F472058

General Info

Members Datasets Scaffolds Average Seq Length
644 245 641 314

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0993235|Ga0436365_0993235_583_1626
Length 347
Sequence MMFEIHDAAVRSIVIIQYFFTNYYLMQPVIQRTCFTVLLILSFQLITKAQTDIDAIMMAKNNFCVGGTYSHSSWDHYWEGTFKRDNQNIGTVSTNMFSLMGNYGITNKLNALFNLPYVSTKASAGTLHDSKGIQDFSLWLKWMPVEKKLNKNSVFSLYGLGGFSTPASNYQADYLPLTLGLHSTTFSARLMADYQYKAFFATASGTYQYRNNIKIDRTAYYTTEMHLTNEVEMPDVASFNVRTGIRTFRVIAEAFFQQNFTLGGFDITRNNMPFPSNRMNSSAVGAHVKYTFVKKLPSLSLEAGGSYIVNGRNVGQSTEFNGSVFYIIPFSHKKVDASHSCKLCGLR

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
175 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
176 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
177 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
178 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
179 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
180 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
181 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
182 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
183 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
198 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
232 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
233 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
234 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
235 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
236 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
237 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
238 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
239 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
240 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
241 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
242 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
243 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.43
Nodule 0
Rhizoplane 0.93
Rhizosphere 86.96
Stem 0
Stem Tuber 0
Unclassified 6.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10014507 3300001979 Bacteria 2904
2 JGI24737J22298_10035845 3300001990 Bacteria 1534
3 JGI24744J21845_10005090 3300002077 Bacteria 2720
4 JGI25162J39368_1002039 3300002737 Bacteria 8880
5 JGI25165J46597_1000620 3300003214 Bacteria 29837
6 rootH1_10068895 3300003316 Bacteria 3416
7 rootH1_10084743 3300003316 Bacteria 2440
8 rootH2_10001891 3300003320 Bacteria 464318
9 rootH2_10005472 3300003320 Bacteria 61274
10 rootH2_10037638 3300003320 Bacteria 6175
11 rootH2_10161659 3300003320 Bacteria 6661
12 rootL2_10048542 3300003322 Bacteria 3283
13 rootL2_10054299 3300003322 Bacteria 2477
14 rootL2_10089616 3300003322 Bacteria 3835
15 rootL2_10155262 3300003322 Bacteria 4188
16 rootL2_10201656 3300003322 Bacteria 2135
17 rootL2_10260817 3300003322 Bacteria 1593
18 rootH1_10002605 3300003323 Bacteria 51064
19 rootH1_10037580 3300003323 Bacteria 8022
20 rootH1_10037581 3300003323 Bacteria 2623
21 rootH1_10065577 3300003323 Bacteria 7522
22 JGI25160J50197_1001307 3300003354 Bacteria 12579
23 JGI25160J50197_1011117 3300003354 Bacteria 3210
24 Ga0065714_10073558 3300005288 Unclassified 3165
25 Ga0065714_10080179 3300005288 Bacteria 2458
26 Ga0065714_10086384 3300005288 Bacteria 2104
27 Ga0065707_10012190 3300005295 Bacteria 1727
28 Ga0070658_10000026 3300005327 Bacteria 171716
29 Ga0070658_10191733 3300005327 Unclassified 1722
30 Ga0070676_10051751 3300005328 Unclassified 2412
31 Ga0070670_100061776 3300005331 Bacteria 3216
32 Ga0070670_100156118 3300005331 Bacteria 1976
33 Ga0068869_100006659 3300005334 Bacteria 7338
34 Ga0068869_100015579 3300005334 Bacteria 5105
35 Ga0068869_100068504 3300005334 Unclassified 2621
36 Ga0068869_100130520 3300005334 Bacteria 1931
37 Ga0070666_10000050 3300005335 Bacteria 100280
38 Ga0070666_10005046 3300005335 Bacteria 8074
39 Ga0070666_10061185 3300005335 Bacteria 2549
40 Ga0070680_100015425 3300005336 Bacteria 5989
41 Ga0070682_100013193 3300005337 Bacteria 4749
42 Ga0068868_100005340 3300005338 Bacteria 9020
43 Ga0068868_100012088 3300005338 Bacteria 6304
44 Ga0068868_100019106 3300005338 Bacteria 5132
45 Ga0068868_100030994 3300005338 Bacteria 4104
46 Ga0070660_100105177 3300005339 Bacteria 2240
47 Ga0070689_100028137 3300005340 Bacteria 4246
48 Ga0070668_100079253 3300005347 Unclassified 2571
49 Ga0070668_100351508 3300005347 Bacteria 1248
50 Ga0070669_100127838 3300005353 Bacteria 1946
51 Ga0070669_100155527 3300005353 Bacteria 1773
52 Ga0070675_100035887 3300005354 Bacteria 4031
53 Ga0070675_100078530 3300005354 Bacteria 2749
54 Ga0070675_100081962 3300005354 Unclassified 2691
55 Ga0070671_100103922 3300005355 Unclassified 2384
56 Ga0070671_100133209 3300005355 Bacteria 2094
57 Ga0070673_100002401 3300005364 Bacteria 11402
58 Ga0070673_100316694 3300005364 Bacteria 1377
59 Ga0070688_100027128 3300005365 Bacteria 3409
60 Ga0070667_100017847 3300005367 Bacteria 5881
61 Ga0070667_100020480 3300005367 Bacteria 5490
62 Ga0070667_100043098 3300005367 Bacteria 3787
63 Ga0070667_100043490 3300005367 Bacteria 3770
64 Ga0070667_100130870 3300005367 Bacteria 2190
65 Ga0070667_100176587 3300005367 Bacteria 1888
66 Ga0070667_100319953 3300005367 Bacteria 1400
67 Ga0070667_100491518 3300005367 Bacteria 1124
68 Ga0070663_100185506 3300005455 Bacteria 1616
69 Ga0070678_100013581 3300005456 Bacteria 5113
70 Ga0070678_100015076 3300005456 Bacteria 4900
71 Ga0070678_100051724 3300005456 Bacteria 2979
72 Ga0070678_100071575 3300005456 Bacteria 2596
73 Ga0070662_100000153 3300005457 Bacteria 39715
74 Ga0070681_10119122 3300005458 Bacteria 2576
75 Ga0070681_10474629 3300005458 Bacteria 1163
76 Ga0068867_100048127 3300005459 Bacteria 3136
77 Ga0068867_100053309 3300005459 Bacteria 2987
78 Ga0068867_100057294 3300005459 Bacteria 2885
79 Ga0068867_100101189 3300005459 Bacteria 2201
80 Ga0070685_10077141 3300005466 Bacteria 1989
81 Ga0070698_100003063 3300005471 Bacteria 18436
82 Ga0070679_100034065 3300005530 Bacteria 5046
83 Ga0070679_100080929 3300005530 Bacteria 3237
84 Ga0070679_100411309 3300005530 Bacteria 1298
85 Ga0068853_100001501 3300005539 Bacteria 16945
86 Ga0068853_100002933 3300005539 Bacteria 12973
87 Ga0068853_100068377 3300005539 Bacteria 3088
88 Ga0068853_100142660 3300005539 Bacteria 2151
89 Ga0068853_100167423 3300005539 Unclassified 1987
90 Ga0068853_100198243 3300005539 Bacteria 1826
91 Ga0068853_100206147 3300005539 Bacteria 1791
92 Ga0070672_100069018 3300005543 Bacteria 2805
93 Ga0070672_100086567 3300005543 Bacteria 2520
94 Ga0070672_100223958 3300005543 Bacteria 1578
95 Ga0070672_100310705 3300005543 Bacteria 1338
96 Ga0070672_100360953 3300005543 Bacteria 1240
97 Ga0070693_100006246 3300005547 Bacteria 5772
98 Ga0070665_100000014 3300005548 Bacteria 484881
99 Ga0070665_100000020 3300005548 Bacteria 389687
100 Ga0070665_100229043 3300005548 Unclassified 1858
101 Ga0070665_100543459 3300005548 Bacteria 1174
102 Ga0070665_100549220 3300005548 Bacteria 1167
103 Ga0068855_100007819 3300005563 Bacteria 12914
104 Ga0068855_100009960 3300005563 Bacteria 11457
105 Ga0068855_100042715 3300005563 Bacteria 5372
106 Ga0068855_100045307 3300005563 Bacteria 5202
107 Ga0068855_100054902 3300005563 Bacteria 4681
108 Ga0068855_100057646 3300005563 Bacteria 4552
109 Ga0068855_100160964 3300005563 Bacteria 2548
110 Ga0068855_100197862 3300005563 Bacteria 2264
111 Ga0068857_100037651 3300005577 Unclassified 4286
112 Ga0068857_100116526 3300005577 Unclassified 2404
113 Ga0068857_100117105 3300005577 Bacteria 2397
114 Ga0068857_100252508 3300005577 Bacteria 1617
115 Ga0068857_100316192 3300005577 Bacteria 1441
116 Ga0068856_100000271 3300005614 Bacteria 56548
117 Ga0068856_100002643 3300005614 Bacteria 18380
118 Ga0068856_100045584 3300005614 Bacteria 4318
119 Ga0068856_100070260 3300005614 Bacteria 3464
120 Ga0068856_100299563 3300005614 Bacteria 1625
121 Ga0068856_100421135 3300005614 Bacteria 1355
122 Ga0068852_100007484 3300005616 Bacteria 7971
123 Ga0068852_100020291 3300005616 Bacteria 5283
124 Ga0068852_100192819 3300005616 Bacteria 1924
125 Ga0068852_100239745 3300005616 Unclassified 1732
126 Ga0068852_100251564 3300005616 Bacteria 1693
127 Ga0068852_100331745 3300005616 Bacteria 1480
128 Ga0068859_100000025 3300005617 Bacteria 191679
129 Ga0068859_100025612 3300005617 Bacteria 5917
130 Ga0068859_100032587 3300005617 Bacteria 5234
131 Ga0068859_100048334 3300005617 Bacteria 4274
132 Ga0068859_100070254 3300005617 Bacteria 3537
133 Ga0068859_100071347 3300005617 Bacteria 3509
134 Ga0068864_100006903 3300005618 Bacteria 9309
135 Ga0068864_100132027 3300005618 Bacteria 2244
136 Ga0068864_100144691 3300005618 Bacteria 2148
137 Ga0068866_10044369 3300005718 Unclassified 2224
138 Ga0068866_10057375 3300005718 Bacteria 2006
139 Ga0068861_100030623 3300005719 Bacteria 3945
140 Ga0068861_100107982 3300005719 Bacteria 2226
141 Ga0068851_10008554 3300005834 Unclassified 4735
142 Ga0068851_10022253 3300005834 Unclassified 3085
143 Ga0068851_10082321 3300005834 Bacteria 1682
144 Ga0068851_10099318 3300005834 Bacteria 1542
145 Ga0068870_10048014 3300005840 Unclassified 2246
146 Ga0068863_100009689 3300005841 Bacteria 9399
147 Ga0068863_100016345 3300005841 Bacteria 7119
148 Ga0068858_100007839 3300005842 Bacteria 10303
149 Ga0068858_100201892 3300005842 Bacteria 1880
150 Ga0068860_100000061 3300005843 Bacteria 192548
151 Ga0068860_100002976 3300005843 Bacteria 17499
152 Ga0068860_100003705 3300005843 Bacteria 15722
153 Ga0068860_100007315 3300005843 Bacteria 11039
154 Ga0068860_100026713 3300005843 Bacteria 5564
155 Ga0068860_100209152 3300005843 Bacteria 1892
156 Ga0068860_100339323 3300005843 Bacteria 1477
157 Ga0068860_100503508 3300005843 Bacteria 1209
158 Ga0068862_100014299 3300005844 Bacteria 6584
159 Ga0068862_100090031 3300005844 Bacteria 2671
160 Ga0068862_100102338 3300005844 Unclassified 2507
161 Ga0068862_100166355 3300005844 Unclassified 1972
162 Ga0068862_100497565 3300005844 Bacteria 1156
163 Ga0081540_1002830 3300005983 Bacteria 14047
164 Ga0081539_10003031 3300005985 Bacteria 21772
165 Ga0075366_10000467 3300006195 Bacteria 18777
166 Ga0075366_10000806 3300006195 Bacteria 15007
167 Ga0097621_100003375 3300006237 Bacteria 10990
168 Ga0097621_100008467 3300006237 Bacteria 7411
169 Ga0097621_100016645 3300006237 Bacteria 5564
170 Ga0097621_100017205 3300006237 Bacteria 5487
171 Ga0097621_100089226 3300006237 Unclassified 2577
172 Ga0097621_100224693 3300006237 Unclassified 1637
173 Ga0075370_10091589 3300006353 Bacteria 1754
174 Ga0068871_100001044 3300006358 Bacteria 18562
175 Ga0068871_100003925 3300006358 Bacteria 10256
176 Ga0068871_100005284 3300006358 Bacteria 9040
177 Ga0068871_100010670 3300006358 Bacteria 6717
178 Ga0068871_100014781 3300006358 Bacteria 5828
179 Ga0068871_100021989 3300006358 Unclassified 4913
180 Ga0068871_100026108 3300006358 Bacteria 4554
181 Ga0075429_100023162 3300006880 Bacteria 5386
182 Ga0068865_100022837 3300006881 Bacteria 4087
183 Ga0068865_100067228 3300006881 Bacteria 2531
184 Ga0068865_100088179 3300006881 Unclassified 2244
185 Ga0068865_100350684 3300006881 Bacteria 1195
186 Ga0097620_100000025 3300006931 Bacteria 191679
187 Ga0097620_100025612 3300006931 Bacteria 5917
188 Ga0097620_100032588 3300006931 Bacteria 5234
189 Ga0097620_100048331 3300006931 Bacteria 4274
190 Ga0097620_100070253 3300006931 Bacteria 3537
191 Ga0097620_100071345 3300006931 Bacteria 3509
192 Ga0105240_10000190 3300009093 Bacteria 125290
193 Ga0105240_10000226 3300009093 Bacteria 112655
194 Ga0105240_10000592 3300009093 Bacteria 67301
195 Ga0105240_10000674 3300009093 Bacteria 62689
196 Ga0105240_10022499 3300009093 Bacteria 8354
197 Ga0105240_10029462 3300009093 Bacteria 7150
198 Ga0105240_10034100 3300009093 Bacteria 6569
199 Ga0105240_10034712 3300009093 Bacteria 6503
200 Ga0105240_10051808 3300009093 Bacteria 5163
201 Ga0105240_10052823 3300009093 Bacteria 5106
202 Ga0105240_10068291 3300009093 Bacteria 4402
203 Ga0105240_10297328 3300009093 Unclassified 1848
204 Ga0105240_10467091 3300009093 Unclassified 1409
205 Ga0111539_10024937 3300009094 Bacteria 7331
206 Ga0111539_10095604 3300009094 Bacteria 3490
207 Ga0105247_10001380 3300009101 Bacteria 17607
208 Ga0105247_10001913 3300009101 Bacteria 14526
209 Ga0114129_10002011 3300009147 Bacteria 27860
210 Ga0105241_10000761 3300009174 Bacteria 24490
211 Ga0105241_10009803 3300009174 Bacteria 7039
212 Ga0105241_10010644 3300009174 Bacteria 6747
213 Ga0105241_10011571 3300009174 Bacteria 6470
214 Ga0105241_10011639 3300009174 Bacteria 6454
215 Ga0105241_10011903 3300009174 Bacteria 6392
216 Ga0105241_10066771 3300009174 Bacteria 2782
217 Ga0105241_10567956 3300009174 Unclassified 1021
218 Ga0105242_10047864 3300009176 Bacteria 3473
219 Ga0105242_10117861 3300009176 Bacteria 2274
220 Ga0105242_10131094 3300009176 Bacteria 2164
221 Ga0105242_10145611 3300009176 Bacteria 2060
222 Ga0105242_10178072 3300009176 Bacteria 1874
223 Ga0105248_10011596 3300009177 Bacteria 9709
224 Ga0105248_10406345 3300009177 Unclassified 1533
225 Ga0105237_10000229 3300009545 Bacteria 79571
226 Ga0105237_10000702 3300009545 Bacteria 46425
227 Ga0105237_10002329 3300009545 Bacteria 23581
228 Ga0105237_10003831 3300009545 Bacteria 17683
229 Ga0105237_10006536 3300009545 Bacteria 12897
230 Ga0105237_10006551 3300009545 Bacteria 12879
231 Ga0105237_10007386 3300009545 Bacteria 12034
232 Ga0105237_10009599 3300009545 Bacteria 10363
233 Ga0105237_10010656 3300009545 Bacteria 9768
234 Ga0105237_10011389 3300009545 Bacteria 9408
235 Ga0105237_10025884 3300009545 Bacteria 5998
236 Ga0105237_10074175 3300009545 Bacteria 3394
237 Ga0105237_10469397 3300009545 Bacteria 1264
238 Ga0105238_10011536 3300009551 Bacteria 8902
239 Ga0105238_10018529 3300009551 Bacteria 7085
240 Ga0105238_10087602 3300009551 Bacteria 3100
241 Ga0105238_10141707 3300009551 Bacteria 2380
242 Ga0105238_10166714 3300009551 Bacteria 2178
243 Ga0105238_10343219 3300009551 Unclassified 1482
244 Ga0105249_10007902 3300009553 Bacteria 9269
245 Ga0105249_10008648 3300009553 Bacteria 8872
246 Ga0105249_10025316 3300009553 Bacteria 5340
247 Ga0105249_10035127 3300009553 Bacteria 4544
248 Ga0105249_10053249 3300009553 Bacteria 3699
249 Ga0105249_10060457 3300009553 Unclassified 3476
250 Ga0105249_10075366 3300009553 Bacteria 3125
251 Ga0105249_10110699 3300009553 Unclassified 2595
252 Ga0105239_10000013 3300010375 Bacteria 327371
253 Ga0105239_10000019 3300010375 Bacteria 273836
254 Ga0105239_10000805 3300010375 Bacteria 44408
255 Ga0105239_10001332 3300010375 Bacteria 33262
256 Ga0105239_10002738 3300010375 Bacteria 22132
257 Ga0105239_10004499 3300010375 Bacteria 16638
258 Ga0105239_10006970 3300010375 Bacteria 13020
259 Ga0105239_10009377 3300010375 Bacteria 11043
260 Ga0105239_10033671 3300010375 Bacteria 5626
261 Ga0105239_10059152 3300010375 Bacteria 4206
262 Ga0105239_10074274 3300010375 Unclassified 3739
263 Ga0105239_10119908 3300010375 Bacteria 2920
264 Ga0105239_10174238 3300010375 Bacteria 2406
265 Ga0105239_10382085 3300010375 Bacteria 1592
266 Ga0105239_10402600 3300010375 Bacteria 1549
267 Ga0105239_10463978 3300010375 Unclassified 1438
268 Ga0105246_10009499 3300011119 Bacteria 5990
269 Ga0105246_10066584 3300011119 Bacteria 2522
270 Ga0105246_10145736 3300011119 Bacteria 1786
271 Ga0105246_10216386 3300011119 Bacteria 1499
272 Ga0157373_10109353 3300013100 Bacteria 1943
273 Ga0157373_10183467 3300013100 Bacteria 1474
274 Ga0157371_10001423 3300013102 Bacteria 24864
275 Ga0157371_10182377 3300013102 Bacteria 1501
276 Ga0157370_10078587 3300013104 Bacteria 3107
277 Ga0157369_10002827 3300013105 Bacteria 20717
278 Ga0157369_10013285 3300013105 Bacteria 9317
279 Ga0157369_10170760 3300013105 Bacteria 2291
280 Ga0157374_10000011 3300013296 Bacteria 466749
281 Ga0157374_10002533 3300013296 Bacteria 15404
282 Ga0157374_10003205 3300013296 Bacteria 13737
283 Ga0157374_10015600 3300013296 Bacteria 6668
284 Ga0157374_10034609 3300013296 Bacteria 4616
285 Ga0157374_10131414 3300013296 Bacteria 2423
286 Ga0157374_10211559 3300013296 Bacteria 1901
287 Ga0157374_10267459 3300013296 Unclassified 1685
288 Ga0157374_10495623 3300013296 Bacteria 1226
289 Ga0157378_10003970 3300013297 Bacteria 13068
290 Ga0157378_10044014 3300013297 Bacteria 3963
291 Ga0157378_10062651 3300013297 Bacteria 3321
292 Ga0157378_10112342 3300013297 Bacteria 2499
293 Ga0157378_10453635 3300013297 Bacteria 1273
294 Ga0163162_10000256 3300013306 Bacteria 48230
295 Ga0163162_10000549 3300013306 Bacteria 34654
296 Ga0163162_10002245 3300013306 Bacteria 18145
297 Ga0163162_10003819 3300013306 Bacteria 14443
298 Ga0163162_10079496 3300013306 Bacteria 3346
299 Ga0163162_10114033 3300013306 Bacteria 2801
300 Ga0163162_10356725 3300013306 Unclassified 1595
301 Ga0163162_10419844 3300013306 Bacteria 1470
302 Ga0157372_10000030 3300013307 Bacteria 179925
303 Ga0157372_10108521 3300013307 Bacteria 3177
304 Ga0157372_10119388 3300013307 Unclassified 3027
305 Ga0157372_10326533 3300013307 Bacteria 1786
306 Ga0157375_10003913 3300013308 Bacteria 12917
307 Ga0157375_10008136 3300013308 Bacteria 9176
308 Ga0157375_10053968 3300013308 Unclassified 3957
309 Ga0157375_10120617 3300013308 Bacteria 2731
310 Ga0157375_10131968 3300013308 Bacteria 2618
311 Ga0157375_10153494 3300013308 Bacteria 2440
312 Ga0157375_10257788 3300013308 Bacteria 1905
313 Ga0157375_10354861 3300013308 Bacteria 1632
314 Ga0157375_10423754 3300013308 Bacteria 1497
315 Ga0163163_10000079 3300014325 Bacteria 106874
316 Ga0163163_10109362 3300014325 Unclassified 2791
317 Ga0163163_10134098 3300014325 Unclassified 2517
318 Ga0163163_10551295 3300014325 Bacteria 1215
319 Ga0157380_10010345 3300014326 Bacteria 6709
320 Ga0157380_10032170 3300014326 Bacteria 4033
321 Ga0157377_10019384 3300014745 Bacteria 3553
322 Ga0157377_10076962 3300014745 Unclassified 1941
323 Ga0157379_10007087 3300014968 Bacteria 9692
324 Ga0157379_10047097 3300014968 Bacteria 3846
325 Ga0157379_10134639 3300014968 Bacteria 2226
326 Ga0157376_10004662 3300014969 Bacteria 9557
327 Ga0157376_10004720 3300014969 Bacteria 9496
328 Ga0157376_10013495 3300014969 Bacteria 6097
329 Ga0157376_10128517 3300014969 Bacteria 2257
330 Ga0157376_10363064 3300014969 Bacteria 1389
331 Ga0163161_10002103 3300017792 Bacteria 14420
332 Ga0163161_10035152 3300017792 Bacteria 3586
333 Ga0213876_10064772 3300021384 Bacteria 1929
334 Ga0209563_108161 3300025230 Bacteria 1669
335 Ga0207427_100106 3300025231 Bacteria 117041
336 Ga0209437_100226 3300025233 Bacteria 100303
337 Ga0209646_1000003 3300025246 Bacteria 1160860
338 Ga0209026_1000614 3300025250 Bacteria 22834
339 Ga0209233_1000089 3300025261 Bacteria 316381
340 Ga0209758_1009686 3300025297 Bacteria 5932
341 Ga0207426_1000023 3300025302 Bacteria 545465
342 Ga0207426_1000187 3300025302 Bacteria 153809
343 Ga0207656_10005627 3300025321 Unclassified 4446
344 Ga0207656_10088161 3300025321 Bacteria 1404
345 Ga0207642_10060875 3300025899 Unclassified 1753
346 Ga0207710_10001330 3300025900 Bacteria 12420
347 Ga0207688_10004663 3300025901 Bacteria 7470
348 Ga0207680_10000032 3300025903 Bacteria 77485
349 Ga0207647_10000273 3300025904 Bacteria 41974
350 Ga0207647_10046627 3300025904 Unclassified 2700
351 Ga0207647_10090697 3300025904 Unclassified 1823
352 Ga0207645_10001268 3300025907 Bacteria 20776
353 Ga0207645_10001491 3300025907 Bacteria 19131
354 Ga0207645_10076371 3300025907 Unclassified 2145
355 Ga0207645_10209521 3300025907 Bacteria 1284
356 Ga0207645_10248291 3300025907 Unclassified 1177
357 Ga0207643_10057407 3300025908 Bacteria 2215
358 Ga0207643_10068902 3300025908 Unclassified 2032
359 Ga0207705_10000040 3300025909 Bacteria 185735
360 Ga0207654_10001259 3300025911 Bacteria 13484
361 Ga0207654_10001780 3300025911 Bacteria 11193
362 Ga0207654_10015732 3300025911 Bacteria 3931
363 Ga0207654_10030779 3300025911 Unclassified 2949
364 Ga0207654_10032105 3300025911 Bacteria 2898
365 Ga0207654_10051738 3300025911 Bacteria 2365
366 Ga0207654_10057872 3300025911 Bacteria 2255
367 Ga0207654_10142992 3300025911 Bacteria 1528
368 Ga0207707_10012790 3300025912 Bacteria 7301
369 Ga0207695_10000048 3300025913 Bacteria 421800
370 Ga0207695_10000276 3300025913 Bacteria 128924
371 Ga0207695_10000313 3300025913 Bacteria 117072
372 Ga0207695_10001456 3300025913 Bacteria 39626
373 Ga0207695_10003090 3300025913 Bacteria 23836
374 Ga0207695_10034574 3300025913 Bacteria 5494
375 Ga0207695_10042476 3300025913 Bacteria 4855
376 Ga0207695_10046685 3300025913 Bacteria 4589
377 Ga0207695_10053020 3300025913 Unclassified 4245
378 Ga0207671_10001496 3300025914 Bacteria 26941
379 Ga0207671_10001671 3300025914 Bacteria 25207
380 Ga0207671_10003653 3300025914 Bacteria 15191
381 Ga0207671_10004604 3300025914 Bacteria 13095
382 Ga0207671_10007845 3300025914 Bacteria 9174
383 Ga0207671_10008980 3300025914 Bacteria 8409
384 Ga0207671_10020629 3300025914 Bacteria 5012
385 Ga0207671_10022576 3300025914 Bacteria 4755
386 Ga0207671_10032247 3300025914 Bacteria 3900
387 Ga0207671_10152335 3300025914 Bacteria 1787
388 Ga0207671_10152910 3300025914 Bacteria 1783
389 Ga0207671_10240604 3300025914 Bacteria 1421
390 Ga0207660_10013389 3300025917 Bacteria 5377
391 Ga0207662_10070856 3300025918 Bacteria 2109
392 Ga0207657_10053840 3300025919 Bacteria 3483
393 Ga0207652_10019385 3300025921 Bacteria 5594
394 Ga0207652_10254067 3300025921 Bacteria 1585
395 Ga0207652_10414652 3300025921 Bacteria 1215
396 Ga0207681_10263573 3300025923 Bacteria 1350
397 Ga0207694_10160057 3300025924 Unclassified 1818
398 Ga0207650_10030387 3300025925 Bacteria 3891
399 Ga0207650_10047905 3300025925 Bacteria 3151
400 Ga0207659_10240131 3300025926 Unclassified 1465
401 Ga0207644_10039689 3300025931 Bacteria 3324
402 Ga0207706_10001455 3300025933 Bacteria 23670
403 Ga0207706_10196357 3300025933 Unclassified 1770
404 Ga0207686_10078083 3300025934 Unclassified 2151
405 Ga0207670_10172112 3300025936 Bacteria 1625
406 Ga0207704_10000865 3300025938 Bacteria 13433
407 Ga0207704_10034700 3300025938 Unclassified 2881
408 Ga0207691_10053102 3300025940 Bacteria 3701
409 Ga0207691_10108381 3300025940 Bacteria 2472
410 Ga0207691_10189990 3300025940 Unclassified 1791
411 Ga0207691_10237129 3300025940 Bacteria 1578
412 Ga0207691_10256435 3300025940 Bacteria 1508
413 Ga0207691_10410450 3300025940 Unclassified 1154
414 Ga0207711_10033453 3300025941 Bacteria 4350
415 Ga0207689_10002462 3300025942 Bacteria 17250
416 Ga0207689_10005117 3300025942 Bacteria 11790
417 Ga0207689_10023163 3300025942 Bacteria 5214
418 Ga0207689_10025756 3300025942 Bacteria 4928
419 Ga0207689_10042795 3300025942 Unclassified 3745
420 Ga0207689_10143021 3300025942 Unclassified 1971
421 Ga0207689_10159919 3300025942 Bacteria 1856
422 Ga0207667_10015421 3300025949 Bacteria 8682
423 Ga0207667_10028601 3300025949 Bacteria 6053
424 Ga0207667_10032007 3300025949 Bacteria 5671
425 Ga0207667_10042309 3300025949 Bacteria 4843
426 Ga0207667_10043865 3300025949 Bacteria 4744
427 Ga0207667_10088060 3300025949 Bacteria 3211
428 Ga0207667_10140483 3300025949 Bacteria 2487
429 Ga0207667_10283788 3300025949 Bacteria 1692
430 Ga0207651_10022982 3300025960 Unclassified 3826
431 Ga0207651_10188797 3300025960 Bacteria 1642
432 Ga0207651_10243757 3300025960 Bacteria 1466
433 Ga0207712_10003356 3300025961 Bacteria 10134
434 Ga0207712_10036831 3300025961 Bacteria 3334
435 Ga0207712_10079862 3300025961 Bacteria 2377
436 Ga0207712_10115528 3300025961 Bacteria 2021
437 Ga0207712_10200689 3300025961 Bacteria 1581
438 Ga0207668_10073121 3300025972 Unclassified 2456
439 Ga0207668_10349814 3300025972 Bacteria 1235
440 Ga0207640_10177078 3300025981 Unclassified 1595
441 Ga0207658_10033705 3300025986 Unclassified 3654
442 Ga0207658_10252389 3300025986 Bacteria 1499
443 Ga0207677_10019081 3300026023 Bacteria 4132
444 Ga0207677_10025146 3300026023 Bacteria 3710
445 Ga0207677_10034747 3300026023 Bacteria 3267
446 Ga0207677_10357915 3300026023 Bacteria 1225
447 Ga0207703_10001555 3300026035 Bacteria 20808
448 Ga0207639_10010504 3300026041 Bacteria 6413
449 Ga0207639_10017901 3300026041 Bacteria 5026
450 Ga0207639_10045403 3300026041 Bacteria 3309
451 Ga0207639_10389926 3300026041 Bacteria 1252
452 Ga0207678_10228516 3300026067 Bacteria 1593
453 Ga0207678_10279261 3300026067 Bacteria 1433
454 Ga0207702_10000284 3300026078 Bacteria 58710
455 Ga0207702_10010087 3300026078 Bacteria 7916
456 Ga0207702_10025913 3300026078 Bacteria 4868
457 Ga0207702_10069308 3300026078 Bacteria 3032
458 Ga0207702_10524745 3300026078 Bacteria 1156
459 Ga0207641_10000822 3300026088 Bacteria 32995
460 Ga0207641_10034437 3300026088 Bacteria 4213
461 Ga0207648_10000287 3300026089 Bacteria 54959
462 Ga0207648_10006750 3300026089 Bacteria 11382
463 Ga0207648_10013507 3300026089 Bacteria 7595
464 Ga0207648_10092693 3300026089 Bacteria 2642
465 Ga0207648_10107781 3300026089 Bacteria 2445
466 Ga0207648_10140772 3300026089 Bacteria 2126
467 Ga0207648_10469970 3300026089 Unclassified 1147
468 Ga0207676_10023203 3300026095 Bacteria 4573
469 Ga0207676_10241428 3300026095 Bacteria 1621
470 Ga0207674_10027464 3300026116 Bacteria 6019
471 Ga0207674_10029423 3300026116 Bacteria 5783
472 Ga0207674_10045292 3300026116 Bacteria 4526
473 Ga0207674_10232642 3300026116 Bacteria 1791
474 Ga0207674_10234027 3300026116 Bacteria 1785
475 Ga0207675_100000809 3300026118 Bacteria 31123
476 Ga0207675_100003900 3300026118 Bacteria 14503
477 Ga0207675_100117894 3300026118 Bacteria 2510
478 Ga0207675_100135790 3300026118 Bacteria 2334
479 Ga0207675_100290907 3300026118 Unclassified 1589
480 Ga0207683_10006941 3300026121 Bacteria 9700
481 Ga0207683_10020939 3300026121 Bacteria 5597
482 Ga0207683_10038703 3300026121 Bacteria 4159
483 Ga0207698_10021014 3300026142 Bacteria 4508
484 Ga0207698_10031730 3300026142 Bacteria 3818
485 Ga0207698_10081928 3300026142 Bacteria 2607
486 Ga0207698_10087641 3300026142 Bacteria 2536
487 Ga0207698_10111931 3300026142 Bacteria 2290
488 Ga0207698_10292884 3300026142 Bacteria 1511
489 Ga0207428_10104248 3300027907 Bacteria 2189
490 Ga0268266_10000018 3300028379 Bacteria 569141
491 Ga0268266_10000068 3300028379 Bacteria 241100
492 Ga0268266_10496538 3300028379 Unclassified 1165
493 Ga0268265_10033848 3300028380 Bacteria 3719
494 Ga0268265_10055177 3300028380 Bacteria 3018
495 Ga0268264_10000079 3300028381 Bacteria 249516
496 Ga0268264_10020412 3300028381 Bacteria 5415
497 Ga0268264_10021937 3300028381 Bacteria 5211
498 Ga0268264_10027627 3300028381 Bacteria 4639
499 Ga0268264_10039304 3300028381 Bacteria 3908
500 Ga0268264_10255550 3300028381 Bacteria 1630
501 Ga0268264_10314927 3300028381 Bacteria 1478
502 Ga0307517_10035483 3300028786 Bacteria 5643
503 Ga0307515_10000162 3300028794 Bacteria 163720
504 Ga0307515_10000432 3300028794 Bacteria 100348
505 Ga0307515_10009167 3300028794 Bacteria 19183
506 Ga0265338_10329370 3300028800 Bacteria 1103
507 Ga0307511_10000554 3300030521 Bacteria 40123
508 Ga0265327_10000404 3300031251 Bacteria 80704
509 Ga0265327_10065236 3300031251 Bacteria 1842
510 Ga0307513_10048179 3300031456 Unclassified 4627
511 Ga0307513_10227583 3300031456 Bacteria 1680
512 Ga0307509_10060375 3300031507 Bacteria 4008
513 Ga0307509_10060866 3300031507 Bacteria 3989
514 Ga0307509_10070483 3300031507 Bacteria 3650
515 Ga0307509_10202033 3300031507 Bacteria 1823
516 Ga0307509_10311500 3300031507 Bacteria 1316
517 Ga0307508_10000636 3300031616 Bacteria 42249
518 Ga0307516_10001823 3300031730 Bacteria 29270
519 Ga0307507_10000010 3300033179 Bacteria 265208
520 Ga0307507_10115698 3300033179 Bacteria 2169
521 Ga0307510_10000152 3300033180 Bacteria 57328
522 Ga0307510_10003890 3300033180 Bacteria 17505
523 Ga0373936_0025576 3300035113 Bacteria 2309
524 Ga0373927_0233261 3300035695 Bacteria 1209
525 Ga0395899_0000201 3300037312 Bacteria 87516
526 Ga0395899_0024171 3300037312 Bacteria 4596
527 Ga0395900_0000517 3300037418 Bacteria 54614
528 Ga0395900_0001762 3300037418 Bacteria 24846
529 Ga0395900_0022338 3300037418 Bacteria 6471
530 Ga0395898_0088598 3300037466 Bacteria 2979
531 Ga0395898_0345811 3300037466 Bacteria 1418
532 Ga0395905_0001720 3300037471 Bacteria 25699
533 Ga0395905_0004255 3300037471 Bacteria 14951
534 Ga0395901_0005902 3300038443 Bacteria 12396
535 Ga0436365_0198288 3300039437 Bacteria 8842
536 Ga0436365_0636704 3300039437 Bacteria 3534
537 Ga0436365_0993235 3300039437 Bacteria 2532
538 Ga0436365_1678505 3300039437 Bacteria 2471
539 Ga0436361_0684828 3300039447 Bacteria 21305
540 Ga0439436_0007386 3300041404 Bacteria 3382
541 Ga0439439_0009634 3300041406 Bacteria 2302
542 Ga0439439_0031168 3300041406 Unclassified 1358
543 Ga0451800_0297691 3300041459 Bacteria 1146
544 Ga0451807_1019217 3300041486 Bacteria 1050
545 Ga0439441_003589 3300042001 Unclassified 2296
546 Ga0439457_002679 3300042014 Bacteria 5016
547 Ga0439462_0001130 3300042015 Bacteria 5793
548 Ga0450897_001428 3300042128 Bacteria 1630
549 Ga0450898_009869 3300042134 Bacteria 1535
550 Ga0439444_0016855 3300042437 Bacteria 1248
551 Ga0451577_0459413 3300042876 Unclassified 1156
552 Ga0466972_0000123 3300044658 Bacteria 65577
553 Ga0466972_0003081 3300044658 Bacteria 8260
554 Ga0466972_0013598 3300044658 Bacteria 4084
555 Ga0453683_0062736 3300044673 Bacteria 2323
556 Ga0466965_0063603 3300044683 Unclassified 1847
557 Ga0466961_0013023 3300044693 Bacteria 5321
558 Ga0453684_0000525 3300044712 Bacteria 146588
559 Ga0453684_0022337 3300044712 Bacteria 9391
560 Ga0453684_0036571 3300044712 Bacteria 6765
561 Ga0453684_0207670 3300044712 Bacteria 2278
562 Ga0453684_0592919 3300044712 Bacteria 1216
563 Ga0466957_0000689 3300044842 Bacteria 17232
564 Ga0466957_0001397 3300044842 Bacteria 12589
565 Ga0466959_0012351 3300045049 Bacteria 6169
566 Ga0466959_0094511 3300045049 Bacteria 2145
567 Ga0495592_0106442 3300046454 Bacteria 1991
568 Ga0495651_0143081 3300046462 Bacteria 1732
569 Ga0495585_0001492 3300046492 Bacteria 18281
570 Ga0495606_0030288 3300046507 Bacteria 3783
571 Ga0495631_0005290 3300046518 Bacteria 6777
572 Ga0495644_0016557 3300046523 Bacteria 2821
573 Ga0495648_0004098 3300046524 Bacteria 12572
574 Ga0495648_0006383 3300046524 Bacteria 9637
575 Ga0495642_0136738 3300046528 Bacteria 1057
576 Ga0495652_0034660 3300046529 Bacteria 4399
577 Ga0495633_0000014 3300046558 Bacteria 261742
578 Ga0495668_0000003 3300046616 Bacteria 695023
579 Ga0495668_0019520 3300046616 Bacteria 3905
580 Ga0495668_0225702 3300046616 Bacteria 1026
581 Ga0495611_0000026 3300046648 Bacteria 118428
582 Ga0495625_0000471 3300046660 Bacteria 60628
583 Ga0495625_0006731 3300046660 Bacteria 10179
584 Ga0495625_0195241 3300046660 Bacteria 1339
585 Ga0495671_0067630 3300046692 Bacteria 1757
586 Ga0495672_0020619 3300047320 Bacteria 4313
587 Ga0495672_0040154 3300047320 Bacteria 2840
588 Ga0495687_000564 3300047443 Bacteria 43681
589 Ga0495687_002127 3300047443 Bacteria 16569
590 Ga0495686_0000005 3300047472 Bacteria 827143
591 Ga0495686_0007241 3300047472 Bacteria 8350
592 Ga0495686_0056014 3300047472 Bacteria 2464
593 Ga0495686_0134402 3300047472 Bacteria 1464
594 Ga0496101_0073988 3300048904 Bacteria 2504
595 Ga0496102_0092961 3300048905 Bacteria 2794
596 Ga0496104_0337866 3300048907 Bacteria 1419
597 Ga0496114_0121024 3300048917 Bacteria 2251
598 Ga0501031_0021070 3300049568 Bacteria 4251
599 Ga0501033_0132791 3300049570 Bacteria 1803
600 Ga0501034_0108768 3300049571 Bacteria 2763
601 Ga0501036_0148045 3300049572 Bacteria 1981
602 Ga0501036_0180830 3300049572 Bacteria 1775
603 Ga0501037_0040234 3300049573 Bacteria 3440
604 Ga0501038_0026641 3300049574 Bacteria 5147
605 Ga0501038_0165161 3300049574 Bacteria 1796
606 Ga0501039_0067171 3300049575 Bacteria 2784
607 Ga0501039_0089159 3300049575 Bacteria 2403
608 Ga0501043_0010266 3300049579 Bacteria 7338
609 Ga0501043_0061178 3300049579 Bacteria 2957
610 Ga0501047_0008874 3300049581 Bacteria 9484
611 Ga0501225_0004295 3300049705 Unclassified 4261
612 Ga0501080_0395180 3300049742 Bacteria 1244
613 Ga0501035_0195796 3300049822 Bacteria 1736
614 Ga0501044_0023696 3300049823 Bacteria 6527
615 nmdc:mga0k408_143045_c1 3300050493 Bacteria 1423
616 nmdc:mga0k408_332877_c1 3300050493 Bacteria 906
617 nmdc:mga0k408_4362_c1 3300050493 Bacteria 7510
618 nmdc:mga05p37_2057_c1 3300050507 Bacteria 23451
619 nmdc:mga09592_76023_c1 3300050508 Bacteria 2856
620 nmdc:mga06r32_24246_c1 3300050510 Bacteria 5627
621 nmdc:mga08y16_105877_c1 3300050511 Bacteria 2928
622 nmdc:mga08y16_375919_c1 3300050511 Bacteria 1457
623 Ga0500635_0013120 3300053080 Bacteria 2399
624 Ga0500578_0000060 3300053086 Bacteria 118274
625 Ga0500578_0232038 3300053086 Bacteria 1118
626 Ga0500583_0000003 3300053092 Bacteria 229587
627 Ga0500583_0000671 3300053092 Bacteria 10081
628 Ga0500583_0014253 3300053092 Unclassified 3105
629 Ga0500641_0000014 3300053096 Bacteria 150696
630 Ga0500608_007923 3300053122 Bacteria 4427
631 Ga0500618_000002 3300053125 Bacteria 370822
632 Ga0500642_0072720 3300053130 Bacteria 1567
633 Ga0500652_023681 3300053131 Bacteria 2337
634 Ga0500568_0000208 3300053139 Bacteria 51266
635 Ga0500604_0009255 3300053151 Bacteria 2624
636 Ga0500622_0000339 3300053156 Bacteria 46037
637 Ga0500622_0000398 3300053156 Bacteria 41643
638 Ga0500622_0186113 3300053156 Unclassified 955
639 Ga0500611_000001 3300053727 Bacteria 385744
640 Ga0500645_042911 3300053730 Bacteria 1333
641 Ga0466962_0104721 3300061719 Bacteria 1360

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10000592 Ga0105240_1000059260 258
2 3300009174 Ga0105241_10011903 Ga0105241_100119038 258
3 3300009545 Ga0105237_10003831 Ga0105237_1000383121 258
4 3300010375 Ga0105239_10001332 Ga0105239_100013326 258
5 3300047472 Ga0495686_0134402 Ga0495686_0134402_430_1326 269
6 3300041406 Ga0439439_0031168 Ga0439439_0031168_419_1240 271
7 3300046616 Ga0495668_0225702 Ga0495668_0225702_82_912 271
8 3300041486 Ga0451807_1019217 Ga0451807_1019217_22_864 277
9 3300025911 Ga0207654_10032105 Ga0207654_100321051 278
10 3300025913 Ga0207695_10000048 Ga0207695_10000048165 278
11 3300025914 Ga0207671_10007845 Ga0207671_1000784512 282
12 3300041459 Ga0451800_0297691 Ga0451800_0297691_33_887 282
13 3300044658 Ga0466972_0000123 Ga0466972_0000123_41599_42462 282
14 3300050493 nmdc:mga0k408_332877_c1 nmdc:mga0k408_332877_c1_13_870 282
15 3300053156 Ga0500622_0186113 Ga0500622_0186113_56_910 282
16 3300042876 Ga0451577_0459413 Ga0451577_0459413_280_1140 285
17 3300046692 Ga0495671_0067630 Ga0495671_0067630_141_1010 286
18 3300053096 Ga0500641_0000014 Ga0500641_0000014_96352_97221 286
19 3300005466 Ga0070685_10077141 Ga0070685_100771412 287
20 3300005577 Ga0068857_100316192 Ga0068857_1003161921 287
21 3300026116 Ga0207674_10232642 Ga0207674_102326421 287
22 3300006358 Ga0068871_100005284 Ga0068871_1000052844 288
23 3300009545 Ga0105237_10074175 Ga0105237_100741753 288
24 3300010375 Ga0105239_10119908 Ga0105239_101199082 288
25 3300010375 Ga0105239_10000805 Ga0105239_1000080514 289
26 3300037418 Ga0395900_0000517 Ga0395900_0000517_17361_18236 289
27 3300009093 Ga0105240_10051808 Ga0105240_100518082 290
28 3300009545 Ga0105237_10000702 Ga0105237_1000070230 290
29 3300009545 Ga0105237_10025884 Ga0105237_100258845 290
30 3300009545 Ga0105237_10469397 Ga0105237_104693973 290
31 3300010375 Ga0105239_10004499 Ga0105239_100044998 290
32 3300010375 Ga0105239_10059152 Ga0105239_100591524 290
33 3300011119 Ga0105246_10066584 Ga0105246_100665841 290
34 3300013105 Ga0157369_10170760 Ga0157369_101707604 290
35 3300013308 Ga0157375_10008136 Ga0157375_100081364 290
36 3300037418 Ga0395900_0022338 Ga0395900_0022338_1773_2651 290
37 3300037466 Ga0395898_0345811 Ga0395898_0345811_268_1146 290
38 3300037471 Ga0395905_0004255 Ga0395905_0004255_5861_6739 290
39 3300046454 Ga0495592_0106442 Ga0495592_0106442_554_1432 290
40 3300046462 Ga0495651_0143081 Ga0495651_0143081_64_942 290
41 3300046529 Ga0495652_0034660 Ga0495652_0034660_668_1546 290
42 3300047443 Ga0495687_002127 Ga0495687_002127_9262_10140 290
43 3300044712 Ga0453684_0592919 Ga0453684_0592919_15_911 291
44 3300009551 Ga0105238_10166714 Ga0105238_101667141 292
45 3300010375 Ga0105239_10402600 Ga0105239_104026001 292
46 3300046492 Ga0495585_0001492 Ga0495585_0001492_2019_2909 293
47 3300046524 Ga0495648_0004098 Ga0495648_0004098_8082_8972 293
48 3300046558 Ga0495633_0000014 Ga0495633_0000014_72730_73620 293
49 3300046616 Ga0495668_0000003 Ga0495668_0000003_320245_321135 293
50 3300046660 Ga0495625_0000471 Ga0495625_0000471_4387_5277 293
51 3300046660 Ga0495625_0006731 Ga0495625_0006731_6095_6985 293
52 3300050493 nmdc:mga0k408_4362_c1 nmdc:mga0k408_4362_c1_3574_4464 293
53 3300053125 Ga0500618_000002 Ga0500618_000002_303355_304245 293
54 iso_pu_bacteria 8056440228 8056443761 293
55 3300005834 Ga0068851_10099318 Ga0068851_100993182 294
56 3300046660 Ga0495625_0195241 Ga0495625_0195241_118_1011 294
57 3300009551 Ga0105238_10087602 Ga0105238_100876022 295
58 3300014325 Ga0163163_10551295 Ga0163163_105512952 295
59 3300014969 Ga0157376_10363064 Ga0157376_103630641 295
60 3300025913 Ga0207695_10053020 Ga0207695_100530203 295
61 3300053086 Ga0500578_0000060 Ga0500578_0000060_46090_46992 295
62 3300053092 Ga0500583_0000003 Ga0500583_0000003_165367_166260 295
63 3300005295 Ga0065707_10012190 Ga0065707_100121902 296
64 3300005365 Ga0070688_100027128 Ga0070688_1000271283 296
65 3300005367 Ga0070667_100491518 Ga0070667_1004915182 296
66 3300005539 Ga0068853_100198243 Ga0068853_1001982432 296
67 3300005543 Ga0070672_100310705 Ga0070672_1003107052 296
68 3300009093 Ga0105240_10052823 Ga0105240_100528232 298
69 3300013307 Ga0157372_10326533 Ga0157372_103265332 298
70 3300025911 Ga0207654_10051738 Ga0207654_100517382 298
71 3300045049 Ga0466959_0094511 Ga0466959_0094511_312_1367 298
72 3300049581 Ga0501047_0008874 Ga0501047_0008874_7033_7935 298
73 3300049822 Ga0501035_0195796 Ga0501035_0195796_186_1088 298
74 3300049823 Ga0501044_0023696 Ga0501044_0023696_1541_2443 298
75 3300005548 Ga0070665_100000014 Ga0070665_100000014290 299
76 3300006237 Ga0097621_100003375 Ga0097621_1000033758 299
77 3300009147 Ga0114129_10002011 Ga0114129_1000201119 299
78 3300013296 Ga0157374_10267459 Ga0157374_102674592 299
79 3300013297 Ga0157378_10062651 Ga0157378_100626511 299
80 3300013306 Ga0163162_10079496 Ga0163162_100794961 299
81 3300028379 Ga0268266_10000068 Ga0268266_10000068144 299
82 3300044683 Ga0466965_0063603 Ga0466965_0063603_486_1412 299
83 3300044712 Ga0453684_0000525 Ga0453684_0000525_133118_134095 299
84 3300046524 Ga0495648_0006383 Ga0495648_0006383_1311_2240 299
85 3300047443 Ga0495687_000564 Ga0495687_000564_28368_29297 299
86 3300050493 nmdc:mga0k408_143045_c1 nmdc:mga0k408_143045_c1_59_967 299
87 3300050507 nmdc:mga05p37_2057_c1 nmdc:mga05p37_2057_c1_20099_21004 299
88 3300053092 Ga0500583_0014253 Ga0500583_0014253_1462_2391 299
89 3300053130 Ga0500642_0072720 Ga0500642_0072720_572_1501 299
90 3300053156 Ga0500622_0000398 Ga0500622_0000398_36208_37137 299
91 iso_pu_bacteria 2929921140 2929926467 299
92 3300005456 Ga0070678_100071575 Ga0070678_1000715752 300
93 3300009093 Ga0105240_10000226 Ga0105240_1000022671 300
94 3300014326 Ga0157380_10010345 Ga0157380_100103452 300
95 3300025913 Ga0207695_10000313 Ga0207695_1000031328 300
96 3300049568 Ga0501031_0021070 Ga0501031_0021070_2673_3599 300
97 3300049570 Ga0501033_0132791 Ga0501033_0132791_391_1323 300
98 3300049571 Ga0501034_0108768 Ga0501034_0108768_1482_2408 300
99 3300049572 Ga0501036_0148045 Ga0501036_0148045_351_1277 300
100 3300049572 Ga0501036_0180830 Ga0501036_0180830_57_986 300
101 3300049573 Ga0501037_0040234 Ga0501037_0040234_390_1316 300
102 3300049574 Ga0501038_0026641 Ga0501038_0026641_3489_4418 300
103 3300049574 Ga0501038_0165161 Ga0501038_0165161_423_1349 300
104 3300049575 Ga0501039_0067171 Ga0501039_0067171_1285_2211 300
105 3300049575 Ga0501039_0089159 Ga0501039_0089159_273_1202 300
106 3300049579 Ga0501043_0061178 Ga0501043_0061178_1013_1939 300
107 3300005539 Ga0068853_100001501 Ga0068853_1000015014 301
108 3300005614 Ga0068856_100070260 Ga0068856_1000702602 301
109 3300005616 Ga0068852_100192819 Ga0068852_1001928192 301
110 3300005843 Ga0068860_100000061 Ga0068860_10000006188 301
111 3300005843 Ga0068860_100002976 Ga0068860_10000297615 301
112 3300009093 Ga0105240_10000190 Ga0105240_1000019076 301
113 3300009093 Ga0105240_10000674 Ga0105240_1000067418 301
114 3300009093 Ga0105240_10022499 Ga0105240_100224995 301
115 3300009093 Ga0105240_10029462 Ga0105240_100294623 301
116 3300009093 Ga0105240_10467091 Ga0105240_104670912 301
117 3300009545 Ga0105237_10006551 Ga0105237_1000655111 301
118 3300009545 Ga0105237_10010656 Ga0105237_100106567 301
119 3300009551 Ga0105238_10011536 Ga0105238_100115366 301
120 3300009551 Ga0105238_10141707 Ga0105238_101417072 301
121 3300010375 Ga0105239_10174238 Ga0105239_101742381 301
122 3300013306 Ga0163162_10003819 Ga0163162_100038193 301
123 3300025904 Ga0207647_10090697 Ga0207647_100906972 301
124 3300025911 Ga0207654_10057872 Ga0207654_100578722 301
125 3300025913 Ga0207695_10000276 Ga0207695_1000027626 301
126 3300025913 Ga0207695_10001456 Ga0207695_1000145627 301
127 3300025914 Ga0207671_10001496 Ga0207671_100014963 301
128 3300025914 Ga0207671_10008980 Ga0207671_100089805 301
129 3300025924 Ga0207694_10160057 Ga0207694_101600572 301
130 3300026078 Ga0207702_10069308 Ga0207702_100693082 301
131 3300026118 Ga0207675_100290907 Ga0207675_1002909071 301
132 3300026142 Ga0207698_10031730 Ga0207698_100317302 301
133 3300026142 Ga0207698_10111931 Ga0207698_101119312 301
134 3300028381 Ga0268264_10000079 Ga0268264_1000007995 301
135 3300044658 Ga0466972_0013598 Ga0466972_0013598_2732_3667 301
136 3300053086 Ga0500578_0232038 Ga0500578_0232038_64_999 301
137 3300003322 rootL2_10201656 rootL2_102016563 302
138 3300005334 Ga0068869_100015579 Ga0068869_1000155791 302
139 3300005843 Ga0068860_100003705 Ga0068860_1000037053 302
140 3300005844 Ga0068862_100014299 Ga0068862_1000142993 302
141 3300025942 Ga0207689_10023163 Ga0207689_100231633 302
142 3300028380 Ga0268265_10033848 Ga0268265_100338482 302
143 3300028381 Ga0268264_10039304 Ga0268264_100393043 302
144 3300044842 Ga0466957_0001397 Ga0466957_0001397_8805_9731 302
145 3300046648 Ga0495611_0000026 Ga0495611_0000026_64437_65420 302
146 3300003354 JGI25160J50197_1011117 JGI25160J50197_10111172 303
147 3300005336 Ga0070680_100015425 Ga0070680_1000154255 303
148 3300005337 Ga0070682_100013193 Ga0070682_1000131931 303
149 3300005339 Ga0070660_100105177 Ga0070660_1001051772 303
150 3300005458 Ga0070681_10119122 Ga0070681_101191222 303
151 3300005530 Ga0070679_100034065 Ga0070679_1000340654 303
152 3300005539 Ga0068853_100068377 Ga0068853_1000683772 303
153 3300005547 Ga0070693_100006246 Ga0070693_1000062465 303
154 3300005563 Ga0068855_100160964 Ga0068855_1001609642 303
155 3300009093 Ga0105240_10034712 Ga0105240_100347125 303
156 3300009174 Ga0105241_10066771 Ga0105241_100667712 303
157 3300009553 Ga0105249_10075366 Ga0105249_100753662 303
158 3300013100 Ga0157373_10183467 Ga0157373_101834672 303
159 3300013104 Ga0157370_10078587 Ga0157370_100785872 303
160 3300025246 Ga0209646_1000003 Ga0209646_1000003286 303
161 3300025250 Ga0209026_1000614 Ga0209026_100061418 303
162 3300025297 Ga0209758_1009686 Ga0209758_10096863 303
163 3300025302 Ga0207426_1000187 Ga0207426_100018722 303
164 3300025904 Ga0207647_10046627 Ga0207647_100466273 303
165 3300025911 Ga0207654_10015732 Ga0207654_100157325 303
166 3300025912 Ga0207707_10012790 Ga0207707_100127903 303
167 3300025913 Ga0207695_10046685 Ga0207695_100466853 303
168 3300025914 Ga0207671_10240604 Ga0207671_102406042 303
169 3300025917 Ga0207660_10013389 Ga0207660_100133895 303
170 3300025919 Ga0207657_10053840 Ga0207657_100538402 303
171 3300025921 Ga0207652_10019385 Ga0207652_100193853 303
172 3300025949 Ga0207667_10088060 Ga0207667_100880602 303
173 3300026041 Ga0207639_10045403 Ga0207639_100454032 303
174 3300044673 Ga0453683_0062736 Ga0453683_0062736_1339_2280 303
175 3300044712 Ga0453684_0022337 Ga0453684_0022337_5473_6414 303
176 3300053131 Ga0500652_023681 Ga0500652_023681_742_1671 303
177 3300003322 rootL2_10155262 rootL2_101552623 304
178 3300005843 Ga0068860_100339323 Ga0068860_1003393232 304
179 3300006195 Ga0075366_10000467 Ga0075366_100004676 304
180 3300009176 Ga0105242_10131094 Ga0105242_101310942 304
181 3300028381 Ga0268264_10314927 Ga0268264_103149272 304
182 3300031730 Ga0307516_10001823 Ga0307516_1000182323 304
183 3300042128 Ga0450897_001428 Ga0450897_001428_467_1405 304
184 3300044712 Ga0453684_0207670 Ga0453684_0207670_473_1408 304
185 3300047472 Ga0495686_0000005 Ga0495686_0000005_455946_456896 304
186 3300047472 Ga0495686_0007241 Ga0495686_0007241_7141_8079 304
187 3300053727 Ga0500611_000001 Ga0500611_000001_197781_198716 304
188 3300003320 rootH2_10005472 rootH2_1000547245 305
189 3300005288 Ga0065714_10080179 Ga0065714_100801792 305
190 3300005288 Ga0065714_10086384 Ga0065714_100863841 305
191 3300005328 Ga0070676_10051751 Ga0070676_100517512 305
192 3300005334 Ga0068869_100068504 Ga0068869_1000685042 305
193 3300005334 Ga0068869_100130520 Ga0068869_1001305202 305
194 3300005335 Ga0070666_10005046 Ga0070666_100050467 305
195 3300005338 Ga0068868_100005340 Ga0068868_1000053405 305
196 3300005347 Ga0070668_100079253 Ga0070668_1000792531 305
197 3300005354 Ga0070675_100081962 Ga0070675_1000819622 305
198 3300005367 Ga0070667_100043098 Ga0070667_1000430983 305
199 3300005367 Ga0070667_100130870 Ga0070667_1001308702 305
200 3300005456 Ga0070678_100013581 Ga0070678_1000135815 305
201 3300005459 Ga0068867_100101189 Ga0068867_1001011892 305
202 3300005543 Ga0070672_100360953 Ga0070672_1003609532 305
203 3300005548 Ga0070665_100229043 Ga0070665_1002290432 305
204 3300005614 Ga0068856_100421135 Ga0068856_1004211351 305
205 3300005616 Ga0068852_100239745 Ga0068852_1002397452 305
206 3300005616 Ga0068852_100331745 Ga0068852_1003317451 305
207 3300005617 Ga0068859_100032587 Ga0068859_1000325873 305
208 3300005617 Ga0068859_100070254 Ga0068859_1000702542 305
209 3300005719 Ga0068861_100030623 Ga0068861_1000306232 305
210 3300005840 Ga0068870_10048014 Ga0068870_100480142 305
211 3300005843 Ga0068860_100007315 Ga0068860_1000073152 305
212 3300005844 Ga0068862_100102338 Ga0068862_1001023382 305
213 3300005844 Ga0068862_100166355 Ga0068862_1001663552 305
214 3300006195 Ga0075366_10000806 Ga0075366_100008064 305
215 3300006237 Ga0097621_100089226 Ga0097621_1000892262 305
216 3300006237 Ga0097621_100224693 Ga0097621_1002246932 305
217 3300006353 Ga0075370_10091589 Ga0075370_100915891 305
218 3300006358 Ga0068871_100010670 Ga0068871_1000106702 305
219 3300006881 Ga0068865_100088179 Ga0068865_1000881792 305
220 3300006931 Ga0097620_100032588 Ga0097620_1000325883 305
221 3300006931 Ga0097620_100070253 Ga0097620_1000702532 305
222 3300009174 Ga0105241_10567956 Ga0105241_105679561 305
223 3300009176 Ga0105242_10047864 Ga0105242_100478642 305
224 3300009177 Ga0105248_10011596 Ga0105248_100115965 305
225 3300009177 Ga0105248_10406345 Ga0105248_104063452 305
226 3300009553 Ga0105249_10053249 Ga0105249_100532492 305
227 3300009553 Ga0105249_10110699 Ga0105249_101106992 305
228 3300010375 Ga0105239_10463978 Ga0105239_104639782 305
229 3300011119 Ga0105246_10009499 Ga0105246_100094994 305
230 3300013296 Ga0157374_10034609 Ga0157374_100346092 305
231 3300013296 Ga0157374_10211559 Ga0157374_102115592 305
232 3300013308 Ga0157375_10003913 Ga0157375_1000391311 305
233 3300014325 Ga0163163_10000079 Ga0163163_1000007919 305
234 3300014968 Ga0157379_10007087 Ga0157379_100070872 305
235 3300014969 Ga0157376_10013495 Ga0157376_100134953 305
236 3300025901 Ga0207688_10004663 Ga0207688_100046633 305
237 3300025907 Ga0207645_10001491 Ga0207645_1000149115 305
238 3300025908 Ga0207643_10068902 Ga0207643_100689022 305
239 3300025918 Ga0207662_10070856 Ga0207662_100708562 305
240 3300025923 Ga0207681_10263573 Ga0207681_102635732 305
241 3300025926 Ga0207659_10240131 Ga0207659_102401312 305
242 3300025933 Ga0207706_10196357 Ga0207706_101963572 305
243 3300025938 Ga0207704_10034700 Ga0207704_100347002 305
244 3300025940 Ga0207691_10189990 Ga0207691_101899901 305
245 3300025940 Ga0207691_10256435 Ga0207691_102564351 305
246 3300025942 Ga0207689_10002462 Ga0207689_100024628 305
247 3300025942 Ga0207689_10025756 Ga0207689_100257562 305
248 3300025942 Ga0207689_10159919 Ga0207689_101599192 305
249 3300025961 Ga0207712_10079862 Ga0207712_100798622 305
250 3300025981 Ga0207640_10177078 Ga0207640_101770782 305
251 3300025986 Ga0207658_10252389 Ga0207658_102523892 305
252 3300026023 Ga0207677_10019081 Ga0207677_100190812 305
253 3300026067 Ga0207678_10279261 Ga0207678_102792612 305
254 3300026089 Ga0207648_10006750 Ga0207648_100067504 305
255 3300026089 Ga0207648_10107781 Ga0207648_101077812 305
256 3300026118 Ga0207675_100000809 Ga0207675_10000080912 305
257 3300026118 Ga0207675_100003900 Ga0207675_1000039003 305
258 3300026121 Ga0207683_10020939 Ga0207683_100209395 305
259 3300026142 Ga0207698_10292884 Ga0207698_102928842 305
260 3300028794 Ga0307515_10000432 Ga0307515_1000043256 305
261 3300028794 Ga0307515_10009167 Ga0307515_1000916714 305
262 3300030521 Ga0307511_10000554 Ga0307511_1000055427 305
263 3300033179 Ga0307507_10000010 Ga0307507_10000010113 305
264 3300033179 Ga0307507_10115698 Ga0307507_101156982 305
265 3300044712 Ga0453684_0036571 Ga0453684_0036571_3913_4845 305
266 3300046523 Ga0495644_0016557 Ga0495644_0016557_21_950 305
267 3300046528 Ga0495642_0136738 Ga0495642_0136738_12_1001 305
268 3300048904 Ga0496101_0073988 Ga0496101_0073988_144_1079 305
269 3300048905 Ga0496102_0092961 Ga0496102_0092961_496_1431 305
270 3300048907 Ga0496104_0337866 Ga0496104_0337866_466_1401 305
271 3300048917 Ga0496114_0121024 Ga0496114_0121024_181_1116 305
272 3300005367 Ga0070667_100176587 Ga0070667_1001765872 306
273 3300005471 Ga0070698_100003063 Ga0070698_10000306312 306
274 3300005617 Ga0068859_100048334 Ga0068859_1000483342 306
275 3300005843 Ga0068860_100209152 Ga0068860_1002091522 306
276 3300005983 Ga0081540_1002830 Ga0081540_10028307 306
277 3300005985 Ga0081539_10003031 Ga0081539_1000303117 306
278 3300006931 Ga0097620_100048331 Ga0097620_1000483314 306
279 3300009101 Ga0105247_10001913 Ga0105247_100019138 306
280 3300009545 Ga0105237_10000229 Ga0105237_1000022954 306
281 3300009553 Ga0105249_10007902 Ga0105249_100079027 306
282 3300013306 Ga0163162_10114033 Ga0163162_101140334 306
283 3300025900 Ga0207710_10001330 Ga0207710_100013308 306
284 3300025914 Ga0207671_10001671 Ga0207671_1000167114 306
285 3300025940 Ga0207691_10053102 Ga0207691_100531023 306
286 3300025961 Ga0207712_10003356 Ga0207712_100033562 306
287 3300028381 Ga0268264_10021937 Ga0268264_100219373 306
288 3300002737 JGI25162J39368_1002039 JGI25162J39368_10020393 307
289 3300003214 JGI25165J46597_1000620 JGI25165J46597_10006209 307
290 3300003320 rootH2_10037638 rootH2_100376382 307
291 3300003323 rootH1_10002605 rootH1_1000260530 307
292 3300003323 rootH1_10065577 rootH1_100655772 307
293 3300003354 JGI25160J50197_1001307 JGI25160J50197_10013075 307
294 3300005327 Ga0070658_10191733 Ga0070658_101917332 307
295 3300005530 Ga0070679_100080929 Ga0070679_1000809292 307
296 3300005563 Ga0068855_100009960 Ga0068855_1000099606 307
297 3300005577 Ga0068857_100252508 Ga0068857_1002525082 307
298 3300005614 Ga0068856_100000271 Ga0068856_10000027133 307
299 3300005614 Ga0068856_100045584 Ga0068856_1000455845 307
300 3300009093 Ga0105240_10034100 Ga0105240_100341007 307
301 3300009094 Ga0111539_10024937 Ga0111539_100249377 307
302 3300009545 Ga0105237_10002329 Ga0105237_100023292 307
303 3300009545 Ga0105237_10007386 Ga0105237_100073869 307
304 3300009545 Ga0105237_10011389 Ga0105237_100113897 307
305 3300010375 Ga0105239_10000013 Ga0105239_10000013246 307
306 3300010375 Ga0105239_10000019 Ga0105239_10000019135 307
307 3300010375 Ga0105239_10009377 Ga0105239_1000937711 307
308 3300013102 Ga0157371_10182377 Ga0157371_101823772 307
309 3300013296 Ga0157374_10000011 Ga0157374_10000011265 307
310 3300013307 Ga0157372_10119388 Ga0157372_101193883 307
311 3300014969 Ga0157376_10004662 Ga0157376_100046623 307
312 3300025230 Ga0209563_108161 Ga0209563_1081612 307
313 3300025231 Ga0207427_100106 Ga0207427_10010657 307
314 3300025233 Ga0209437_100226 Ga0209437_10022656 307
315 3300025261 Ga0209233_1000089 Ga0209233_100008956 307
316 3300025302 Ga0207426_1000023 Ga0207426_1000023273 307
317 3300025911 Ga0207654_10142992 Ga0207654_101429922 307
318 3300025913 Ga0207695_10042476 Ga0207695_100424762 307
319 3300025914 Ga0207671_10020629 Ga0207671_100206294 307
320 3300025914 Ga0207671_10032247 Ga0207671_100322472 307
321 3300025914 Ga0207671_10152335 Ga0207671_101523352 307
322 3300025921 Ga0207652_10254067 Ga0207652_102540672 307
323 3300025949 Ga0207667_10015421 Ga0207667_100154213 307
324 3300026078 Ga0207702_10000284 Ga0207702_1000028434 307
325 3300026078 Ga0207702_10025913 Ga0207702_100259134 307
326 3300028800 Ga0265338_10329370 Ga0265338_103293702 307
327 3300031507 Ga0307509_10060866 Ga0307509_100608662 307
328 3300031507 Ga0307509_10202033 Ga0307509_102020332 307
329 3300033180 Ga0307510_10000152 Ga0307510_1000015220 307
330 3300044693 Ga0466961_0013023 Ga0466961_0013023_416_1375 307
331 3300045049 Ga0466959_0012351 Ga0466959_0012351_3261_4220 307
332 3300047472 Ga0495686_0056014 Ga0495686_0056014_1324_2283 307
333 3300049742 Ga0501080_0395180 Ga0501080_0395180_42_1007 307
334 3300003320 rootH2_10161659 rootH2_101616593 308
335 3300005353 Ga0070669_100155527 Ga0070669_1001555272 308
336 3300005354 Ga0070675_100078530 Ga0070675_1000785302 308
337 3300005367 Ga0070667_100017847 Ga0070667_1000178475 308
338 3300005367 Ga0070667_100319953 Ga0070667_1003199532 308
339 3300005459 Ga0068867_100053309 Ga0068867_1000533093 308
340 3300005539 Ga0068853_100206147 Ga0068853_1002061472 308
341 3300005543 Ga0070672_100086567 Ga0070672_1000865672 308
342 3300005617 Ga0068859_100025612 Ga0068859_1000256125 308
343 3300005618 Ga0068864_100132027 Ga0068864_1001320272 308
344 3300005618 Ga0068864_100144691 Ga0068864_1001446912 308
345 3300005834 Ga0068851_10082321 Ga0068851_100823212 308
346 3300005841 Ga0068863_100016345 Ga0068863_1000163455 308
347 3300005844 Ga0068862_100497565 Ga0068862_1004975651 308
348 3300006358 Ga0068871_100003925 Ga0068871_1000039253 308
349 3300006881 Ga0068865_100350684 Ga0068865_1003506842 308
350 3300006931 Ga0097620_100025612 Ga0097620_1000256125 308
351 3300009176 Ga0105242_10178072 Ga0105242_101780722 308
352 3300009551 Ga0105238_10343219 Ga0105238_103432192 308
353 3300009553 Ga0105249_10008648 Ga0105249_100086483 308
354 3300009553 Ga0105249_10060457 Ga0105249_100604572 308
355 3300011119 Ga0105246_10216386 Ga0105246_102163862 308
356 3300013296 Ga0157374_10131414 Ga0157374_101314142 308
357 3300013297 Ga0157378_10112342 Ga0157378_101123423 308
358 3300013297 Ga0157378_10453635 Ga0157378_104536351 308
359 3300013306 Ga0163162_10419844 Ga0163162_104198442 308
360 3300013308 Ga0157375_10120617 Ga0157375_101206172 308
361 3300013308 Ga0157375_10257788 Ga0157375_102577882 308
362 3300014325 Ga0163163_10134098 Ga0163163_101340982 308
363 3300014745 Ga0157377_10076962 Ga0157377_100769622 308
364 3300014968 Ga0157379_10134639 Ga0157379_101346391 308
365 3300017792 Ga0163161_10035152 Ga0163161_100351522 308
366 3300021384 Ga0213876_10064772 Ga0213876_100647722 308
367 3300025321 Ga0207656_10088161 Ga0207656_100881612 308
368 3300025907 Ga0207645_10248291 Ga0207645_102482911 308
369 3300025925 Ga0207650_10030387 Ga0207650_100303872 308
370 3300025940 Ga0207691_10108381 Ga0207691_101083812 308
371 3300025942 Ga0207689_10042795 Ga0207689_100427952 308
372 3300025961 Ga0207712_10115528 Ga0207712_101155282 308
373 3300025961 Ga0207712_10200689 Ga0207712_102006892 308
374 3300025986 Ga0207658_10033705 Ga0207658_100337052 308
375 3300026088 Ga0207641_10034437 Ga0207641_100344372 308
376 3300026089 Ga0207648_10092693 Ga0207648_100926932 308
377 3300026089 Ga0207648_10469970 Ga0207648_104699702 308
378 3300026095 Ga0207676_10241428 Ga0207676_102414282 308
379 3300026116 Ga0207674_10234027 Ga0207674_102340272 308
380 3300026118 Ga0207675_100135790 Ga0207675_1001357902 308
381 3300026142 Ga0207698_10087641 Ga0207698_100876412 308
382 3300028381 Ga0268264_10027627 Ga0268264_100276272 308
383 3300028381 Ga0268264_10255550 Ga0268264_102555502 308
384 3300039437 Ga0436365_0198288 Ga0436365_0198288_1964_2932 308
385 3300039437 Ga0436365_0636704 Ga0436365_0636704_2065_3030 308
386 3300039437 Ga0436365_0993235 Ga0436365_0993235_583_1626 308
387 3300042001 Ga0439441_003589 Ga0439441_003589_785_1723 308
388 3300042437 Ga0439444_0016855 Ga0439444_0016855_56_994 308
389 3300047320 Ga0495672_0020619 Ga0495672_0020619_198_1154 308
390 3300047320 Ga0495672_0040154 Ga0495672_0040154_1840_2778 308
391 3300003316 rootH1_10084743 rootH1_100847432 309
392 3300003322 rootL2_10054299 rootL2_100542992 309
393 3300003322 rootL2_10089616 rootL2_100896165 309
394 3300005334 Ga0068869_100006659 Ga0068869_1000066591 309
395 3300005563 Ga0068855_100057646 Ga0068855_1000576463 309
396 3300005718 Ga0068866_10044369 Ga0068866_100443692 309
397 3300009174 Ga0105241_10010644 Ga0105241_100106442 309
398 3300009545 Ga0105237_10009599 Ga0105237_100095994 309
399 3300010375 Ga0105239_10006970 Ga0105239_100069707 309
400 3300013105 Ga0157369_10013285 Ga0157369_100132857 309
401 3300025899 Ga0207642_10060875 Ga0207642_100608752 309
402 3300025907 Ga0207645_10076371 Ga0207645_100763712 309
403 3300025913 Ga0207695_10034574 Ga0207695_100345742 309
404 3300025940 Ga0207691_10410450 Ga0207691_104104502 309
405 3300025942 Ga0207689_10143021 Ga0207689_101430211 309
406 3300025949 Ga0207667_10032007 Ga0207667_100320075 309
407 3300026089 Ga0207648_10013507 Ga0207648_100135072 309
408 3300031251 Ga0265327_10000404 Ga0265327_1000040429 309
409 3300031507 Ga0307509_10060375 Ga0307509_100603754 309
410 3300053139 Ga0500568_0000208 Ga0500568_0000208_1055_2014 309
411 3300053156 Ga0500622_0000339 Ga0500622_0000339_38708_39670 309
412 iso_pu_bacteria 2738541278 2738725705 309
413 3300005288 Ga0065714_10073558 Ga0065714_100735582 310
414 3300005340 Ga0070689_100028137 Ga0070689_1000281372 310
415 3300005347 Ga0070668_100351508 Ga0070668_1003515081 310
416 3300005354 Ga0070675_100035887 Ga0070675_1000358873 310
417 3300005577 Ga0068857_100117105 Ga0068857_1001171052 310
418 3300005617 Ga0068859_100071347 Ga0068859_1000713471 310
419 3300005719 Ga0068861_100107982 Ga0068861_1001079822 310
420 3300005844 Ga0068862_100090031 Ga0068862_1000900312 310
421 3300006931 Ga0097620_100071345 Ga0097620_1000713451 310
422 3300009094 Ga0111539_10095604 Ga0111539_100956042 310
423 3300013308 Ga0157375_10354861 Ga0157375_103548612 310
424 3300014326 Ga0157380_10032170 Ga0157380_100321704 310
425 3300014745 Ga0157377_10019384 Ga0157377_100193842 310
426 3300025907 Ga0207645_10209521 Ga0207645_102095212 310
427 3300025908 Ga0207643_10057407 Ga0207643_100574072 310
428 3300025936 Ga0207670_10172112 Ga0207670_101721122 310
429 3300025960 Ga0207651_10243757 Ga0207651_102437572 310
430 3300025972 Ga0207668_10349814 Ga0207668_103498142 310
431 3300026116 Ga0207674_10029423 Ga0207674_100294234 310
432 3300026118 Ga0207675_100117894 Ga0207675_1001178942 310
433 3300027907 Ga0207428_10104248 Ga0207428_101042482 310
434 3300028380 Ga0268265_10055177 Ga0268265_100551772 310
435 3300031251 Ga0265327_10065236 Ga0265327_100652362 310
436 3300042134 Ga0450898_009869 Ga0450898_009869_404_1360 310
437 3300050511 nmdc:mga08y16_105877_c1 nmdc:mga08y16_105877_c1_1070_2026 310
438 3300061719 Ga0466962_0104721 Ga0466962_0104721_216_1166 310
439 3300003322 rootL2_10048542 rootL2_100485422 311
440 3300005548 Ga0070665_100543459 Ga0070665_1005434591 311
441 3300013308 Ga0157375_10131968 Ga0157375_101319682 311
442 3300031616 Ga0307508_10000636 Ga0307508_1000063621 311
443 3300046507 Ga0495606_0030288 Ga0495606_0030288_2659_3606 311
444 3300046616 Ga0495668_0019520 Ga0495668_0019520_127_1092 311
445 3300053151 Ga0500604_0009255 Ga0500604_0009255_1573_2538 311
446 3300053730 Ga0500645_042911 Ga0500645_042911_310_1272 311
447 3300001990 JGI24737J22298_10035845 JGI24737J22298_100358451 312
448 3300005338 Ga0068868_100030994 Ga0068868_1000309942 312
449 3300005353 Ga0070669_100127838 Ga0070669_1001278382 312
450 3300005457 Ga0070662_100000153 Ga0070662_10000015332 312
451 3300005539 Ga0068853_100142660 Ga0068853_1001426602 312
452 3300005563 Ga0068855_100007819 Ga0068855_1000078195 312
453 3300005577 Ga0068857_100037651 Ga0068857_1000376513 312
454 3300005577 Ga0068857_100116526 Ga0068857_1001165262 312
455 3300005614 Ga0068856_100002643 Ga0068856_10000264312 312
456 3300005616 Ga0068852_100251564 Ga0068852_1002515642 312
457 3300005842 Ga0068858_100201892 Ga0068858_1002018922 312
458 3300009174 Ga0105241_10011639 Ga0105241_100116392 312
459 3300009176 Ga0105242_10117861 Ga0105242_101178612 312
460 3300010375 Ga0105239_10002738 Ga0105239_1000273814 312
461 3300025904 Ga0207647_10000273 Ga0207647_100002733 312
462 3300025911 Ga0207654_10001780 Ga0207654_1000178011 312
463 3300025911 Ga0207654_10030779 Ga0207654_100307792 312
464 3300025933 Ga0207706_10001455 Ga0207706_100014553 312
465 3300025934 Ga0207686_10078083 Ga0207686_100780832 312
466 3300025949 Ga0207667_10140483 Ga0207667_101404832 312
467 3300026023 Ga0207677_10357915 Ga0207677_103579151 312
468 3300026078 Ga0207702_10010087 Ga0207702_100100872 312
469 3300026078 Ga0207702_10524745 Ga0207702_105247452 312
470 3300026116 Ga0207674_10027464 Ga0207674_100274643 312
471 3300026116 Ga0207674_10045292 Ga0207674_100452922 312
472 3300031507 Ga0307509_10070483 Ga0307509_100704832 312
473 3300049579 Ga0501043_0010266 Ga0501043_0010266_3916_4872 312
474 3300003322 rootL2_10260817 rootL2_102608172 313
475 3300010375 Ga0105239_10382085 Ga0105239_103820852 313
476 3300026041 Ga0207639_10389926 Ga0207639_103899262 313
477 3300028379 Ga0268266_10496538 Ga0268266_104965381 313
478 3300031456 Ga0307513_10048179 Ga0307513_100481792 313
479 3300031456 Ga0307513_10227583 Ga0307513_102275832 313
480 3300035695 Ga0373927_0233261 Ga0373927_0233261_88_1053 313
481 3300041404 Ga0439436_0007386 Ga0439436_0007386_1656_2612 313
482 3300041406 Ga0439439_0009634 Ga0439439_0009634_1242_2198 313
483 3300042014 Ga0439457_002679 Ga0439457_002679_4008_4964 313
484 3300042015 Ga0439462_0001130 Ga0439462_0001130_2760_3716 313
485 3300044842 Ga0466957_0000689 Ga0466957_0000689_10642_11610 313
486 3300049705 Ga0501225_0004295 Ga0501225_0004295_1750_2706 313
487 3300053092 Ga0500583_0000671 Ga0500583_0000671_6030_7013 313
488 3300005331 Ga0070670_100156118 Ga0070670_1001561182 314
489 3300005335 Ga0070666_10061185 Ga0070666_100611852 314
490 3300005367 Ga0070667_100043490 Ga0070667_1000434903 314
491 3300005456 Ga0070678_100015076 Ga0070678_1000150764 314
492 3300005459 Ga0068867_100048127 Ga0068867_1000481273 314
493 3300005718 Ga0068866_10057375 Ga0068866_100573752 314
494 3300006237 Ga0097621_100008467 Ga0097621_1000084673 314
495 3300006358 Ga0068871_100001044 Ga0068871_10000104412 314
496 3300009093 Ga0105240_10297328 Ga0105240_102973281 314
497 3300009553 Ga0105249_10035127 Ga0105249_100351272 314
498 3300013296 Ga0157374_10015600 Ga0157374_100156002 314
499 3300013306 Ga0163162_10002245 Ga0163162_100022457 314
500 3300013306 Ga0163162_10356725 Ga0163162_103567252 314
501 3300014969 Ga0157376_10128517 Ga0157376_101285172 314
502 3300017792 Ga0163161_10002103 Ga0163161_100021032 314
503 3300025931 Ga0207644_10039689 Ga0207644_100396892 314
504 3300025941 Ga0207711_10033453 Ga0207711_100334532 314
505 3300025961 Ga0207712_10036831 Ga0207712_100368312 314
506 3300026089 Ga0207648_10140772 Ga0207648_101407722 314
507 3300026121 Ga0207683_10038703 Ga0207683_100387032 314
508 3300035113 Ga0373936_0025576 Ga0373936_0025576_669_1670 314
509 3300039437 Ga0436365_1678505 Ga0436365_1678505_18_986 314
510 3300044658 Ga0466972_0003081 Ga0466972_0003081_2607_3575 314
511 3300053080 Ga0500635_0013120 Ga0500635_0013120_405_1361 314
512 3300003316 rootH1_10068895 rootH1_100688952 315
513 3300005331 Ga0070670_100061776 Ga0070670_1000617763 315
514 3300005335 Ga0070666_10000050 Ga0070666_100000506 315
515 3300005338 Ga0068868_100012088 Ga0068868_1000120884 315
516 3300005355 Ga0070671_100103922 Ga0070671_1001039222 315
517 3300005355 Ga0070671_100133209 Ga0070671_1001332092 315
518 3300005364 Ga0070673_100316694 Ga0070673_1003166942 315
519 3300005367 Ga0070667_100020480 Ga0070667_1000204804 315
520 3300005458 Ga0070681_10474629 Ga0070681_104746291 315
521 3300005530 Ga0070679_100411309 Ga0070679_1004113091 315
522 3300005543 Ga0070672_100069018 Ga0070672_1000690182 315
523 3300005548 Ga0070665_100549220 Ga0070665_1005492202 315
524 3300005563 Ga0068855_100197862 Ga0068855_1001978622 315
525 3300005616 Ga0068852_100020291 Ga0068852_1000202915 315
526 3300005617 Ga0068859_100000025 Ga0068859_100000025170 315
527 3300005618 Ga0068864_100006903 Ga0068864_1000069037 315
528 3300005834 Ga0068851_10008554 Ga0068851_100085543 315
529 3300005834 Ga0068851_10022253 Ga0068851_100222532 315
530 3300005841 Ga0068863_100009689 Ga0068863_1000096895 315
531 3300005842 Ga0068858_100007839 Ga0068858_1000078398 315
532 3300005843 Ga0068860_100026713 Ga0068860_1000267132 315
533 3300006237 Ga0097621_100017205 Ga0097621_1000172055 315
534 3300006358 Ga0068871_100021989 Ga0068871_1000219892 315
535 3300006358 Ga0068871_100026108 Ga0068871_1000261083 315
536 3300006880 Ga0075429_100023162 Ga0075429_1000231625 315
537 3300006881 Ga0068865_100067228 Ga0068865_1000672282 315
538 3300006931 Ga0097620_100000025 Ga0097620_100000025170 315
539 3300009101 Ga0105247_10001380 Ga0105247_100013809 315
540 3300009174 Ga0105241_10000761 Ga0105241_1000076115 315
541 3300009553 Ga0105249_10025316 Ga0105249_100253162 315
542 3300010375 Ga0105239_10074274 Ga0105239_100742742 315
543 3300011119 Ga0105246_10145736 Ga0105246_101457362 315
544 3300013296 Ga0157374_10495623 Ga0157374_104956231 315
545 3300013297 Ga0157378_10003970 Ga0157378_1000397012 315
546 3300013297 Ga0157378_10044014 Ga0157378_100440142 315
547 3300013306 Ga0163162_10000549 Ga0163162_1000054924 315
548 3300013308 Ga0157375_10053968 Ga0157375_100539682 315
549 3300013308 Ga0157375_10153494 Ga0157375_101534941 315
550 3300013308 Ga0157375_10423754 Ga0157375_104237542 315
551 3300014325 Ga0163163_10109362 Ga0163163_101093622 315
552 3300014968 Ga0157379_10047097 Ga0157379_100470972 315
553 3300025321 Ga0207656_10005627 Ga0207656_100056274 315
554 3300025903 Ga0207680_10000032 Ga0207680_100000322 315
555 3300025911 Ga0207654_10001259 Ga0207654_100012592 315
556 3300025914 Ga0207671_10004604 Ga0207671_100046045 315
557 3300025914 Ga0207671_10152910 Ga0207671_101529102 315
558 3300025921 Ga0207652_10414652 Ga0207652_104146522 315
559 3300025925 Ga0207650_10047905 Ga0207650_100479053 315
560 3300025942 Ga0207689_10005117 Ga0207689_100051179 315
561 3300025960 Ga0207651_10188797 Ga0207651_101887972 315
562 3300025972 Ga0207668_10073121 Ga0207668_100731212 315
563 3300026023 Ga0207677_10025146 Ga0207677_100251462 315
564 3300026035 Ga0207703_10001555 Ga0207703_1000155511 315
565 3300026088 Ga0207641_10000822 Ga0207641_1000082220 315
566 3300026095 Ga0207676_10023203 Ga0207676_100232032 315
567 3300028381 Ga0268264_10020412 Ga0268264_100204122 315
568 3300028794 Ga0307515_10000162 Ga0307515_1000016218 315
569 3300031507 Ga0307509_10311500 Ga0307509_103115002 315
570 3300050508 nmdc:mga09592_76023_c1 nmdc:mga09592_76023_c1_1461_2441 315
571 3300050510 nmdc:mga06r32_24246_c1 nmdc:mga06r32_24246_c1_1205_2185 315
572 3300050511 nmdc:mga08y16_375919_c1 nmdc:mga08y16_375919_c1_203_1165 315
573 3300005327 Ga0070658_10000026 Ga0070658_1000002692 316
574 3300005563 Ga0068855_100054902 Ga0068855_1000549023 316
575 3300005843 Ga0068860_100503508 Ga0068860_1005035082 316
576 3300025909 Ga0207705_10000040 Ga0207705_1000004045 316
577 3300025949 Ga0207667_10042309 Ga0207667_100423093 316
578 3300028786 Ga0307517_10035483 Ga0307517_100354833 316
579 3300033180 Ga0307510_10003890 Ga0307510_1000389012 316
580 3300046518 Ga0495631_0005290 Ga0495631_0005290_5770_6732 316
581 3300002077 JGI24744J21845_10005090 JGI24744J21845_100050904 317
582 3300003320 rootH2_10001891 rootH2_1000189168 317
583 3300003323 rootH1_10037580 rootH1_100375803 317
584 3300003323 rootH1_10037581 rootH1_100375812 317
585 3300005338 Ga0068868_100019106 Ga0068868_1000191064 317
586 3300005364 Ga0070673_100002401 Ga0070673_1000024013 317
587 3300005456 Ga0070678_100051724 Ga0070678_1000517243 317
588 3300005459 Ga0068867_100057294 Ga0068867_1000572943 317
589 3300005539 Ga0068853_100002933 Ga0068853_1000029339 317
590 3300005539 Ga0068853_100167423 Ga0068853_1001674232 317
591 3300005543 Ga0070672_100223958 Ga0070672_1002239583 317
592 3300005548 Ga0070665_100000020 Ga0070665_10000002052 317
593 3300005563 Ga0068855_100042715 Ga0068855_1000427152 317
594 3300005563 Ga0068855_100045307 Ga0068855_1000453072 317
595 3300005614 Ga0068856_100299563 Ga0068856_1002995632 317
596 3300005616 Ga0068852_100007484 Ga0068852_1000074843 317
597 3300006237 Ga0097621_100016645 Ga0097621_1000166453 317
598 3300006358 Ga0068871_100014781 Ga0068871_1000147816 317
599 3300006881 Ga0068865_100022837 Ga0068865_1000228374 317
600 3300009093 Ga0105240_10068291 Ga0105240_100682912 317
601 3300009174 Ga0105241_10009803 Ga0105241_100098035 317
602 3300009174 Ga0105241_10011571 Ga0105241_100115715 317
603 3300009176 Ga0105242_10145611 Ga0105242_101456112 317
604 3300009545 Ga0105237_10006536 Ga0105237_100065363 317
605 3300009551 Ga0105238_10018529 Ga0105238_100185294 317
606 3300010375 Ga0105239_10033671 Ga0105239_100336715 317
607 3300013100 Ga0157373_10109353 Ga0157373_101093532 317
608 3300013296 Ga0157374_10002533 Ga0157374_100025333 317
609 3300013296 Ga0157374_10003205 Ga0157374_100032053 317
610 3300013306 Ga0163162_10000256 Ga0163162_1000025639 317
611 3300013307 Ga0157372_10108521 Ga0157372_101085212 317
612 3300014969 Ga0157376_10004720 Ga0157376_100047203 317
613 3300025907 Ga0207645_10001268 Ga0207645_100012683 317
614 3300025913 Ga0207695_10003090 Ga0207695_1000309018 317
615 3300025914 Ga0207671_10003653 Ga0207671_100036539 317
616 3300025914 Ga0207671_10022576 Ga0207671_100225763 317
617 3300025938 Ga0207704_10000865 Ga0207704_1000086510 317
618 3300025940 Ga0207691_10237129 Ga0207691_102371292 317
619 3300025949 Ga0207667_10028601 Ga0207667_100286012 317
620 3300025949 Ga0207667_10043865 Ga0207667_100438655 317
621 3300025949 Ga0207667_10283788 Ga0207667_102837882 317
622 3300025960 Ga0207651_10022982 Ga0207651_100229823 317
623 3300026023 Ga0207677_10034747 Ga0207677_100347474 317
624 3300026041 Ga0207639_10010504 Ga0207639_100105042 317
625 3300026041 Ga0207639_10017901 Ga0207639_100179012 317
626 3300026089 Ga0207648_10000287 Ga0207648_1000028733 317
627 3300026121 Ga0207683_10006941 Ga0207683_100069419 317
628 3300026142 Ga0207698_10021014 Ga0207698_100210145 317
629 3300026142 Ga0207698_10081928 Ga0207698_100819282 317
630 3300028379 Ga0268266_10000018 Ga0268266_10000018137 317
631 3300037312 Ga0395899_0024171 Ga0395899_0024171_1927_2907 317
632 3300037418 Ga0395900_0001762 Ga0395900_0001762_1784_2764 317
633 3300037466 Ga0395898_0088598 Ga0395898_0088598_96_1076 317
634 3300037471 Ga0395905_0001720 Ga0395905_0001720_1784_2764 317
635 3300038443 Ga0395901_0005902 Ga0395901_0005902_9633_10613 317
636 3300039447 Ga0436361_0684828 Ga0436361_0684828_10630_11595 317
637 3300053122 Ga0500608_007923 Ga0500608_007923_1074_2039 317
638 3300001979 JGI24740J21852_10014507 JGI24740J21852_100145072 321
639 3300005455 Ga0070663_100185506 Ga0070663_1001855062 321
640 3300013102 Ga0157371_10001423 Ga0157371_1000142310 321
641 3300013105 Ga0157369_10002827 Ga0157369_100028276 321
642 3300013307 Ga0157372_10000030 Ga0157372_1000003080 321
643 3300026067 Ga0207678_10228516 Ga0207678_102285162 321
644 3300037312 Ga0395899_0000201 Ga0395899_0000201_54734_55699 321

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rl8-assembly2.cif.gz_B crystal structure of the cog4313 outer membrane channel from pseudomonas putida f1 0.8319 31 301
4rl8-assembly2.cif.gz_B crystal structure of the cog4313 outer membrane channel from pseudomonas putida f1 0.8145 31 301
5o68-assembly2.cif.gz_F crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.8051 24 301
4fqe-assembly1.cif.gz_A kdgm porin 0.7912 43 301
5o68-assembly2.cif.gz_F crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.7903 24 301
ID Description Score Start End Superfamily
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.7912 43 301 2.40.160.40
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.7785 43 301 2.40.160.40
af_P76773_24_229_2.40.160.40 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6991 46 299 2.40.160.40
af_P76773_24_229_2.40.160.40 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.691 46 299 2.40.160.40
2wjrA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6499 45 299 2.40.160.40
ID Description Score Start End GO Terms
AF-A0A5C1HR75-F1-model_v4 deleted 0.9903 27 305
AF-A0A839SBP7-F1-model_v4 Transporter 0.9879 30 309
AF-A0A7W8KTG0-F1-model_v4 deleted 0.9867 34 309
AF-A0A0D3LJ64-F1-model_v4 Transporter 0.9818 30 305
AF-A0A4Q6AL37-F1-model_v4 Transporter 0.9814 48 305

Feature Viewer

pLDDT pTM Quality
83.58 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map