9388
528 Ga0501075_0038973 3300049591 Archaea 3554
529 Ga0501075_0048691 3300049591 Archaea 3185
530 Ga0501075_0142850 3300049591 Archaea 1824
531 Ga0501075_0155175 3300049591 Archaea 1745
532 Ga0501075_0251008 3300049591 Unclassified 1348
533 Ga0501075_0251362 3300049591 Unclassified 1347
534 Ga0501076_0001650 3300049592 Archaea 15064
535 Ga0501076_0002218 3300049592 Archaea 13307
536 Ga0501076_0021364 3300049592 Archaea 4964
537 Ga0501076_0070737 3300049592 Archaea 2790
538 Ga0501076_0236602 3300049592 Archaea 1493
539 Ga0501077_0014100 3300049593 Archaea 5014
540 Ga0501077_0014603 3300049593 Archaea 4938
541 Ga0501077_0020609 3300049593 Archaea 4174
542 Ga0501077_0040590 3300049593 Archaea 2965
543 Ga0501077_0131875 3300049593 Archaea 1584
544 Ga0501079_0001465 3300049741 Archaea 16689
545 Ga0501079_0015637 3300049741 Archaea 5795
546 Ga0501079_0488839 3300049741 Unclassified 967
547 Ga0501080_0004181 3300049742 Archaea 12801
548 Ga0501080_0010193 3300049742 Archaea 8594
549 Ga0501080_0032772 3300049742 Archaea 4847
550 Ga0501081_0005949 3300049743 Archaea 7898
551 Ga0501081_0007667 3300049743 Archaea 7000
552 Ga0501081_0147879 3300049743 Archaea 1686
553 Ga0501081_0160186 3300049743 Archaea 1621
554 Ga0501083_0177544 3300049744 Archaea 1391
555 Ga0501035_0000004 3300049822 Bacteria 403650
556 Ga0501035_0009543 3300049822 Bacteria 9023
557 Ga0501035_0012113 3300049822 Archaea 7976
558 Ga0501035_0017085 3300049822 Archaea 6684
559 Ga0501035_0018384 3300049822 Bacteria 6440
560 Ga0501035_0040072 3300049822 Bacteria 4235
561 Ga0501035_0223592 3300049822 Archaea 1606
562 Ga0501035_0474690 3300049822 Unclassified 1032
563 Ga0501044_0002619 3300049823 Bacteria 20448
564 Ga0501044_0007157 3300049823 Bacteria 12273
565 Ga0501044_0040632 3300049823 Archaea 4846
566 Ga0501044_0118648 3300049823 Bacteria 2648
567 Ga0501044_0342473 3300049823 Bacteria 1416
568 Ga0501045_0020828 3300049824 Archaea 4686
569 Ga0501045_0049292 3300049824 Archaea 3070
570 Ga0501045_0070548 3300049824 Archaea 2571
571 Ga0501045_0108197 3300049824 Archaea 2060
572 Ga0501045_0126439 3300049824 Archaea 1899
573 Ga0501045_0228438 3300049824 Unclassified 1385
574 nmdc:mga0k408_173758_c1 3300050493 Bacteria 1284
575 nmdc:mga0k408_179061_c1 3300050493 Unclassified 1264
576 nmdc:mga05p37_117082_c1 3300050507 Archaea 3275
577 nmdc:mga05p37_149975_c1 3300050507 Archaea 2853
578 nmdc:mga05p37_309259_c1 3300050507 Archaea 1874
579 nmdc:mga05p37_316426_c1 3300050507 Unclassified 1849
580 nmdc:mga05p37_348572_c1 3300050507 Bacteria 1744
581 nmdc:mga05p37_41981_c1 3300050507 Bacteria 5619
582 nmdc:mga05p37_45036_c1 3300050507 Archaea 5428
583 nmdc:mga05p37_5567_c1 3300050507 Archaea 12717
584 nmdc:mga05p37_88491_c1 3300050507 Archaea 3817
585 nmdc:mga09592_10090_c1 3300050508 Bacteria 7681
586 nmdc:mga09592_12781_c1 3300050508 Bacteria 6843
587 nmdc:mga09592_12880_c1 3300050508 Archaea 6820
588 nmdc:mga09592_14263_c1 3300050508 Archaea 6487
589 nmdc:mga09592_19749_c1 3300050508 Archaea 5535
590 nmdc:mga09592_50700_c1 3300050508 Archaea 3501
591 nmdc:mga09592_93682_c1 3300050508 Archaea 2569
592 nmdc:mga0qj67_25095_c1 3300050509 Archaea 4602
593 nmdc:mga0qj67_303805_c1 3300050509 Archaea 1293
594 nmdc:mga0qj67_366108_c1 3300050509 Unclassified 1165
595 nmdc:mga0qj67_79219_c1 3300050509 Archaea 2631
596 nmdc:mga06r32_11176_c1 3300050510 Bacteria 8087
597 nmdc:mga06r32_138522_c1 3300050510 Unclassified 2408
598 nmdc:mga06r32_191703_c1 3300050510 Archaea 2031
599 nmdc:mga06r32_216146_c1 3300050510 Archaea 1905
600 nmdc:mga06r32_222253_c1 3300050510 Archaea 1877
601 nmdc:mga06r32_436422_c1 3300050510 Archaea 1290
602 nmdc:mga06r32_463215_c1 3300050510 Archaea 1247
603 nmdc:mga06r32_58751_c1 3300050510 Bacteria 3697
604 nmdc:mga06r32_99872_c1 3300050510 Archaea 2847
605 nmdc:mga08y16_1099_c1 3300050511 Archaea 26635
606 nmdc:mga08y16_120161_c1 3300050511 Archaea 2735
607 nmdc:mga08y16_219659_c1 3300050511 Archaea 1968
608 nmdc:mga08y16_325664_c1 3300050511 Bacteria 1581
609 nmdc:mga08y16_82040_c1 3300050511 Archaea 3362
610 nmdc:mga0n895_2037_c1 3300050512 Bacteria 15540
611 nmdc:mga0n895_336368_c1 3300050512 Bacteria 1530
612 nmdc:mga0n895_45709_c1 3300050512 Archaea 4274
613 nmdc:mga0n895_5476_c1 3300050512 Archaea 10622
614 nmdc:mga0n895_95256_c1 3300050512 Archaea 2981
615 nmdc:mga0rr50_173741_c1 3300050513 Unclassified 1757
616 nmdc:mga08x19_74599_c1 3300050514 Archaea 2217
617 nmdc:mga0a205_11830_c1 3300050515 Bacteria 8055
618 nmdc:mga0a205_21061_c1 3300050515 Archaea 6165
619 nmdc:mga0a205_284196_c1 3300050515 Bacteria 1530
620 nmdc:mga0a205_49147_c1 3300050515 Archaea 4071
621 nmdc:mga0a205_78994_c1 3300050515 Unclassified 3179
622 Ga0500604_0036720 3300053151 Bacteria 1462
623 Ga0500616_0010909 3300053153 Bacteria 5410
624 Ga0501084_0007746 3300054114 Archaea 8841
625 Ga0501084_0009036 3300054114 Archaea 8247
626 Ga0501084_0015093 3300054114 Archaea 6407
627 Ga0501084_0039112 3300054114 Archaea 3967
628 Ga0501084_0370708 3300054114 Unclassified 1210
629 Ga0501082_0000314 3300060353 Archaea 43184
630 Ga0501082_0016300 3300060353 Archaea 6396
631 Ga0501082_0040351 3300060353 Archaea 4027
632 Ga0501082_0076428 3300060353 Archaea 2887
633 Ga0501082_0096885 3300060353 Archaea 2550
634 Ga0501082_0157888 3300060353 Archaea 1970
635 Ga0466962_0000025 3300061719 Bacteria 76266
636 Ga0530510_0001674 3300061734 Archaea 14999
637 Ga0530510_0021231 3300061734 Archaea 4619
638 Ga0530510_0063167 3300061734 Archaea 2681
639 Ga0530510_0075232 3300061734 Archaea 2452
640 Ga0530510_0224783 3300061734 Unclassified 1396
641 2572254340 2571042365 Bacteria 3289345
642 2691330553 2690315857 Bacteria 4396207
643 2738714133 2738541276 Bacteria 4690596
644 2919535582 2919534386 Bacteria 4577686
645 2919690827 2919688452 Bacteria 4595932
646 Ga0501031_0006567
647 SwRhRL2b_contig_2367793
648 ARcpr5yngRDRAFT_c003195
649 ARSoilOldRDRAFT_c001680
650 JGI24736J21556_1003840
651 JGI24746J21847_1001954
652 JGI24739J22299_10012842
653 JGI24033J26618_1002699
654 JGI24033J26618_1004632
655 rootH2_10182878
656 rootL2_10054505
657 rootH1_10053731
658 Ga0065704_10008222
659 Ga0065704_10008344
660 Ga0065704_10012137
661 Ga0065704_10163727
662 Ga0065715_10001363
663 Ga0065707_10002152
664 Ga0065707_10006821
665 Ga0065707_10120943
666 Ga0070676_10002391
667 Ga0070676_10010667
668 Ga0070676_10023736
669 Ga0070670_100034341
670 Ga0070670_100083547
671 Ga0070670_100240053
672 Ga0068869_100000601
673 Ga0068869_100019381
674 Ga0068869_100076262
675 Ga0070680_100087132
676 Ga0070680_100173018
677 Ga0070680_100264088
678 Ga0068868_100017091
679 Ga0070687_100001605
680 Ga0070687_100003314
681 Ga0070687_100098221
682 Ga0070692_10003870
683 Ga0070692_10010183
684 Ga0070692_10023958
685 Ga0070668_100122262
686 Ga0070669_100003546
687 Ga0070669_100067935
688 Ga0070669_100113730
689 Ga0070669_100130243
690 Ga0070675_100019080
691 Ga0070671_100142555
692 Ga0070671_100348733
693 Ga0070673_100006123
694 Ga0070710_10113960
695 Ga0070701_10031999
696 Ga0070701_10033371
697 Ga0070705_100004076
698 Ga0070700_100015656
699 Ga0070694_100007626
700 Ga0070694_100027811
701 Ga0070694_100029682
702 Ga0070694_100143749
703 Ga0070662_100023699
704 Ga0070662_100042742
705 Ga0070662_100104050
706 Ga0070662_100271935
707 Ga0070681_10019748
708 Ga0070681_10044428
709 Ga0070681_10362104
710 Ga0068867_100011842
711 Ga0068867_100048620
712 Ga0068867_100162820
713 Ga0068867_100192359
714 Ga0070698_100120126
715 Ga0070698_100366582
716 Ga0070679_100110516
717 Ga0068853_100000199
718 Ga0068853_100147725
719 Ga0070672_100003830
720 Ga0070672_100059851
721 Ga0070686_100018805
722 Ga0070695_100028111
723 Ga0070696_100024360
724 Ga0070696_100062708
725 Ga0070696_100163411
726 Ga0070693_100025377
727 Ga0070665_100139285
728 Ga0070704_100076309
729 Ga0068855_100017845
730 Ga0070664_100013255
731 Ga0070664_100059691
732 Ga0068857_100058233
733 Ga0068857_100252766
734 Ga0068856_100000034
735 Ga0068856_100069965
736 Ga0070702_100014299
737 Ga0070702_100159508
738 Ga0068852_100205130
739 Ga0068859_100077290
740 Ga0068859_100256871
741 Ga0068864_100031607
742 Ga0068864_100310025
743 Ga0068866_10085873
744 Ga0068861_100399535
745 Ga0068870_10002062
746 Ga0068870_10004612
747 Ga0068870_10018699
748 Ga0068858_100223444
749 Ga0068858_100563967
750 Ga0068860_100000541
751 Ga0068860_100051622
752 Ga0068860_100386223
753 Ga0068862_100022253
754 Ga0068862_100076630
755 Ga0068862_100112532
756 Ga0081455_10002865
757 Ga0081538_10090696
758 Ga0075432_10004767
759 Ga0075427_10001741
760 Ga0097621_100075923
761 Ga0068871_100085880
762 Ga0075428_100022119
763 Ga0075428_100038060
764 Ga0075428_100053455
765 Ga0075428_100076228
766 Ga0075428_100133714
767 Ga0075428_100148578
768 Ga0075431_100084081
769 Ga0075431_100099350
770 Ga0075431_100116937
771 Ga0075431_100329225
772 Ga0075431_100334153
773 Ga0075433_10004169
774 Ga0075433_10082961
775 Ga0075433_10236347
776 Ga0075434_100177916
777 Ga0075434_100183779
778 Ga0075434_100418748
779 Ga0075429_100015389
780 Ga0075429_100018090
781 Ga0075429_100022954
782 Ga0075429_100054171
783 Ga0075429_100112592
784 Ga0075429_100163529
785 Ga0075436_100086708
786 Ga0097620_100077288
787 Ga0097620_100256875
788 Ga0075435_100305442
789 Ga0111539_10010939
790 Ga0111539_10058887
791 Ga0111539_10077009
792 Ga0111539_10156317
793 Ga0105245_10065235
794 Ga0105247_10099960
795 Ga0114129_10039580
796 Ga0114129_10050708
797 Ga0114129_10077846
798 Ga0114129_10124477
799 Ga0114129_10190997
800 Ga0114129_10269253
801 Ga0105241_10133743
802 Ga0105242_10020085
803 Ga0105242_10050396
804 Ga0105237_10069143
805 Ga0105249_10010727
806 Ga0105249_10070172
807 Ga0105249_10174039
808 Ga0105239_10254196
809 Ga0105246_10025168
810 Ga0105246_10080099
811 Ga0105246_10144955
812 Ga0157341_1001535
813 Ga0157319_1000463
814 Ga0157314_1003168
815 Ga0157327_1003001
816 Ga0157371_10017664
817 Ga0157371_10173212
818 Ga0157374_10005815
819 Ga0157374_10016187
820 Ga0157378_10013746
821 Ga0157378_10082474
822 Ga0157378_10257298
823 Ga0163162_10100136
824 Ga0157372_10203069
825 Ga0157375_10018965
826 Ga0157377_10009152
827 Ga0157379_10054048
828 Ga0163161_10024426
829 Ga0213873_10007667
830 Ga0213876_10017591
831 Ga0207673_1000921
832 Ga0207697_10000379
833 Ga0207682_10023626
834 Ga0207642_10107084
835 Ga0207688_10005645
836 Ga0207688_10031681
837 Ga0207647_10001306
838 Ga0207647_10008480
839 Ga0207645_10001665
840 Ga0207645_10003325
841 Ga0207643_10000731
842 Ga0207643_10001601
843 Ga0207643_10003647
844 Ga0207707_10194218
845 Ga0207693_10259038
846 Ga0207660_10063110
847 Ga0207660_10222985
848 Ga0207662_10000610
849 Ga0207662_10004384
850 Ga0207649_10000385
851 Ga0207649_10256254
852 Ga0207646_10327832
853 Ga0207681_10009198
854 Ga0207681_10056302
855 Ga0207650_10112887
856 Ga0207650_10152875
857 Ga0207650_10179112
858 Ga0207659_10007461
859 Ga0207687_10059683
860 Ga0207706_10013739
861 Ga0207706_10036783
862 Ga0207670_10120975
863 Ga0207691_10009637
864 Ga0207691_10014411
865 Ga0207691_10089602
866 Ga0207689_10001717
867 Ga0207689_10054222
868 Ga0207689_10094096
869 Ga0207679_10211111
870 Ga0207667_10005563
871 Ga0207712_10001734
872 Ga0207712_10012230
873 Ga0207712_10052709
874 Ga0207668_10048331
875 Ga0207668_10118684
876 Ga0207677_10002331
877 Ga0207703_10003856
878 Ga0207703_10122122
879 Ga0207639_10000235
880 Ga0207639_10353628
881 Ga0207708_10035267
882 Ga0207708_10041291
883 Ga0207702_10000924
884 Ga0207648_10002870
885 Ga0207648_10008095
886 Ga0207648_10050746
887 Ga0207676_10025088
888 Ga0207676_10121248
889 Ga0207676_10254177
890 Ga0207674_10119741
891 Ga0207674_10303825
892 Ga0207675_100515648
893 Ga0207683_10017986
894 Ga0209969_1000229
895 Ga0209967_1000367
896 Ga0209967_1000580
897 Ga0209967_1006308
898 Ga0209996_1002844
899 Ga0209996_1011718
900 Ga0209984_1001384
901 Ga0209984_1002984
902 Ga0210000_1001246
903 Ga0210000_1002076
904 Ga0209968_1001681
905 Ga0209999_1000999
906 Ga0209999_1010987
907 Ga0209982_1001346
908 Ga0209982_1002666
909 Ga0209970_1004838
910 Ga0209970_1011192
911 Ga0210002_1001108
912 Ga0210002_1003115
913 Ga0210002_1004774
914 Ga0209983_1007101
915 Ga0209971_1012364
916 Ga0209971_1018556
917 Ga0209998_10001071
918 Ga0209998_10008187
919 Ga0207428_10000225
920 Ga0207428_10000999
921 Ga0207428_10039195
922 Ga0207428_10098156
923 Ga0268265_10005877
924 Ga0268265_10018810
925 Ga0268265_10289791
926 Ga0268265_10323655
927 Ga0268264_10000513
928 Ga0268264_10005582
929 Ga0265337_1011697
930 Ga0265323_10006598
931 Ga0265323_10039083
932 Ga0265338_10000028
933 Ga0265338_10044775
934 Ga0265330_10012388
935 Ga0265330_10050405
936 Ga0265320_10000064
937 Ga0265339_10072560
938 Ga0265327_10018703
939 Ga0265316_10053323
940 Ga0265316_10173777
941 Ga0265313_10043193
942 Ga0316575_10003979
943 Ga0316575_10067006
944 Ga0316575_10074090
945 Ga0316579_10006464
946 Ga0316579_10057439
947 Ga0316579_10060675
948 Ga0265342_10058443
949 Ga0316576_10000301
950 Ga0316576_10000803
951 Ga0316576_10028239
952 Ga0316576_10064140
953 Ga0316576_10105281
954 Ga0316576_10112288
955 Ga0316576_10116739
956 Ga0316576_10216137
957 Ga0316576_10244535
958 Ga0316578_10012162
959 Ga0316578_10032837
960 Ga0316578_10073213
961 Ga0316578_10079322
962 Ga0316578_10095232
963 Ga0316578_10112243
964 Ga0316578_10173715
965 Ga0316577_10159182
966 Ga0307413_10145628
967 Ga0307410_10255280
968 Ga0307406_10055409
969 Ga0307416_100308748
970 Ga0316583_10002551
971 Ga0316583_10013150
972 Ga0316583_10015290
973 Ga0316583_10050303
974 Ga0316583_10094809
975 Ga0316585_10056169
976 Ga0316580_10001837
977 Ga0316580_10005038
978 Ga0316580_10010779
979 Ga0316593_10000768
980 Ga0316593_10026090
981 Ga0316593_10047983
982 Ga0316592_1014660
983 Ga0316588_1020768
984 Ga0316596_1003846
985 Ga0373940_0015128
986 Ga0373952_0015117
987 Ga0373932_0008364
988 Ga0316574_0009701
989 Ga0316574_0093602
990 Ga0316574_0165427
991 Ga0316582_0062584
992 Ga0316582_0065681
993 Ga0316582_0067708
994 Ga0316582_0085428
995 Ga0316582_0138175
996 Ga0316582_0204487
997 Ga0316582_0249264
998 Ga0316584_0005301
999 Ga0316584_0006411
1000 Ga0316584_0008435
1001 Ga0316584_0040331
1002 Ga0316584_0050666
1003 Ga0316584_0148559
1004 Ga0316584_0150781
1005 Ga0395899_0000032
1006 Ga0395900_0007484
1007 Ga0395900_0118736
1008 Ga0395898_0000012
1009 Ga0395905_0006555
1010 Ga0395905_0078994
1011 Ga0395905_0085917
1012 Ga0395901_0142486
1013 Ga0395901_0208693
1014 Ga0395901_0476918
1015 Ga0436365_0167594
1016 Ga0436365_1720376
1017 Ga0436362_0328787
1018 Ga0436362_0447478
1019 Ga0439453_0001649
1020 Ga0439466_0008005
1021 Ga0451843_0941248
1022 Ga0439431_0005230
1023 Ga0439437_002828
1024 Ga0439441_000304
1025 Ga0439432_017179
1026 Ga0439450_000251
1027 Ga0439451_025372
1028 Ga0439454_008861
1029 Ga0439455_0008436
1030 Ga0439456_006314
1031 Ga0439434_0030899
1032 Ga0439435_0014319
1033 Ga0439444_0002146
1034 Ga0439444_0028025
1035 Ga0439464_0001176
1036 Ga0439460_0016592
1037 Ga0439460_0061932
1038 Ga0450893_0004916
1039 Ga0451577_0009415
1040 Ga0451577_0061295
1041 Ga0451577_0189692
1042 Ga0439440_0000516
1043 Ga0439440_0042395
1044 Ga0453683_0009178
1045 Ga0466964_0011670
1046 Ga0453684_0000185
1047 Ga0453684_0000702
1048 Ga0453684_0001222
1049 Ga0453684_0050369
1050 Ga0453684_0137268
1051 Ga0453684_0312637
1052 Ga0453684_0355087
1053 Ga0466971_0000075
1054 Ga0466957_0004450
1055 Ga0451576_0000266
1056 Ga0451576_0001622
1057 Ga0451576_0030346
1058 Ga0466967_0014174
1059 Ga0495621_0041076
1060 Ga0495656_0003937
1061 Ga0495668_0006308
1062 Ga0495659_0103472
1063 Ga0495636_0000200
1064 Ga0495636_0003457
1065 Ga0495674_0045342
1066 Ga0496100_0215144
1067 Ga0496106_0012930
1068 Ga0496108_0054268
1069 Ga0496109_0088594
1070 Ga0496112_0156015
1071 Ga0496113_0018021
1072 Ga0501031_0022565
1073 Ga0501031_0025338
1074 Ga0501031_0035548
1075 Ga0501031_0061184
1076 Ga0501031_0181374
1077 Ga0501032_0000058
1078 Ga0501032_0012640
1079 Ga0501032_0033042
1080 Ga0501033_0000001
1081 Ga0501033_0028548
1082 Ga0501033_0049310
1083 Ga0501033_0168928
1084 Ga0501034_0020851
1085 Ga0501034_0032006
1086 Ga0501036_0022157
1087 Ga0501036_0063587
1088 Ga0501036_0094046
1089 Ga0501036_0108595
1090 Ga0501036_0128831
1091 Ga0501036_0142666
1092 Ga0501036_0241956
1093 Ga0501036_0314343
1094 Ga0501037_0000019
1095 Ga0501037_0014274
1096 Ga0501037_0024953
1097 Ga0501037_0054592
1098 Ga0501037_0064029
1099 Ga0501037_0065954
1100 Ga0501037_0091750
1101 Ga0501037_0233943
1102 Ga0501038_0050843
1103 Ga0501038_0064361
1104 Ga0501038_0094363
1105 Ga0501038_0099188
1106 Ga0501038_0127572
1107 Ga0501038_0159596
1108 Ga0501038_0351264
1109 Ga0501038_0388645
1110 Ga0501039_0000537
1111 Ga0501039_0000857
1112 Ga0501039_0001005
1113 Ga0501039_0047683
1114 Ga0501039_0166820
1115 Ga0501039_0241956
1116 Ga0501040_0000508
1117 Ga0501040_0034072
1118 Ga0501041_0007419
1119 Ga0501041_0008471
1120 Ga0501041_0028624
1121 Ga0501041_0029828
1122 Ga0501041_0069550
1123 Ga0501041_0086215
1124 Ga0501042_0096363
1125 Ga0501042_0097646
1126 Ga0501042_0129218
1127 Ga0501042_0167464
1128 Ga0501043_0002115
1129 Ga0501043_0006100
1130 Ga0501043_0016384
1131 Ga0501043_0020144
1132 Ga0501043_0024942
1133 Ga0501043_0032503
1134 Ga0501043_0119557
1135 Ga0501043_0148966
1136 Ga0501046_0012517
1137 Ga0501046_0049415
1138 Ga0501046_0113103
1139 Ga0501046_0347577
1140 Ga0501047_0005756
1141 Ga0501047_0034043
1142 Ga0501047_0057904
1143 Ga0501047_0122048
1144 Ga0501047_0251442
1145 Ga0501048_0000444
1146 Ga0501048_0000921
1147 Ga0501048_0005160
1148 Ga0501048_0209240
1149 Ga0501048_0233696
1150 Ga0501068_0048444
1151 Ga0501070_0002048
1152 Ga0501070_0404370
1153 Ga0501071_0001768
1154 Ga0501071_0006617
1155 Ga0501071_0008409
1156 Ga0501071_0044066
1157 Ga0501071_0069559
1158 Ga0501071_0133619
1159 Ga0501071_0190217
1160 Ga0501071_0359213
1161 Ga0501072_0000206
1162 Ga0501072_0007223
1163 Ga0501072_0088126
1164 Ga0501072_0126698
1165 Ga0501072_0150654
1166 Ga0501072_0161874
1167 Ga0501072_0238145
1168 Ga0501074_0023757
1169 Ga0501074_0026547
1170 Ga0501074_0216644
1171 Ga0501074_0233699
1172 Ga0501075_0004565
1173 Ga0501075_0038973
1174 Ga0501075_0048691
1175 Ga0501075_0142850
1176 Ga0501075_0155175
1177 Ga0501075_0251008
1178 Ga0501075_0251362
1179 Ga0501076_0001650
1180 Ga0501076_0002218
1181 Ga0501076_0021364
1182 Ga0501076_0070737
1183 Ga0501076_0236602
1184 Ga0501077_0014100
1185 Ga0501077_0014603
1186 Ga0501077_0020609
1187 Ga0501077_0040590
1188 Ga0501077_0131875
1189 Ga0501079_0001465
1190 Ga0501079_0015637
1191 Ga0501079_0488839
1192 Ga0501080_0004181
1193 Ga0501080_0010193
1194 Ga0501080_0032772
1195 Ga0501081_0005949
1196 Ga0501081_0007667
1197 Ga0501081_0147879
1198 Ga0501081_0160186
1199 Ga0501083_0177544
1200 Ga0501035_0000004
1201 Ga0501035_0009543
1202 Ga0501035_0012113
1203 Ga0501035_0017085
1204 Ga0501035_0018384
1205 Ga0501035_0040072
1206 Ga0501035_0223592
1207 Ga0501035_0474690
1208 Ga0501044_0002619
1209 Ga0501044_0007157
1210 Ga0501044_0040632
1211 Ga0501044_0118648
1212 Ga0501044_0342473
1213 Ga0501045_0020828
1214 Ga0501045_0049292
1215 Ga0501045_0070548
1216 Ga0501045_0108197
1217 Ga0501045_0126439
1218 Ga0501045_0228438
1219 nmdc:mga0k408_173758_c1
1220 nmdc:mga0k408_179061_c1
1221 nmdc:mga05p37_117082_c1
1222 nmdc:mga05p37_149975_c1
1223 nmdc:mga05p37_309259_c1
1224 nmdc:mga05p37_316426_c1
1225 nmdc:mga05p37_348572_c1
1226 nmdc:mga05p37_41981_c1
1227 nmdc:mga05p37_45036_c1
1228 nmdc:mga05p37_5567_c1
1229 nmdc:mga05p37_88491_c1
1230 nmdc:mga09592_10090_c1
1231 nmdc:mga09592_12781_c1
1232 nmdc:mga09592_12880_c1
1233 nmdc:mga09592_14263_c1
1234 nmdc:mga09592_19749_c1
1235 nmdc:mga09592_50700_c1
1236 nmdc:mga09592_93682_c1
1237 nmdc:mga0qj67_25095_c1
1238 nmdc:mga0qj67_303805_c1
1239 nmdc:mga0qj67_366108_c1
1240 nmdc:mga0qj67_79219_c1
1241 nmdc:mga06r32_11176_c1
1242 nmdc:mga06r32_138522_c1
1243 nmdc:mga06r32_191703_c1
1244 nmdc:mga06r32_216146_c1
1245 nmdc:mga06r32_222253_c1
1246 nmdc:mga06r32_436422_c1
1247 nmdc:mga06r32_463215_c1
1248 nmdc:mga06r32_58751_c1
1249 nmdc:mga06r32_99872_c1
1250 nmdc:mga08y16_1099_c1
1251 nmdc:mga08y16_120161_c1
1252 nmdc:mga08y16_219659_c1
1253 nmdc:mga08y16_325664_c1
1254 nmdc:mga08y16_82040_c1
1255 nmdc:mga0n895_2037_c1
1256 nmdc:mga0n895_336368_c1
1257 nmdc:mga0n895_45709_c1
1258 nmdc:mga0n895_5476_c1
1259 nmdc:mga0n895_95256_c1
1260 nmdc:mga0rr50_173741_c1
1261 nmdc:mga08x19_74599_c1
1262 nmdc:mga0a205_11830_c1
1263 nmdc:mga0a205_21061_c1
1264 nmdc:mga0a205_284196_c1
1265 nmdc:mga0a205_49147_c1
1266 nmdc:mga0a205_78994_c1
1267 Ga0500604_0036720
1268 Ga0500616_0010909
1269 Ga0501084_0007746
1270 Ga0501084_0009036
1271 Ga0501084_0015093
1272 Ga0501084_0039112
1273 Ga0501084_0370708
1274 Ga0501082_0000314
1275 Ga0501082_0016300
1276 Ga0501082_0040351
1277 Ga0501082_0076428
1278 Ga0501082_0096885
1279 Ga0501082_0157888
1280 Ga0466962_0000025
1281 Ga0530510_0001674
1282 Ga0530510_0021231
1283 Ga0530510_0063167
1284 Ga0530510_0075232
1285 Ga0530510_0224783
1286 2572254340
1287 2691330553
1288 2738714133
1289 2919535582
1290 2919690827

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

210

333

0.95

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

60

171

0.93

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

242

366

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c49-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase from acinetobacter baumannii 0.9707 2 335
7bu3-assembly1.cif.gz_A structure of alcohol dehydrogenase yjgb in complex with nadp from escherichia coli 0.9665 1 332
6c49-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase from acinetobacter baumannii 0.9651 2 335
8a3n-assembly1.cif.gz_A geissoschizine synthase from catharanthus roseus - binary complex with nadp+ 0.9617 1 332
5h83-assembly1.cif.gz_B heteroyohimbine synthase hys from catharanthus roseus - apo form 0.961 1 332
ID Description Score Start End Superfamily
af_P27250_2_339_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9822 1 335 1.10.510.10
af_P27250_2_339_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9793 1 335 1.10.510.10
af_P27250_3_152_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9753 3 149 3.90.180.10
af_Q04894_6_172_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9656 3 157 3.90.180.10
6c49A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9627 151 303 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0C1L6P3-F1-model_v4 Alcohol dehydrogenase 0.9898 1 335 GO:0008270
GO:0016616
AF-A0A1L6L0U5-F1-model_v4 deleted 0.988 1 238
AF-A0A0C1L6P3-F1-model_v4 Alcohol dehydrogenase 0.9868 1 335 GO:0008270
GO:0016616
AF-A0A349X6Y8-F1-model_v4 Alcohol dehydrogenase 0.9866 1 296 GO:0008270
GO:0016616
AF-A0A314WBY3-F1-model_v4 Alcohol dehydrogenase 0.9784 1 335 GO:0008270
GO:0016616

Map