F472138

General Info

Members Datasets Scaffolds Average Seq Length
645 382 1290 88

Family's Representative Sequence

Representative Sequence 3300027682|Ga0209971_1003823|Ga0209971_10038235
Length 80
Sequence MIKTRTTISNQLGLHARASAKLTKVAASFPCDVWMLRGERRINAKSIMGVMMLAAGMGPQEQEAMDALLAMIDDKFGEGQ

Samples

Sample ID Description Type Environment
1 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
99 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
116 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
132 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
133 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
136 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
137 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
138 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
202 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
203 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
208 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
209 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
210 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
211 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
212 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
213 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
214 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
215 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
216 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
217 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
218 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
219 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
220 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
234 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
246 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
247 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
248 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
249 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
250 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
251 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
252 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
253 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
254 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
255 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
256 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
257 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
258 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
259 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
260 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
261 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
262 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
263 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
264 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
265 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
266 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
267 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
268 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
269 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
270 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
271 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
272 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
273 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
274 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
275 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
276 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
277 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
278 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
279 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
280 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
281 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
282 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
283 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
284 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
285 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
286 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
287 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
288 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
289 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
290 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
291 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
292 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
293 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
294 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
295 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
296 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
297 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
298 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
299 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
300 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
301 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
305 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
306 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
307 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
308 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
309 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
310 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
311 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
312 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
313 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
314 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
315 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
316 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
317 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
318 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
319 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
326 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
327 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
328 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
329 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
330 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
331 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
332 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
333 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
334 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
335 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
336 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
337 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
338 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
339 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
340 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
341 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
342 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
343 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
344 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
345 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
346 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
347 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
348 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
349 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
350 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
351 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
352 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
353 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
354 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
355 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
356 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
357 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
358 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
359 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
360 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
361 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
362 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
363 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
364 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
365 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
366 2643221658 Variovorax sp. Root411 Isolate Unclassified
367 2643221672 Variovorax sp. Root434 Isolate Unclassified
368 2738541277 Variovorax sp. GV051 Isolate Unclassified
369 2738541307 Variovorax sp. GV008 Isolate Unclassified
370 2738543019 Variovorax sp. GV040 Isolate Unclassified
371 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
372 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
373 2842677519 Variovorax sp. R-72495 Isolate Unclassified
374 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
375 2904456579 Variovorax sp. 2002 Isolate Unclassified
376 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
377 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
378 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
379 2929520902 Variovorax beijingensis 502 Isolate Unclassified
380 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
381 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
382 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 0.31
Isolates 2.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.74
Nodule 0.93
Rhizoplane 0.93
Rhizosphere 75.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209971_1003823 3300027682 Bacteria 3560
2 JGI24740J21852_10001224 3300001979 Bacteria 11607
3 JGI24739J22299_10018116 3300001989 Bacteria 2534
4 JGI25150J39212_1018804 3300002774 Bacteria 1094
5 JGI25159J45721_1003727 3300002987 Bacteria 5282
6 JGI25151J46595_10006148 3300003187 Bacteria 6084
7 JGI25151J46595_10010700 3300003187 Bacteria 4245
8 rootL2_10044452 3300003322 Bacteria 3930
9 JGI25160J50197_1006708 3300003354 Bacteria 4624
10 JGI25161J50226_1008737 3300003374 Bacteria 1523
11 Ga0006562J51391_1042062 3300003578 Bacteria 5050
12 Ga0006562J51391_1043803 3300003578 Bacteria 6923
13 Ga0055526_1009611 3300003771 Bacteria 4624
14 Ga0055537_1000438 3300003773 Bacteria 26662
15 Ga0055537_1005515 3300003773 Bacteria 3381
16 Ga0055537_1023022 3300003773 Bacteria 898
17 Ga0055524_1007198 3300003775 Bacteria 4759
18 Ga0055536_1006419 3300003781 Bacteria 5499
19 Ga0055536_1007569 3300003781 Bacteria 4830
20 Ga0055534_1000402 3300003784 Bacteria 26659
21 Ga0055534_1002184 3300003784 Bacteria 6986
22 Ga0055528_1035077 3300003790 Bacteria 1224
23 Ga0055530_10006090 3300003791 Bacteria 5499
24 Ga0055530_10014873 3300003791 Bacteria 2569
25 Ga0055530_10045729 3300003791 Bacteria 1043
26 Ga0055540_1004303 3300003792 Bacteria 6495
27 Ga0055540_1005424 3300003792 Bacteria 5360
28 Ga0055531_10004803 3300003794 Bacteria 8072
29 Ga0055531_10008584 3300003794 Bacteria 5360
30 Ga0055531_10053133 3300003794 Bacteria 1049
31 Ga0055543_1010104 3300004625 Bacteria 1994
32 Ga0065714_10011567 3300005288 Bacteria 2276
33 Ga0065712_10203787 3300005290 Bacteria 1096
34 Ga0065707_10106840 3300005295 Bacteria 2569
35 Ga0070690_101112212 3300005330 Bacteria 627
36 Ga0070670_100703056 3300005331 Bacteria 909
37 Ga0070670_101303983 3300005331 Bacteria 665
38 Ga0070677_10312158 3300005333 Bacteria 803
39 Ga0068869_100112933 3300005334 Bacteria 2069
40 Ga0070666_10341911 3300005335 Bacteria 1069
41 Ga0070680_100268670 3300005336 Bacteria 1444
42 Ga0068868_101034611 3300005338 Bacteria 753
43 Ga0070660_100382042 3300005339 Bacteria 1163
44 Ga0070660_100724065 3300005339 Bacteria 835
45 Ga0070660_101463036 3300005339 Bacteria 581
46 Ga0070689_100075545 3300005340 Bacteria 2638
47 Ga0070689_101882175 3300005340 Bacteria 546
48 Ga0070687_101386822 3300005343 Bacteria 525
49 Ga0070661_100122358 3300005344 Bacteria 1950
50 Ga0070692_10033176 3300005345 Bacteria 2601
51 Ga0070668_100052466 3300005347 Bacteria 3143
52 Ga0070669_100000876 3300005353 Bacteria 21910
53 Ga0070669_100022558 3300005353 Bacteria 4501
54 Ga0070675_100016359 3300005354 Bacteria 5886
55 Ga0070674_100091466 3300005356 Bacteria 2197
56 Ga0070673_100195783 3300005364 Bacteria 1738
57 Ga0070673_101898390 3300005364 Bacteria 565
58 Ga0070688_100071889 3300005365 Bacteria 2215
59 Ga0070659_100027346 3300005366 Bacteria 4395
60 Ga0070659_100197362 3300005366 Bacteria 1655
61 Ga0070659_102149871 3300005366 Bacteria 502
62 Ga0070714_100029629 3300005435 Bacteria 4550
63 Ga0070714_100756054 3300005435 Bacteria 940
64 Ga0070714_101597923 3300005435 Bacteria 637
65 Ga0070713_100367307 3300005436 Bacteria 1338
66 Ga0070701_10033016 3300005438 Bacteria 2583
67 Ga0070701_10585747 3300005438 Bacteria 737
68 Ga0070711_101153647 3300005439 Bacteria 669
69 Ga0070705_100184144 3300005440 Bacteria 1417
70 Ga0070705_100489117 3300005440 Bacteria 931
71 Ga0070700_100000737 3300005441 Bacteria 16158
72 Ga0070700_100296168 3300005441 Bacteria 1179
73 Ga0070694_100299480 3300005444 Bacteria 1232
74 Ga0070708_100201576 3300005445 Bacteria 1863
75 Ga0070663_101472112 3300005455 Bacteria 605
76 Ga0070678_100416958 3300005456 Bacteria 1169
77 Ga0070678_102219351 3300005456 Bacteria 521
78 Ga0070662_100455250 3300005457 Bacteria 1063
79 Ga0070681_11665036 3300005458 Bacteria 564
80 Ga0068867_100001458 3300005459 Bacteria 16395
81 Ga0068867_100517998 3300005459 Bacteria 1028
82 Ga0068867_102265907 3300005459 Bacteria 516
83 Ga0070685_10438347 3300005466 Bacteria 912
84 Ga0070706_100213454 3300005467 Bacteria 1802
85 Ga0070698_100720741 3300005471 Bacteria 940
86 Ga0070698_100752116 3300005471 Bacteria 918
87 Ga0070699_100234163 3300005518 Bacteria 1638
88 Ga0070699_100693790 3300005518 Bacteria 930
89 Ga0070699_101121502 3300005518 Bacteria 721
90 Ga0070684_100077227 3300005535 Bacteria 2941
91 Ga0070697_100050810 3300005536 Bacteria 3366
92 Ga0070697_101991278 3300005536 Bacteria 520
93 Ga0068853_100028042 3300005539 Bacteria 4736
94 Ga0068853_100799642 3300005539 Bacteria 903
95 Ga0068853_101423543 3300005539 Bacteria 671
96 Ga0070672_100027653 3300005543 Bacteria 4233
97 Ga0070672_100466798 3300005543 Bacteria 1089
98 Ga0070686_101113474 3300005544 Bacteria 653
99 Ga0070695_100001729 3300005545 Bacteria 12278
100 Ga0070696_100010522 3300005546 Bacteria 6200
101 Ga0070696_100090315 3300005546 Bacteria 2179
102 Ga0070693_100133307 3300005547 Bacteria 1556
103 Ga0070704_100071241 3300005549 Bacteria 2525
104 Ga0070704_101276796 3300005549 Bacteria 671
105 Ga0070704_101404199 3300005549 Bacteria 641
106 Ga0070704_101774300 3300005549 Bacteria 571
107 Ga0068855_100003915 3300005563 Bacteria 18175
108 Ga0068855_100202209 3300005563 Bacteria 2236
109 Ga0068855_100259774 3300005563 Bacteria 1935
110 Ga0068857_100071166 3300005577 Bacteria 3099
111 Ga0068857_100244442 3300005577 Bacteria 1644
112 Ga0068857_100490930 3300005577 Bacteria 1151
113 Ga0068857_100561656 3300005577 Bacteria 1076
114 Ga0068854_101303905 3300005578 Bacteria 654
115 Ga0068854_101713709 3300005578 Bacteria 575
116 Ga0068856_100174270 3300005614 Bacteria 2164
117 Ga0068856_101635035 3300005614 Bacteria 657
118 Ga0068852_100003888 3300005616 Bacteria 10494
119 Ga0068852_100101111 3300005616 Bacteria 2602
120 Ga0068852_100210722 3300005616 Bacteria 1843
121 Ga0068852_100227025 3300005616 Bacteria 1779
122 Ga0068852_102287042 3300005616 Bacteria 562
123 Ga0068852_102427769 3300005616 Bacteria 545
124 Ga0068859_100065940 3300005617 Bacteria 3655
125 Ga0068859_100214510 3300005617 Bacteria 2012
126 Ga0068859_100395951 3300005617 Bacteria 1477
127 Ga0068866_10282468 3300005718 Bacteria 1029
128 Ga0068861_100038271 3300005719 Bacteria 3570
129 Ga0068858_100169397 3300005842 Bacteria 2059
130 Ga0068862_100635008 3300005844 Bacteria 1028
131 Ga0081539_10082478 3300005985 Bacteria 1685
132 Ga0075365_10009390 3300006038 Bacteria 5619
133 Ga0075365_10748254 3300006038 Bacteria 690
134 Ga0075365_11200456 3300006038 Bacteria 534
135 Ga0075363_100133735 3300006048 Bacteria 1392
136 Ga0075363_100535657 3300006048 Bacteria 698
137 Ga0075364_10012265 3300006051 Bacteria 5240
138 Ga0075364_10487654 3300006051 Bacteria 842
139 Ga0075432_10003588 3300006058 Bacteria 5270
140 Ga0070716_100302463 3300006173 Bacteria 1113
141 Ga0075362_10006731 3300006177 Bacteria 4296
142 Ga0075367_10079207 3300006178 Bacteria 1985
143 Ga0075367_10952848 3300006178 Bacteria 548
144 Ga0075369_10069888 3300006186 Bacteria 1544
145 Ga0075366_10066964 3300006195 Bacteria 2137
146 Ga0075366_10139490 3300006195 Bacteria 1465
147 Ga0075366_10415087 3300006195 Bacteria 829
148 Ga0075366_10815453 3300006195 Bacteria 581
149 Ga0097621_100279299 3300006237 Bacteria 1470
150 Ga0097621_100511437 3300006237 Bacteria 1089
151 Ga0097621_101422785 3300006237 Bacteria 657
152 Ga0075370_10010803 3300006353 Bacteria 4786
153 Ga0075370_10015211 3300006353 Bacteria 4114
154 Ga0075370_10383816 3300006353 Bacteria 842
155 Ga0075370_10485990 3300006353 Bacteria 744
156 Ga0075370_10531741 3300006353 Bacteria 710
157 Ga0075370_10532222 3300006353 Bacteria 710
158 Ga0075428_101897437 3300006844 Bacteria 619
159 Ga0075430_100397914 3300006846 Bacteria 1137
160 Ga0075431_100369762 3300006847 Bacteria 1439
161 Ga0075434_102211736 3300006871 Bacteria 554
162 Ga0068865_100001000 3300006881 Bacteria 16237
163 Ga0068865_100214393 3300006881 Bacteria 1502
164 Ga0068865_100443238 3300006881 Bacteria 1072
165 Ga0075436_100013043 3300006914 Bacteria 5698
166 Ga0075436_100016906 3300006914 Bacteria 4992
167 Ga0075436_100081791 3300006914 Bacteria 2239
168 Ga0097620_100065939 3300006931 Bacteria 3655
169 Ga0097620_100214500 3300006931 Bacteria 2012
170 Ga0097620_100395945 3300006931 Bacteria 1477
171 Ga0079104_1012971 3300006946 Bacteria 2591
172 Ga0099826_10018442 3300006948 Bacteria 5265
173 Ga0099826_10235654 3300006948 Bacteria 975
174 Ga0075435_100626097 3300007076 Bacteria 933
175 Ga0105251_10239391 3300009011 Bacteria 817
176 Ga0105244_10009389 3300009036 Bacteria 6018
177 Ga0105240_10017082 3300009093 Bacteria 9797
178 Ga0105240_10019527 3300009093 Bacteria 9051
179 Ga0105240_10379868 3300009093 Bacteria 1596
180 Ga0105240_10417106 3300009093 Bacteria 1509
181 Ga0105240_11114871 3300009093 Bacteria 839
182 Ga0111539_10069837 3300009094 Bacteria 4147
183 Ga0105245_11868667 3300009098 Bacteria 654
184 Ga0105245_12216888 3300009098 Bacteria 603
185 Ga0114129_12832388 3300009147 Bacteria 575
186 Ga0105243_10000643 3300009148 Bacteria 34604
187 Ga0105243_10002799 3300009148 Bacteria 14478
188 Ga0105243_10007953 3300009148 Bacteria 8145
189 Ga0105241_11793122 3300009174 Bacteria 599
190 Ga0105242_10054928 3300009176 Bacteria 3257
191 Ga0105242_10483088 3300009176 Bacteria 1174
192 Ga0105237_10079598 3300009545 Bacteria 3267
193 Ga0105238_10027287 3300009551 Bacteria 5817
194 Ga0105238_10162292 3300009551 Bacteria 2210
195 Ga0105238_10309353 3300009551 Bacteria 1565
196 Ga0105238_10768052 3300009551 Bacteria 978
197 Ga0105238_10818527 3300009551 Bacteria 947
198 Ga0105238_11152531 3300009551 Bacteria 799
199 Ga0105249_10106137 3300009553 Bacteria 2649
200 Ga0105249_10356577 3300009553 Bacteria 1483
201 Ga0105239_10137033 3300010375 Bacteria 2725
202 Ga0105239_11777441 3300010375 Bacteria 714
203 Ga0105246_10123063 3300011119 Bacteria 1925
204 Ga0105246_11888757 3300011119 Bacteria 573
205 Ga0157347_1004058 3300012502 Bacteria 1343
206 Ga0157339_1001058 3300012505 Bacteria 1588
207 Ga0157373_10814153 3300013100 Bacteria 689
208 Ga0157373_10849461 3300013100 Bacteria 675
209 Ga0157371_10822189 3300013102 Bacteria 701
210 Ga0157370_10023403 3300013104 Bacteria 6132
211 Ga0157370_10500149 3300013104 Bacteria 1116
212 Ga0157369_10002911 3300013105 Bacteria 20469
213 Ga0157369_10280510 3300013105 Bacteria 1735
214 Ga0157369_11085994 3300013105 Bacteria 818
215 Ga0157369_11153826 3300013105 Bacteria 791
216 Ga0157378_10518090 3300013297 Bacteria 1194
217 Ga0157378_11476983 3300013297 Bacteria 724
218 Ga0163162_10336952 3300013306 Bacteria 1641
219 Ga0157372_10001455 3300013307 Bacteria 25652
220 Ga0157375_10201740 3300013308 Bacteria 2145
221 Ga0157375_11271829 3300013308 Bacteria 864
222 Ga0163163_12540151 3300014325 Bacteria 570
223 Ga0157380_10258187 3300014326 Bacteria 1581
224 Ga0157380_10489974 3300014326 Bacteria 1191
225 Ga0157380_11302676 3300014326 Bacteria 774
226 Ga0157380_11428987 3300014326 Bacteria 743
227 Ga0157380_12094289 3300014326 Bacteria 629
228 Ga0157380_12185527 3300014326 Bacteria 617
229 Ga0182008_10009480 3300014497 Bacteria 5251
230 Ga0182008_10010055 3300014497 Bacteria 5077
231 Ga0182008_10085383 3300014497 Bacteria 1554
232 Ga0157377_10011904 3300014745 Bacteria 4357
233 Ga0157377_10523429 3300014745 Bacteria 833
234 Ga0157379_10711087 3300014968 Bacteria 943
235 Ga0157376_10150627 3300014969 Bacteria 2097
236 Ga0182006_1001981 3300015261 Bacteria 11583
237 Ga0182006_1013682 3300015261 Bacteria 3512
238 Ga0182007_10071618 3300015262 Bacteria 1135
239 Ga0182007_10188089 3300015262 Bacteria 717
240 Ga0182005_1068410 3300015265 Bacteria 974
241 Ga0163161_10000680 3300017792 Bacteria 27157
242 Ga0163161_10019260 3300017792 Bacteria 4785
243 Ga0209436_115376 3300025208 Bacteria 1185
244 Ga0207425_1003177 3300025245 Bacteria 5371
245 Ga0209129_1011103 3300025258 Bacteria 2180
246 Ga0209565_1000496 3300025263 Bacteria 28804
247 Ga0209565_1000578 3300025263 Bacteria 24925
248 Ga0209565_1003687 3300025263 Bacteria 4862
249 Ga0209673_1000690 3300025273 Bacteria 48324
250 Ga0209673_1000985 3300025273 Bacteria 34864
251 Ga0209673_1001088 3300025273 Bacteria 30573
252 Ga0209130_1002077 3300025284 Bacteria 10790
253 Ga0209675_1000093 3300025291 Bacteria 140158
254 Ga0209675_1002295 3300025291 Bacteria 9932
255 Ga0209675_1008044 3300025291 Bacteria 3938
256 Ga0209676_1000802 3300025292 Bacteria 41381
257 Ga0209676_1000868 3300025292 Bacteria 38801
258 Ga0209676_1002903 3300025292 Bacteria 11226
259 Ga0209025_1001188 3300025294 Bacteria 36832
260 Ga0209025_1010058 3300025294 Bacteria 6473
261 Ga0209025_1034005 3300025294 Bacteria 2340
262 Ga0209564_1000223 3300025295 Bacteria 128117
263 Ga0209050_1000224 3300025298 Bacteria 125433
264 Ga0209050_1003606 3300025298 Bacteria 11229
265 Ga0209050_1036848 3300025298 Bacteria 1421
266 Ga0209256_1000174 3300025299 Bacteria 128117
267 Ga0209256_1029005 3300025299 Bacteria 1550
268 Ga0207426_1000232 3300025302 Bacteria 128117
269 Ga0209051_1000313 3300025303 Bacteria 75138
270 Ga0209051_1000656 3300025303 Bacteria 39150
271 Ga0209051_1000658 3300025303 Bacteria 39012
272 Ga0209051_1000690 3300025303 Bacteria 37346
273 Ga0209257_1000163 3300025304 Bacteria 175355
274 Ga0207656_10544189 3300025321 Bacteria 591
275 Ga0207655_1001405 3300025728 Bacteria 22434
276 Ga0207682_10054064 3300025893 Bacteria 1667
277 Ga0207642_10045559 3300025899 Bacteria 1948
278 Ga0207680_10732777 3300025903 Bacteria 709
279 Ga0207647_10224634 3300025904 Bacteria 1081
280 Ga0207645_10020724 3300025907 Bacteria 4298
281 Ga0207645_10465882 3300025907 Bacteria 854
282 Ga0207643_10132111 3300025908 Bacteria 1486
283 Ga0207705_10245090 3300025909 Bacteria 1366
284 Ga0207705_10772616 3300025909 Bacteria 746
285 Ga0207684_10172826 3300025910 Bacteria 1862
286 Ga0207684_11583552 3300025910 Bacteria 531
287 Ga0207654_10981009 3300025911 Bacteria 614
288 Ga0207707_11061140 3300025912 Bacteria 662
289 Ga0207695_10032113 3300025913 Bacteria 5749
290 Ga0207695_10153389 3300025913 Bacteria 2240
291 Ga0207695_11422123 3300025913 Bacteria 574
292 Ga0207660_10284994 3300025917 Bacteria 1312
293 Ga0207662_10026184 3300025918 Bacteria 3363
294 Ga0207657_10159786 3300025919 Bacteria 1831
295 Ga0207657_10929510 3300025919 Bacteria 669
296 Ga0207657_11076246 3300025919 Bacteria 615
297 Ga0207649_10478174 3300025920 Bacteria 944
298 Ga0207649_11024988 3300025920 Bacteria 650
299 Ga0207681_10000560 3300025923 Bacteria 25447
300 Ga0207681_10007126 3300025923 Bacteria 6856
301 Ga0207694_10031527 3300025924 Bacteria 4050
302 Ga0207694_10306947 3300025924 Bacteria 1307
303 Ga0207694_10521896 3300025924 Bacteria 995
304 Ga0207694_11896161 3300025924 Bacteria 500
305 Ga0207650_11804882 3300025925 Bacteria 517
306 Ga0207659_10190929 3300025926 Bacteria 1630
307 Ga0207659_11293710 3300025926 Bacteria 626
308 Ga0207700_11375270 3300025928 Bacteria 628
309 Ga0207664_10034632 3300025929 Bacteria 3890
310 Ga0207664_11128018 3300025929 Bacteria 701
311 Ga0207644_11636577 3300025931 Bacteria 540
312 Ga0207690_10127656 3300025932 Bacteria 1856
313 Ga0207690_10239874 3300025932 Bacteria 1396
314 Ga0207690_11169567 3300025932 Bacteria 642
315 Ga0207690_11213616 3300025932 Bacteria 630
316 Ga0207706_10248848 3300025933 Bacteria 1553
317 Ga0207706_10267201 3300025933 Bacteria 1493
318 Ga0207686_10171432 3300025934 Bacteria 1531
319 Ga0207686_10172976 3300025934 Bacteria 1525
320 Ga0207709_10000490 3300025935 Bacteria 35951
321 Ga0207709_10002126 3300025935 Bacteria 12730
322 Ga0207709_10006652 3300025935 Bacteria 6486
323 Ga0207670_10040230 3300025936 Bacteria 3068
324 Ga0207670_10117059 3300025936 Bacteria 1930
325 Ga0207670_10247624 3300025936 Bacteria 1376
326 Ga0207669_10054972 3300025937 Bacteria 2408
327 Ga0207669_11397653 3300025937 Bacteria 596
328 Ga0207704_10001905 3300025938 Bacteria 9349
329 Ga0207704_10891032 3300025938 Bacteria 748
330 Ga0207665_10273314 3300025939 Bacteria 1255
331 Ga0207691_10047243 3300025940 Bacteria 3951
332 Ga0207691_10544409 3300025940 Bacteria 984
333 Ga0207689_10213106 3300025942 Bacteria 1596
334 Ga0207689_10221072 3300025942 Bacteria 1565
335 Ga0207689_10673478 3300025942 Bacteria 872
336 Ga0207689_10849387 3300025942 Bacteria 770
337 Ga0207661_10189784 3300025944 Bacteria 1801
338 Ga0207679_10017261 3300025945 Bacteria 4811
339 Ga0207667_10001085 3300025949 Bacteria 34518
340 Ga0207667_10072058 3300025949 Bacteria 3591
341 Ga0207667_10121657 3300025949 Bacteria 2689
342 Ga0207712_10001981 3300025961 Bacteria 13422
343 Ga0207712_10796473 3300025961 Bacteria 830
344 Ga0207668_10017087 3300025972 Bacteria 4539
345 Ga0207677_10604406 3300026023 Bacteria 963
346 Ga0207677_10931865 3300026023 Bacteria 784
347 Ga0207703_10138901 3300026035 Bacteria 2107
348 Ga0207639_10023601 3300026041 Bacteria 4442
349 Ga0207639_10032801 3300026041 Bacteria 3826
350 Ga0207639_10747916 3300026041 Bacteria 909
351 Ga0207639_11133629 3300026041 Bacteria 734
352 Ga0207639_11212921 3300026041 Bacteria 708
353 Ga0207678_10124758 3300026067 Bacteria 2197
354 Ga0207708_10001699 3300026075 Bacteria 16293
355 Ga0207708_10752895 3300026075 Bacteria 836
356 Ga0207702_10352877 3300026078 Bacteria 1408
357 Ga0207702_11121742 3300026078 Bacteria 780
358 Ga0207641_10779908 3300026088 Bacteria 945
359 Ga0207641_10852799 3300026088 Bacteria 903
360 Ga0207648_10081466 3300026089 Bacteria 2823
361 Ga0207648_10363566 3300026089 Bacteria 1306
362 Ga0207648_10875928 3300026089 Bacteria 838
363 Ga0207648_11697572 3300026089 Bacteria 593
364 Ga0207674_10041113 3300026116 Bacteria 4783
365 Ga0207674_10376792 3300026116 Bacteria 1372
366 Ga0207674_11306374 3300026116 Bacteria 695
367 Ga0207675_100003269 3300026118 Bacteria 15870
368 Ga0207675_100071751 3300026118 Bacteria 3238
369 Ga0207675_100703927 3300026118 Bacteria 1019
370 Ga0207683_10254032 3300026121 Bacteria 1604
371 Ga0207683_10608513 3300026121 Bacteria 1012
372 Ga0207698_10019886 3300026142 Bacteria 4609
373 Ga0207698_10024004 3300026142 Bacteria 4271
374 Ga0207698_10067871 3300026142 Bacteria 2814
375 Ga0207698_10147644 3300026142 Bacteria 2036
376 Ga0207698_10164641 3300026142 Bacteria 1944
377 Ga0209281_1049272 3300027111 Bacteria 678
378 Ga0209282_1092178 3300027666 Bacteria 1584
379 Ga0209971_1023285 3300027682 Bacteria 1477
380 Ga0209998_10025071 3300027717 Bacteria 1297
381 Ga0207428_10017264 3300027907 Bacteria 6197
382 Ga0207428_10061989 3300027907 Bacteria 2958
383 Ga0268265_10001299 3300028380 Bacteria 21420
384 Ga0265338_10339132 3300028800 Bacteria 1084
385 Ga0316177_1073809 3300030731 Bacteria 2695
386 Ga0316176_1029497 3300030732 Bacteria 1651
387 Ga0314311_1090358 3300030733 Bacteria 3857
388 Ga0316179_1088193 3300030734 Bacteria 1577
389 Ga0316178_1090357 3300030735 Bacteria 2235
390 Ga0316180_1132279 3300030736 Bacteria 1683
391 Ga0316183_1036273 3300030742 Bacteria 11340
392 Ga0316182_1240696 3300030745 Bacteria 2356
393 Ga0265330_10000464 3300031235 Bacteria 27117
394 Ga0265330_10059179 3300031235 Bacteria 1669
395 Ga0265332_10000018 3300031238 Bacteria 224913
396 Ga0265332_10189073 3300031238 Bacteria 857
397 Ga0265325_10005805 3300031241 Bacteria 7565
398 Ga0265325_10065155 3300031241 Bacteria 1841
399 Ga0265340_10219214 3300031247 Bacteria 852
400 Ga0265327_10134207 3300031251 Bacteria 1162
401 Ga0307513_10517543 3300031456 Bacteria 909
402 Ga0307408_100000012 3300031548 Bacteria 408153
403 Ga0307408_100116242 3300031548 Bacteria 2064
404 Ga0307408_100153467 3300031548 Bacteria 1820
405 Ga0307408_100802919 3300031548 Bacteria 854
406 Ga0307408_101639847 3300031548 Bacteria 611
407 Ga0307408_101772455 3300031548 Bacteria 590
408 Ga0307408_101826995 3300031548 Bacteria 581
409 Ga0307514_10017918 3300031649 Bacteria 5818
410 Ga0265314_10001491 3300031711 Bacteria 25976
411 Ga0316576_10060116 3300031727 Bacteria 2783
412 Ga0307405_10011632 3300031731 Bacteria 4624
413 Ga0307405_10074704 3300031731 Bacteria 2193
414 Ga0307405_10210330 3300031731 Bacteria 1419
415 Ga0307405_10309144 3300031731 Bacteria 1202
416 Ga0307405_11021045 3300031731 Bacteria 707
417 Ga0307405_11087623 3300031731 Bacteria 686
418 Ga0307405_11282882 3300031731 Bacteria 636
419 Ga0307413_10446410 3300031824 Bacteria 1025
420 Ga0307413_11583575 3300031824 Bacteria 581
421 Ga0307410_10510974 3300031852 Bacteria 990
422 Ga0307410_10794308 3300031852 Bacteria 804
423 Ga0307410_10842249 3300031852 Bacteria 782
424 Ga0307410_11132674 3300031852 Bacteria 679
425 Ga0307410_11852520 3300031852 Bacteria 536
426 Ga0307406_10005332 3300031901 Bacteria 7037
427 Ga0307406_10368147 3300031901 Bacteria 1129
428 Ga0307406_11782548 3300031901 Bacteria 547
429 Ga0307407_10113837 3300031903 Bacteria 1703
430 Ga0307407_10499261 3300031903 Bacteria 891
431 Ga0307407_10696092 3300031903 Bacteria 765
432 Ga0307412_10229113 3300031911 Bacteria 1429
433 Ga0307412_10253618 3300031911 Bacteria 1367
434 Ga0307412_10373926 3300031911 Bacteria 1151
435 Ga0307412_10605901 3300031911 Bacteria 928
436 Ga0307412_10666429 3300031911 Bacteria 889
437 Ga0307412_11426633 3300031911 Bacteria 627
438 Ga0307409_100957142 3300031995 Bacteria 872
439 Ga0307416_100026542 3300032002 Bacteria 4270
440 Ga0307416_100119832 3300032002 Bacteria 2342
441 Ga0307416_100273959 3300032002 Bacteria 1659
442 Ga0307416_100333892 3300032002 Bacteria 1525
443 Ga0307416_100939158 3300032002 Bacteria 966
444 Ga0307416_101255739 3300032002 Bacteria 846
445 Ga0307416_101402765 3300032002 Bacteria 804
446 Ga0307414_10024044 3300032004 Bacteria 3877
447 Ga0307414_10028304 3300032004 Bacteria 3632
448 Ga0307414_10508481 3300032004 Bacteria 1067
449 Ga0307414_11706341 3300032004 Bacteria 587
450 Ga0307411_10168823 3300032005 Bacteria 1647
451 Ga0307411_10532885 3300032005 Bacteria 999
452 Ga0307411_11855375 3300032005 Bacteria 560
453 Ga0307415_100441250 3300032126 Bacteria 1123
454 Ga0373952_0182098 3300035092 Bacteria 606
455 Ga0373935_0577561 3300035692 Bacteria 821
456 Ga0373927_0046994 3300035695 Bacteria 2792
457 Ga0373947_0170722 3300035725 Bacteria 1411
458 Ga0373937_0197112 3300036401 Bacteria 1893
459 Ga0373925_0005318 3300037068 Bacteria 9608
460 Ga0373925_1117119 3300037068 Bacteria 648
461 Ga0395900_0025554 3300037418 Bacteria 6046
462 Ga0395905_0016176 3300037471 Bacteria 7089
463 Ga0395905_0106268 3300037471 Bacteria 2636
464 Ga0395901_0390865 3300038443 Bacteria 1430
465 Ga0439439_0056014 3300041406 Bacteria 1041
466 Ga0439466_0003533 3300041411 Bacteria 6045
467 Ga0439465_0025877 3300041413 Bacteria 1853
468 Ga0451802_0212090 3300041460 Bacteria 875
469 Ga0451833_0104336 3300041491 Bacteria 707
470 Ga0451835_0830277 3300041492 Bacteria 738
471 Ga0451853_4089157 3300041512 Bacteria 2086
472 Ga0439431_0094936 3300041997 Bacteria 815
473 Ga0439441_030087 3300042001 Bacteria 1048
474 Ga0439441_056689 3300042001 Bacteria 817
475 Ga0439442_033418 3300042002 Bacteria 1075
476 Ga0439445_0072696 3300042004 Bacteria 953
477 Ga0439445_0158606 3300042004 Bacteria 660
478 Ga0439432_141428 3300042006 Bacteria 708
479 Ga0439449_0025883 3300042007 Bacteria 2192
480 Ga0439455_0044621 3300042012 Bacteria 1144
481 Ga0439457_046485 3300042014 Bacteria 971
482 Ga0450919_004848 3300042121 Bacteria 1633
483 Ga0450920_003326 3300042122 Bacteria 2778
484 Ga0450923_027903 3300042125 Bacteria 1137
485 Ga0450890_013987 3300042127 Bacteria 1051
486 Ga0450906_001293 3300042145 Bacteria 5493
487 Ga0450907_016040 3300042146 Bacteria 1249
488 Ga0450910_001111 3300042147 Bacteria 3320
489 Ga0450910_026610 3300042147 Bacteria 894
490 Ga0439458_0084443 3300042157 Bacteria 813
491 Ga0450908_017344 3300042184 Bacteria 1278
492 Ga0439434_0001759 3300042435 Bacteria 6290
493 Ga0439434_0314945 3300042435 Bacteria 542
494 Ga0451577_0001986 3300042876 Bacteria 25597
495 Ga0466972_0011749 3300044658 Bacteria 4397
496 Ga0453683_0484624 3300044673 Bacteria 802
497 Ga0466965_0014239 3300044683 Bacteria 3763
498 Ga0466966_0097421 3300044684 Bacteria 1821
499 Ga0466961_0226134 3300044693 Bacteria 1152
500 Ga0466964_0000264 3300044706 Bacteria 15122
501 Ga0466971_0062415 3300044719 Bacteria 1686
502 Ga0466968_0003021 3300044735 Bacteria 6211
503 Ga0466957_0311115 3300044842 Bacteria 1060
504 Ga0466960_0096217 3300044901 Bacteria 1517
505 Ga0466959_0774935 3300045049 Bacteria 641
506 Ga0451576_0081678 3300045051 Bacteria 3361
507 Ga0451576_0269421 3300045051 Bacteria 1780
508 Ga0466958_0160626 3300045836 Bacteria 1419
509 Ga0495617_153006 3300046452 Bacteria 733
510 Ga0495590_0015967 3300046457 Bacteria 2716
511 Ga0495590_0335243 3300046457 Bacteria 573
512 Ga0495638_0114469 3300046460 Bacteria 1599
513 Ga0495653_0860780 3300046463 Bacteria 542
514 Ga0495584_0003263 3300046491 Bacteria 8989
515 Ga0495594_0092101 3300046499 Bacteria 1699
516 Ga0495594_0156160 3300046499 Bacteria 1296
517 Ga0495607_0005836 3300046501 Bacteria 8756
518 Ga0495583_0002424 3300046506 Bacteria 15992
519 Ga0495606_0223619 3300046507 Bacteria 1059
520 Ga0495610_0177229 3300046512 Bacteria 889
521 Ga0495616_0007850 3300046513 Bacteria 6364
522 Ga0495637_0003535 3300046520 Bacteria 8283
523 Ga0495643_0036422 3300046522 Bacteria 2703
524 Ga0495648_0035939 3300046524 Bacteria 3205
525 Ga0495642_0009549 3300046528 Bacteria 3713
526 Ga0495598_0095145 3300046537 Bacteria 977
527 Ga0495609_0001605 3300046538 Bacteria 14768
528 Ga0495621_0104535 3300046539 Bacteria 1081
529 Ga0495621_0105870 3300046539 Bacteria 1074
530 Ga0495656_0142992 3300046615 Bacteria 1149
531 Ga0495625_0001736 3300046660 Bacteria 25209
532 Ga0495625_0001740 3300046660 Bacteria 25173
533 Ga0495659_0003085 3300046664 Bacteria 5351
534 Ga0495659_0083105 3300046664 Bacteria 1219
535 Ga0495661_0036039 3300046665 Bacteria 3100
536 Ga0495588_0012327 3300046674 Bacteria 4037
537 Ga0495588_0433460 3300046674 Bacteria 690
538 Ga0495669_0000538 3300046684 Bacteria 17062
539 Ga0495649_0038837 3300046694 Bacteria 2610
540 Ga0495660_0045932 3300046810 Bacteria 2396
541 Ga0495636_0008951 3300047318 Bacteria 3942
542 Ga0495680_0904212 3300047322 Bacteria 570
543 Ga0495687_006443 3300047443 Bacteria 7194
544 Ga0495677_0037582 3300047445 Bacteria 1768
545 Ga0495679_012515 3300047446 Bacteria 3225
546 Ga0495685_008769 3300047447 Bacteria 3366
547 Ga0495681_0000330 3300047470 Bacteria 37408
548 Ga0495602_0470185 3300048088 Bacteria 884
549 Ga0495615_0272488 3300048090 Bacteria 542
550 Ga0495626_0060176 3300048091 Bacteria 1731
551 Ga0496100_0118692 3300048903 Bacteria 1848
552 Ga0496101_0035890 3300048904 Bacteria 3508
553 Ga0496102_0697218 3300048905 Bacteria 938
554 Ga0496107_1316765 3300048910 Bacteria 516
555 Ga0496108_0305142 3300048911 Bacteria 1387
556 Ga0496116_0016309 3300048919 Bacteria 5817
557 Ga0496116_0040994 3300048919 Bacteria 3181
558 Ga0496117_0040230 3300048920 Bacteria 3440
559 Ga0496117_0066312 3300048920 Bacteria 2450
560 Ga0496117_0541149 3300048920 Bacteria 556
561 Ga0496118_0004173 3300048921 Bacteria 17410
562 Ga0496118_0012665 3300048921 Bacteria 8068
563 Ga0496118_0341038 3300048921 Bacteria 803
564 Ga0496121_0056464 3300048924 Bacteria 3261
565 Ga0496122_0063764 3300048925 Bacteria 2686
566 Ga0496122_0244273 3300048925 Bacteria 1009
567 Ga0496123_0020467 3300048926 Bacteria 5174
568 Ga0496124_0019115 3300048927 Bacteria 6392
569 Ga0496124_0022911 3300048927 Bacteria 5715
570 Ga0496124_0035877 3300048927 Bacteria 4333
571 Ga0496124_0277560 3300048927 Bacteria 1223
572 Ga0496125_0007461 3300048928 Bacteria 11634
573 Ga0496125_0048355 3300048928 Bacteria 3548
574 Ga0496125_0187842 3300048928 Bacteria 1368
575 Ga0496125_0638103 3300048928 Bacteria 575
576 Ga0496126_0744676 3300048929 Bacteria 757
577 Ga0501294_006478 3300049517 Bacteria 1123
578 Ga0501069_0702768 3300049585 Bacteria 610
579 Ga0501202_110173 3300049652 Bacteria 681
580 Ga0501249_003342 3300049679 Bacteria 3219
581 Ga0501249_155658 3300049679 Bacteria 578
582 Ga0501252_002802 3300049682 Bacteria 1760
583 Ga0501225_0024341 3300049705 Bacteria 1667
584 Ga0501262_007592 3300049759 Bacteria 1314
585 nmdc:mga03683_19972_c2 3300050489 Bacteria 1527
586 nmdc:mga03683_260801_c1 3300050489 Bacteria 807
587 nmdc:mga03683_500398_c1 3300050489 Bacteria 588
588 nmdc:mga03683_7792_c1 3300050489 Bacteria 3735
589 nmdc:mga03n38_15029_c1 3300050490 Bacteria 2982
590 nmdc:mga03n38_182244_c1 3300050490 Bacteria 1077
591 nmdc:mga00v17_128766_c1 3300050491 Bacteria 1616
592 nmdc:mga00v17_33460_c1 3300050491 Bacteria 3046
593 nmdc:mga00v17_479212_c1 3300050491 Bacteria 807
594 nmdc:mga00v17_649653_c1 3300050491 Bacteria 678
595 nmdc:mga0yw44_1229510_c1 3300050492 Bacteria 505
596 nmdc:mga0yw44_17635_c1 3300050492 Bacteria 3891
597 nmdc:mga0yw44_800167_c1 3300050492 Bacteria 640
598 nmdc:mga0k408_112632_c1 3300050493 Bacteria 1609
599 nmdc:mga0k408_318555_c1 3300050493 Bacteria 928
600 nmdc:mga0k408_85010_c1 3300050493 Bacteria 1857
601 nmdc:mga06z11_117230_c1 3300050494 Bacteria 1481
602 nmdc:mga06z11_219811_c1 3300050494 Bacteria 1110
603 nmdc:mga04h51_190990_c1 3300050495 Bacteria 801
604 nmdc:mga07m45_20324_c1 3300050496 Bacteria 3606
605 nmdc:mga07m45_2183_c1 3300050496 Bacteria 9129
606 nmdc:mga07m45_3880_c1 3300050496 Bacteria 7256
607 nmdc:mga07m45_432591_c1 3300050496 Bacteria 763
608 nmdc:mga07m45_775995_c1 3300050496 Bacteria 550
609 nmdc:mga0qj67_71061_c1 3300050509 Bacteria 2777
610 nmdc:mga06r32_108243_c1 3300050510 Bacteria 2732
611 nmdc:mga08y16_25941_c1 3300050511 Bacteria 6183
612 nmdc:mga0n895_1931852_c1 3300050512 Bacteria 549
613 nmdc:mga0rr50_470764_c1 3300050513 Bacteria 1066
614 nmdc:mga08x19_25100_c1 3300050514 Bacteria 3711
615 nmdc:mga08x19_26035_c1 3300050514 Bacteria 3648
616 nmdc:mga08x19_86347_c1 3300050514 Bacteria 2066
617 nmdc:mga0a205_115625_c1 3300050515 Bacteria 2581
618 nmdc:mga0sz30_16382_c1 3300050516 Bacteria 2943
619 nmdc:mga0sz30_37495_c1 3300050516 Bacteria 2029
620 Ga0500610_0215108 3300053079 Bacteria 914
621 Ga0500555_023662 3300053103 Bacteria 1762
622 Ga0500607_024485 3300053121 Bacteria 3370
623 Ga0500608_352254 3300053122 Bacteria 521
624 Ga0500645_069372 3300053730 Bacteria 1013
625 Ga0590071_009640 3300059421 Bacteria 2267
626 Ga0590077_032528 3300059426 Bacteria 1143
627 Ga0466962_0725974 3300061719 Bacteria 510
628 2513231540 2513020051 Bacteria 6053213
629 2644325952 2643221658 Bacteria 6064537
630 2644397433 2643221672 Bacteria 6322190
631 2738723284 2738541277 Bacteria 7458140
632 2738885608 2738541307 Bacteria 8606193
633 2739284015 2738543019 Bacteria 7459457
634 2831268479 2831265667 Bacteria 7184833
635 2838061070 2838054893 Bacteria 7451788
636 2842680685 2842677519 Bacteria 5615038
637 2904453039 2904449895 Bacteria 6927402
638 2904459923 2904456579 Bacteria 6819253
639 2904549107 2904541872 Bacteria 8915136
640 2919463377 2919462493 Bacteria 5817112
641 2929160735 2929160207 Bacteria 9075316
642 2929525997 2929520902 Bacteria 6765052
643 2945914770 2945909444 Bacteria 7065066
644 2945974178 2945972063 Bacteria 6086495
645 2945989831 2945984333 Bacteria 7358892
646 Ga0209971_1003823
647 JGI24740J21852_10001224
648 JGI24739J22299_10018116
649 JGI25150J39212_1018804
650 JGI25159J45721_1003727
651 JGI25151J46595_10006148
652 JGI25151J46595_10010700
653 rootL2_10044452
654 JGI25160J50197_1006708
655 JGI25161J50226_1008737
656 Ga0006562J51391_1042062
657 Ga0006562J51391_1043803
658 Ga0055526_1009611
659 Ga0055537_1000438
660 Ga0055537_1005515
661 Ga0055537_1023022
662 Ga0055524_1007198
663 Ga0055536_1006419
664 Ga0055536_1007569
665 Ga0055534_1000402
666 Ga0055534_1002184
667 Ga0055528_1035077
668 Ga0055530_10006090
669 Ga0055530_10014873
670 Ga0055530_10045729
671 Ga0055540_1004303
672 Ga0055540_1005424
673 Ga0055531_10004803
674 Ga0055531_10008584
675 Ga0055531_10053133
676 Ga0055543_1010104
677 Ga0065714_10011567
678 Ga0065712_10203787
679 Ga0065707_10106840
680 Ga0070690_101112212
681 Ga0070670_100703056
682 Ga0070670_101303983
683 Ga0070677_10312158
684 Ga0068869_100112933
685 Ga0070666_10341911
686 Ga0070680_100268670
687 Ga0068868_101034611
688 Ga0070660_100382042
689 Ga0070660_100724065
690 Ga0070660_101463036
691 Ga0070689_100075545
692 Ga0070689_101882175
693 Ga0070687_101386822
694 Ga0070661_100122358
695 Ga0070692_10033176
696 Ga0070668_100052466
697 Ga0070669_100000876
698 Ga0070669_100022558
699 Ga0070675_100016359
700 Ga0070674_100091466
701 Ga0070673_100195783
702 Ga0070673_101898390
703 Ga0070688_100071889
704 Ga0070659_100027346
705 Ga0070659_100197362
706 Ga0070659_102149871
707 Ga0070714_100029629
708 Ga0070714_100756054
709 Ga0070714_101597923
710 Ga0070713_100367307
711 Ga0070701_10033016
712 Ga0070701_10585747
713 Ga0070711_101153647
714 Ga0070705_100184144
715 Ga0070705_100489117
716 Ga0070700_100000737
717 Ga0070700_100296168
718 Ga0070694_100299480
719 Ga0070708_100201576
720 Ga0070663_101472112
721 Ga0070678_100416958
722 Ga0070678_102219351
723 Ga0070662_100455250
724 Ga0070681_11665036
725 Ga0068867_100001458
726 Ga0068867_100517998
727 Ga0068867_102265907
728 Ga0070685_10438347
729 Ga0070706_100213454
730 Ga0070698_100720741
731 Ga0070698_100752116
732 Ga0070699_100234163
733 Ga0070699_100693790
734 Ga0070699_101121502
735 Ga0070684_100077227
736 Ga0070697_100050810
737 Ga0070697_101991278
738 Ga0068853_100028042
739 Ga0068853_100799642
740 Ga0068853_101423543
741 Ga0070672_100027653
742 Ga0070672_100466798
743 Ga0070686_101113474
744 Ga0070695_100001729
745 Ga0070696_100010522
746 Ga0070696_100090315
747 Ga0070693_100133307
748 Ga0070704_100071241
749 Ga0070704_101276796
750 Ga0070704_101404199
751 Ga0070704_101774300
752 Ga0068855_100003915
753 Ga0068855_100202209
754 Ga0068855_100259774
755 Ga0068857_100071166
756 Ga0068857_100244442
757 Ga0068857_100490930
758 Ga0068857_100561656
759 Ga0068854_101303905
760 Ga0068854_101713709
761 Ga0068856_100174270
762 Ga0068856_101635035
763 Ga0068852_100003888
764 Ga0068852_100101111
765 Ga0068852_100210722
766 Ga0068852_100227025
767 Ga0068852_102287042
768 Ga0068852_102427769
769 Ga0068859_100065940
770 Ga0068859_100214510
771 Ga0068859_100395951
772 Ga0068866_10282468
773 Ga0068861_100038271
774 Ga0068858_100169397
775 Ga0068862_100635008
776 Ga0081539_10082478
777 Ga0075365_10009390
778 Ga0075365_10748254
779 Ga0075365_11200456
780 Ga0075363_100133735
781 Ga0075363_100535657
782 Ga0075364_10012265
783 Ga0075364_10487654
784 Ga0075432_10003588
785 Ga0070716_100302463
786 Ga0075362_10006731
787 Ga0075367_10079207
788 Ga0075367_10952848
789 Ga0075369_10069888
790 Ga0075366_10066964
791 Ga0075366_10139490
792 Ga0075366_10415087
793 Ga0075366_10815453
794 Ga0097621_100279299
795 Ga0097621_100511437
796 Ga0097621_101422785
797 Ga0075370_10010803
798 Ga0075370_10015211
799 Ga0075370_10383816
800 Ga0075370_10485990
801 Ga0075370_10531741
802 Ga0075370_10532222
803 Ga0075428_101897437
804 Ga0075430_100397914
805 Ga0075431_100369762
806 Ga0075434_102211736
807 Ga0068865_100001000
808 Ga0068865_100214393
809 Ga0068865_100443238
810 Ga0075436_100013043
811 Ga0075436_100016906
812 Ga0075436_100081791
813 Ga0097620_100065939
814 Ga0097620_100214500
815 Ga0097620_100395945
816 Ga0079104_1012971
817 Ga0099826_10018442
818 Ga0099826_10235654
819 Ga0075435_100626097
820 Ga0105251_10239391
821 Ga0105244_10009389
822 Ga0105240_10017082
823 Ga0105240_10019527
824 Ga0105240_10379868
825 Ga0105240_10417106
826 Ga0105240_11114871
827 Ga0111539_10069837
828 Ga0105245_11868667
829 Ga0105245_12216888
830 Ga0114129_12832388
831 Ga0105243_10000643
832 Ga0105243_10002799
833 Ga0105243_10007953
834 Ga0105241_11793122
835 Ga0105242_10054928
836 Ga0105242_10483088
837 Ga0105237_10079598
838 Ga0105238_10027287
839 Ga0105238_10162292
840 Ga0105238_10309353
841 Ga0105238_10768052
842 Ga0105238_10818527
843 Ga0105238_11152531
844 Ga0105249_10106137
845 Ga0105249_10356577
846 Ga0105239_10137033
847 Ga0105239_11777441
848 Ga0105246_10123063
849 Ga0105246_11888757
850 Ga0157347_1004058
851 Ga0157339_1001058
852 Ga0157373_10814153
853 Ga0157373_10849461
854 Ga0157371_10822189
855 Ga0157370_10023403
856 Ga0157370_10500149
857 Ga0157369_10002911
858 Ga0157369_10280510
859 Ga0157369_11085994
860 Ga0157369_11153826
861 Ga0157378_10518090
862 Ga0157378_11476983
863 Ga0163162_10336952
864 Ga0157372_10001455
865 Ga0157375_10201740
866 Ga0157375_11271829
867 Ga0163163_12540151
868 Ga0157380_10258187
869 Ga0157380_10489974
870 Ga0157380_11302676
871 Ga0157380_11428987
872 Ga0157380_12094289
873 Ga0157380_12185527
874 Ga0182008_10009480
875 Ga0182008_10010055
876 Ga0182008_10085383
877 Ga0157377_10011904
878 Ga0157377_10523429
879 Ga0157379_10711087
880 Ga0157376_10150627
881 Ga0182006_1001981
882 Ga0182006_1013682
883 Ga0182007_10071618
884 Ga0182007_10188089
885 Ga0182005_1068410
886 Ga0163161_10000680
887 Ga0163161_10019260
888 Ga0209436_115376
889 Ga0207425_1003177
890 Ga0209129_1011103
891 Ga0209565_1000496
892 Ga0209565_1000578
893 Ga0209565_1003687
894 Ga0209673_1000690
895 Ga0209673_1000985
896 Ga0209673_1001088
897 Ga0209130_1002077
898 Ga0209675_1000093
899 Ga0209675_1002295
900 Ga0209675_1008044
901 Ga0209676_1000802
902 Ga0209676_1000868
903 Ga0209676_1002903
904 Ga0209025_1001188
905 Ga0209025_1010058
906 Ga0209025_1034005
907 Ga0209564_1000223
908 Ga0209050_1000224
909 Ga0209050_1003606
910 Ga0209050_1036848
911 Ga0209256_1000174
912 Ga0209256_1029005
913 Ga0207426_1000232
914 Ga0209051_1000313
915 Ga0209051_1000656
916 Ga0209051_1000658
917 Ga0209051_1000690
918 Ga0209257_1000163
919 Ga0207656_10544189
920 Ga0207655_1001405
921 Ga0207682_10054064
922 Ga0207642_10045559
923 Ga0207680_10732777
924 Ga0207647_10224634
925 Ga0207645_10020724
926 Ga0207645_10465882
927 Ga0207643_10132111
928 Ga0207705_10245090
929 Ga0207705_10772616
930 Ga0207684_10172826
931 Ga0207684_11583552
932 Ga0207654_10981009
933 Ga0207707_11061140
934 Ga0207695_10032113
935 Ga0207695_10153389
936 Ga0207695_11422123
937 Ga0207660_10284994
938 Ga0207662_10026184
939 Ga0207657_10159786
940 Ga0207657_10929510
941 Ga0207657_11076246
942 Ga0207649_10478174
943 Ga0207649_11024988
944 Ga0207681_10000560
945 Ga0207681_10007126
946 Ga0207694_10031527
947 Ga0207694_10306947
948 Ga0207694_10521896
949 Ga0207694_11896161
950 Ga0207650_11804882
951 Ga0207659_10190929
952 Ga0207659_11293710
953 Ga0207700_11375270
954 Ga0207664_10034632
955 Ga0207664_11128018
956 Ga0207644_11636577
957 Ga0207690_10127656
958 Ga0207690_10239874
959 Ga0207690_11169567
960 Ga0207690_11213616
961 Ga0207706_10248848
962 Ga0207706_10267201
963 Ga0207686_10171432
964 Ga0207686_10172976
965 Ga0207709_10000490
966 Ga0207709_10002126
967 Ga0207709_10006652
968 Ga0207670_10040230
969 Ga0207670_10117059
970 Ga0207670_10247624
971 Ga0207669_10054972
972 Ga0207669_11397653
973 Ga0207704_10001905
974 Ga0207704_10891032
975 Ga0207665_10273314
976 Ga0207691_10047243
977 Ga0207691_10544409
978 Ga0207689_10213106
979 Ga0207689_10221072
980 Ga0207689_10673478
981 Ga0207689_10849387
982 Ga0207661_10189784
983 Ga0207679_10017261
984 Ga0207667_10001085
985 Ga0207667_10072058
986 Ga0207667_10121657
987 Ga0207712_10001981
988 Ga0207712_10796473
989 Ga0207668_10017087
990 Ga0207677_10604406
991 Ga0207677_10931865
992 Ga0207703_10138901
993 Ga0207639_10023601
994 Ga0207639_10032801
995 Ga0207639_10747916
996 Ga0207639_11133629
997 Ga0207639_11212921
998 Ga0207678_10124758
999 Ga0207708_10001699
1000 Ga0207708_10752895
1001 Ga0207702_10352877
1002 Ga0207702_11121742
1003 Ga0207641_10779908
1004 Ga0207641_10852799
1005 Ga0207648_10081466
1006 Ga0207648_10363566
1007 Ga0207648_10875928
1008 Ga0207648_11697572
1009 Ga0207674_10041113
1010 Ga0207674_10376792
1011 Ga0207674_11306374
1012 Ga0207675_100003269
1013 Ga0207675_100071751
1014 Ga0207675_100703927
1015 Ga0207683_10254032
1016 Ga0207683_10608513
1017 Ga0207698_10019886
1018 Ga0207698_10024004
1019 Ga0207698_10067871
1020 Ga0207698_10147644
1021 Ga0207698_10164641
1022 Ga0209281_1049272
1023 Ga0209282_1092178
1024 Ga0209971_1023285
1025 Ga0209998_10025071
1026 Ga0207428_10017264
1027 Ga0207428_10061989
1028 Ga0268265_10001299
1029 Ga0265338_10339132
1030 Ga0316177_1073809
1031 Ga0316176_1029497
1032 Ga0314311_1090358
1033 Ga0316179_1088193
1034 Ga0316178_1090357
1035 Ga0316180_1132279
1036 Ga0316183_1036273
1037 Ga0316182_1240696
1038 Ga0265330_10000464
1039 Ga0265330_10059179
1040 Ga0265332_10000018
1041 Ga0265332_10189073
1042 Ga0265325_10005805
1043 Ga0265325_10065155
1044 Ga0265340_10219214
1045 Ga0265327_10134207
1046 Ga0307513_10517543
1047 Ga0307408_100000012
1048 Ga0307408_100116242
1049 Ga0307408_100153467
1050 Ga0307408_100802919
1051 Ga0307408_101639847
1052 Ga0307408_101772455
1053 Ga0307408_101826995
1054 Ga0307514_10017918
1055 Ga0265314_10001491
1056 Ga0316576_10060116
1057 Ga0307405_10011632
1058 Ga0307405_10074704
1059 Ga0307405_10210330
1060 Ga0307405_10309144
1061 Ga0307405_11021045
1062 Ga0307405_11087623
1063 Ga0307405_11282882
1064 Ga0307413_10446410
1065 Ga0307413_11583575
1066 Ga0307410_10510974
1067 Ga0307410_10794308
1068 Ga0307410_10842249
1069 Ga0307410_11132674
1070 Ga0307410_11852520
1071 Ga0307406_10005332
1072 Ga0307406_10368147
1073 Ga0307406_11782548
1074 Ga0307407_10113837
1075 Ga0307407_10499261
1076 Ga0307407_10696092
1077 Ga0307412_10229113
1078 Ga0307412_10253618
1079 Ga0307412_10373926
1080 Ga0307412_10605901
1081 Ga0307412_10666429
1082 Ga0307412_11426633
1083 Ga0307409_100957142
1084 Ga0307416_100026542
1085 Ga0307416_100119832
1086 Ga0307416_100273959
1087 Ga0307416_100333892
1088 Ga0307416_100939158
1089 Ga0307416_101255739
1090 Ga0307416_101402765
1091 Ga0307414_10024044
1092 Ga0307414_10028304
1093 Ga0307414_10508481
1094 Ga0307414_11706341
1095 Ga0307411_10168823
1096 Ga0307411_10532885
1097 Ga0307411_11855375
1098 Ga0307415_100441250
1099 Ga0373952_0182098
1100 Ga0373935_0577561
1101 Ga0373927_0046994
1102 Ga0373947_0170722
1103 Ga0373937_0197112
1104 Ga0373925_0005318
1105 Ga0373925_1117119
1106 Ga0395900_0025554
1107 Ga0395905_0016176
1108 Ga0395905_0106268
1109 Ga0395901_0390865
1110 Ga0439439_0056014
1111 Ga0439466_0003533
1112 Ga0439465_0025877
1113 Ga0451802_0212090
1114 Ga0451833_0104336
1115 Ga0451835_0830277
1116 Ga0451853_4089157
1117 Ga0439431_0094936
1118 Ga0439441_030087
1119 Ga0439441_056689
1120 Ga0439442_033418
1121 Ga0439445_0072696
1122 Ga0439445_0158606
1123 Ga0439432_141428
1124 Ga0439449_0025883
1125 Ga0439455_0044621
1126 Ga0439457_046485
1127 Ga0450919_004848
1128 Ga0450920_003326
1129 Ga0450923_027903
1130 Ga0450890_013987
1131 Ga0450906_001293
1132 Ga0450907_016040
1133 Ga0450910_001111
1134 Ga0450910_026610
1135 Ga0439458_0084443
1136 Ga0450908_017344
1137 Ga0439434_0001759
1138 Ga0439434_0314945
1139 Ga0451577_0001986
1140 Ga0466972_0011749
1141 Ga0453683_0484624
1142 Ga0466965_0014239
1143 Ga0466966_0097421
1144 Ga0466961_0226134
1145 Ga0466964_0000264
1146 Ga0466971_0062415
1147 Ga0466968_0003021
1148 Ga0466957_0311115
1149 Ga0466960_0096217
1150 Ga0466959_0774935
1151 Ga0451576_0081678
1152 Ga0451576_0269421
1153 Ga0466958_0160626
1154 Ga0495617_153006
1155 Ga0495590_0015967
1156 Ga0495590_0335243
1157 Ga0495638_0114469
1158 Ga0495653_0860780
1159 Ga0495584_0003263
1160 Ga0495594_0092101
1161 Ga0495594_0156160
1162 Ga0495607_0005836
1163 Ga0495583_0002424
1164 Ga0495606_0223619
1165 Ga0495610_0177229
1166 Ga0495616_0007850
1167 Ga0495637_0003535
1168 Ga0495643_0036422
1169 Ga0495648_0035939
1170 Ga0495642_0009549
1171 Ga0495598_0095145
1172 Ga0495609_0001605
1173 Ga0495621_0104535
1174 Ga0495621_0105870
1175 Ga0495656_0142992
1176 Ga0495625_0001736
1177 Ga0495625_0001740
1178 Ga0495659_0003085
1179 Ga0495659_0083105
1180 Ga0495661_0036039
1181 Ga0495588_0012327
1182 Ga0495588_0433460
1183 Ga0495669_0000538
1184 Ga0495649_0038837
1185 Ga0495660_0045932
1186 Ga0495636_0008951
1187 Ga0495680_0904212
1188 Ga0495687_006443
1189 Ga0495677_0037582
1190 Ga0495679_012515
1191 Ga0495685_008769
1192 Ga0495681_0000330
1193 Ga0495602_0470185
1194 Ga0495615_0272488
1195 Ga0495626_0060176
1196 Ga0496100_0118692
1197 Ga0496101_0035890
1198 Ga0496102_0697218
1199 Ga0496107_1316765
1200 Ga0496108_0305142
1201 Ga0496116_0016309
1202 Ga0496116_0040994
1203 Ga0496117_0040230
1204 Ga0496117_0066312
1205 Ga0496117_0541149
1206 Ga0496118_0004173
1207 Ga0496118_0012665
1208 Ga0496118_0341038
1209 Ga0496121_0056464
1210 Ga0496122_0063764
1211 Ga0496122_0244273
1212 Ga0496123_0020467
1213 Ga0496124_0019115
1214 Ga0496124_0022911
1215 Ga0496124_0035877
1216 Ga0496124_0277560
1217 Ga0496125_0007461
1218 Ga0496125_0048355
1219 Ga0496125_0187842
1220 Ga0496125_0638103
1221 Ga0496126_0744676
1222 Ga0501294_006478
1223 Ga0501069_0702768
1224 Ga0501202_110173
1225 Ga0501249_003342
1226 Ga0501249_155658
1227 Ga0501252_002802
1228 Ga0501225_0024341
1229 Ga0501262_007592
1230 nmdc:mga03683_19972_c2
1231 nmdc:mga03683_260801_c1
1232 nmdc:mga03683_500398_c1
1233 nmdc:mga03683_7792_c1
1234 nmdc:mga03n38_15029_c1
1235 nmdc:mga03n38_182244_c1
1236 nmdc:mga00v17_128766_c1
1237 nmdc:mga00v17_33460_c1
1238 nmdc:mga00v17_479212_c1
1239 nmdc:mga00v17_649653_c1
1240 nmdc:mga0yw44_1229510_c1
1241 nmdc:mga0yw44_17635_c1
1242 nmdc:mga0yw44_800167_c1
1243 nmdc:mga0k408_112632_c1
1244 nmdc:mga0k408_318555_c1
1245 nmdc:mga0k408_85010_c1
1246 nmdc:mga06z11_117230_c1
1247 nmdc:mga06z11_219811_c1
1248 nmdc:mga04h51_190990_c1
1249 nmdc:mga07m45_20324_c1
1250 nmdc:mga07m45_2183_c1
1251 nmdc:mga07m45_3880_c1
1252 nmdc:mga07m45_432591_c1
1253 nmdc:mga07m45_775995_c1
1254 nmdc:mga0qj67_71061_c1
1255 nmdc:mga06r32_108243_c1
1256 nmdc:mga08y16_25941_c1
1257 nmdc:mga0n895_1931852_c1
1258 nmdc:mga0rr50_470764_c1
1259 nmdc:mga08x19_25100_c1
1260 nmdc:mga08x19_26035_c1
1261 nmdc:mga08x19_86347_c1
1262 nmdc:mga0a205_115625_c1
1263 nmdc:mga0sz30_16382_c1
1264 nmdc:mga0sz30_37495_c1
1265 Ga0500610_0215108
1266 Ga0500555_023662
1267 Ga0500607_024485
1268 Ga0500608_352254
1269 Ga0500645_069372
1270 Ga0590071_009640
1271 Ga0590077_032528
1272 Ga0466962_0725974
1273 2513231540
1274 2644325952
1275 2644397433
1276 2738723284
1277 2738885608
1278 2739284015
1279 2831268479
1280 2838061070
1281 2842680685
1282 2904453039
1283 2904459923
1284 2904549107
1285 2919463377
1286 2929160735
1287 2929525997
1288 2945914770
1289 2945974178
1290 2945989831

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00381

PTS-HPr

PTS HPr component phosphorylation site

2

74

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sph-assembly1.cif.gz_B refined structures of the active s83c and impaired s46d hprs: evidence that phosphorylation does not require a backbone conformational transition 0.9681 2 76
5ya0-assembly1.cif.gz_C crystal structure of lsrk and hpr complex 0.9676 1 78
2hpr-assembly1.cif.gz_A histidine-containing phosphocarrier protein hpr mutant with met 51 replaced by val and ser 83 replaced by cys (m51v, s83c) 0.9667 2 77
3lfg-assembly2.cif.gz_B crystal structure of hpr-c-his from thermoanaerobacter tengcongensis 0.9657 1 84
7ff5-assembly3.cif.gz_C the crystal structure of ruminiclostridium cellulolyticum phosphocarrier 0.9648 1 76
ID Description Score Start End Superfamily
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9652 1 83 3.30.1340.10
3ccdB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9634 1 78 3.30.1340.10
af_P69811_287_371_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9609 1 77 3.30.1340.10
3ihsB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9484 1 76 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9432 1 83 3.30.1340.10
ID Description Score Start End GO Terms
AF-A0A851H7D5-F1-model_v4 HPr family phosphocarrier protein 1.003 1 84 GO:0005737
GO:0009401
AF-G0AFG9-F1-model_v4 Phosphocarrier protein, nitrogen regulation associated 1.002 1 84 GO:0005737
GO:0009401
AF-A0A1I4LHF2-F1-model_v4 Phosphocarrier protein (EC 2.7.11.-) 1.002 1 84 GO:0005737
GO:0009401
GO:0016740
AF-A0A2P7TZJ2-F1-model_v4 HPr family phosphocarrier protein 1.001 1 84 GO:0005737
GO:0009401
AF-A0A1V5FSD6-F1-model_v4 Phosphocarrier protein HPr (EC 2.7.11.-) 1 1 84 GO:0005737
GO:0009401
GO:0016740

Map