F471964

General Info

Members Datasets Scaffolds Average Seq Length
643 322 1286 109

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10515911|Ga0307413_105159112
Length 119
Sequence MPRREGGYRLRMPQQQWSKKRERQYEHIKEGLEDRGRDEDTAEEIAARTVNKERARHGEARQASRTSTQDISSSRRGGLRSHRGPGGRTKAQLYEEAKHKNVKGRSSMTKAELERAVGR

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
84 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
85 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
86 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
104 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
187 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
188 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
189 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
190 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
191 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
192 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
193 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
196 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
197 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
222 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
226 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
279 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
280 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
281 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
282 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
285 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
286 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
287 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
293 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
297 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
298 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
304 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
305 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
308 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
320 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
321 2643221576 Nocardioides sp. Root614 Isolate Unclassified
322 2643221590 Nocardioides sp. Root682 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.25
Metatranscriptomes 12.44
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 0
Rhizoplane 7
Rhizosphere 87.25
Stem 0
Stem Tuber 0
Unclassified 2.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10515911 3300031824 Bacteria 963
2 LJQas_1008771 3300000549 Bacteria 1225
3 Ga0070658_10004936 3300005327 Bacteria 10869
4 Ga0070658_10050241 3300005327 Bacteria 3379
5 Ga0070658_10052522 3300005327 Bacteria 3306
6 Ga0070658_10162390 3300005327 Bacteria 1874
7 Ga0070676_10169461 3300005328 Bacteria 1411
8 Ga0070683_100097497 3300005329 Bacteria 2765
9 Ga0070683_100160568 3300005329 Bacteria 2132
10 Ga0070683_100550830 3300005329 Bacteria 1103
11 Ga0070683_100740168 3300005329 Bacteria 942
12 Ga0070683_100901586 3300005329 Bacteria 848
13 Ga0068869_100157732 3300005334 Bacteria 1764
14 Ga0068869_100570496 3300005334 Bacteria 953
15 Ga0070680_100154635 3300005336 Bacteria 1926
16 Ga0070682_100089314 3300005337 Bacteria 2013
17 Ga0070682_100931883 3300005337 Bacteria 716
18 Ga0068868_100331130 3300005338 Bacteria 1300
19 Ga0070660_100037933 3300005339 Bacteria 3655
20 Ga0070660_101355771 3300005339 Bacteria 604
21 Ga0070689_100512192 3300005340 Bacteria 1029
22 Ga0070691_10095235 3300005341 Bacteria 1472
23 Ga0070661_100124012 3300005344 Bacteria 1937
24 Ga0070661_101094179 3300005344 Bacteria 664
25 Ga0070692_10611809 3300005345 Bacteria 722
26 Ga0070692_10953337 3300005345 Bacteria 597
27 Ga0070675_100124314 3300005354 Bacteria 2194
28 Ga0070674_100488671 3300005356 Bacteria 1023
29 Ga0070659_100037414 3300005366 Bacteria 3783
30 Ga0070667_100444137 3300005367 Bacteria 1185
31 Ga0070709_10296815 3300005434 Bacteria 1179
32 Ga0070714_100021544 3300005435 Bacteria 5274
33 Ga0070714_100270600 3300005435 Bacteria 1575
34 Ga0070714_100383323 3300005435 Bacteria 1326
35 Ga0070714_100465284 3300005435 Bacteria 1203
36 Ga0070713_101079240 3300005436 Bacteria 776
37 Ga0070701_10129123 3300005438 Bacteria 1434
38 Ga0070705_100671202 3300005440 Bacteria 810
39 Ga0070694_100382228 3300005444 Bacteria 1098
40 Ga0070694_101940099 3300005444 Bacteria 503
41 Ga0070663_100150447 3300005455 Bacteria 1784
42 Ga0070663_100398804 3300005455 Bacteria 1124
43 Ga0070663_101552641 3300005455 Bacteria 589
44 Ga0070678_100313802 3300005456 Bacteria 1337
45 Ga0070662_100157689 3300005457 Bacteria 1773
46 Ga0070662_100334300 3300005457 Bacteria 1238
47 Ga0070662_100793578 3300005457 Bacteria 805
48 Ga0070662_101229965 3300005457 Bacteria 644
49 Ga0070681_10022501 3300005458 Bacteria 6329
50 Ga0070681_10880687 3300005458 Bacteria 813
51 Ga0070681_11182161 3300005458 Bacteria 687
52 Ga0068867_100063712 3300005459 Bacteria 2740
53 Ga0068867_100413979 3300005459 Bacteria 1140
54 Ga0068867_100732109 3300005459 Bacteria 876
55 Ga0070706_100361447 3300005467 Bacteria 1353
56 Ga0070706_101082684 3300005467 Bacteria 738
57 Ga0070707_100498913 3300005468 Bacteria 1179
58 Ga0070698_100040383 3300005471 Bacteria 4795
59 Ga0070698_101302676 3300005471 Bacteria 677
60 Ga0070679_100101531 3300005530 Bacteria 2863
61 Ga0070679_100583354 3300005530 Bacteria 1061
62 Ga0070679_101123733 3300005530 Bacteria 731
63 Ga0070679_102067359 3300005530 Bacteria 519
64 Ga0070684_100237536 3300005535 Bacteria 1665
65 Ga0070697_100710881 3300005536 Bacteria 887
66 Ga0070697_100978389 3300005536 Bacteria 752
67 Ga0068853_100182590 3300005539 Bacteria 1903
68 Ga0068853_100400910 3300005539 Bacteria 1284
69 Ga0068853_100522744 3300005539 Bacteria 1122
70 Ga0070686_100071394 3300005544 Bacteria 2273
71 Ga0070686_100315387 3300005544 Bacteria 1164
72 Ga0070695_100006674 3300005545 Bacteria 6825
73 Ga0070695_101070877 3300005545 Bacteria 659
74 Ga0070696_100188579 3300005546 Bacteria 1534
75 Ga0070696_101241612 3300005546 Bacteria 631
76 Ga0070693_100018776 3300005547 Bacteria 3616
77 Ga0070665_100001640 3300005548 Bacteria 25777
78 Ga0070665_100125879 3300005548 Bacteria 2565
79 Ga0070665_101068030 3300005548 Bacteria 819
80 Ga0070704_100032636 3300005549 Bacteria 3514
81 Ga0070704_100332817 3300005549 Bacteria 1276
82 Ga0068855_100015844 3300005563 Bacteria 9068
83 Ga0068855_100024671 3300005563 Bacteria 7192
84 Ga0068855_100237534 3300005563 Bacteria 2038
85 Ga0068855_100260523 3300005563 Bacteria 1932
86 Ga0070664_100319278 3300005564 Bacteria 1407
87 Ga0068857_100008374 3300005577 Bacteria 8937
88 Ga0068857_100054017 3300005577 Bacteria 3564
89 Ga0068854_100020113 3300005578 Bacteria 4510
90 Ga0068854_100068533 3300005578 Bacteria 2587
91 Ga0068854_101130161 3300005578 Unclassified 699
92 Ga0068856_100029951 3300005614 Bacteria 5319
93 Ga0068856_100062910 3300005614 Bacteria 3665
94 Ga0068856_102615213 3300005614 Bacteria 511
95 Ga0070702_100099095 3300005615 Bacteria 1784
96 Ga0070702_100212620 3300005615 Bacteria 1288
97 Ga0070702_100217769 3300005615 Bacteria 1275
98 Ga0068852_100007714 3300005616 Bacteria 7872
99 Ga0068852_100605135 3300005616 Bacteria 1100
100 Ga0068852_100621377 3300005616 Bacteria 1086
101 Ga0068859_100002859 3300005617 Bacteria 17517
102 Ga0068859_100086069 3300005617 Bacteria 3189
103 Ga0068858_100795561 3300005842 Bacteria 922
104 Ga0068860_101893963 3300005843 Bacteria 618
105 Ga0068862_100806184 3300005844 Bacteria 917
106 Ga0070717_10000010 3300006028 Bacteria 283501
107 Ga0070717_10044645 3300006028 Bacteria 3621
108 Ga0070717_10503010 3300006028 Bacteria 1095
109 Ga0075364_10264659 3300006051 Bacteria 1169
110 Ga0075364_10670418 3300006051 Bacteria 708
111 Ga0075364_10955430 3300006051 Bacteria 583
112 Ga0070712_100931354 3300006175 Bacteria 750
113 Ga0075362_10018487 3300006177 Bacteria 2884
114 Ga0075362_10218900 3300006177 Bacteria 930
115 Ga0075367_10038909 3300006178 Bacteria 2771
116 Ga0075366_10218147 3300006195 Bacteria 1162
117 Ga0075366_10503694 3300006195 Bacteria 749
118 Ga0097621_101914951 3300006237 Bacteria 566
119 Ga0075370_10000751 3300006353 Bacteria 12970
120 Ga0075428_101657475 3300006844 Bacteria 668
121 Ga0075430_100127222 3300006846 Bacteria 2124
122 Ga0075431_100504364 3300006847 Bacteria 1201
123 Ga0075431_100594959 3300006847 Bacteria 1090
124 Ga0075433_11086565 3300006852 Bacteria 696
125 Ga0075434_100434736 3300006871 Bacteria 1333
126 Ga0075436_100039244 3300006914 Bacteria 3268
127 Ga0097620_100002859 3300006931 Bacteria 17517
128 Ga0097620_100086071 3300006931 Bacteria 3189
129 Ga0075435_100689614 3300007076 Bacteria 887
130 Ga0105240_10031383 3300009093 Bacteria 6891
131 Ga0105240_10048878 3300009093 Bacteria 5344
132 Ga0105240_10243500 3300009093 Bacteria 2083
133 Ga0105240_10609778 3300009093 Bacteria 1201
134 Ga0105240_11031983 3300009093 Bacteria 878
135 Ga0105240_11148464 3300009093 Bacteria 825
136 Ga0111539_10045281 3300009094 Bacteria 5267
137 Ga0105245_10001047 3300009098 Bacteria 25048
138 Ga0105245_10406790 3300009098 Bacteria 1361
139 Ga0105245_10514745 3300009098 Bacteria 1214
140 Ga0105245_11526724 3300009098 Bacteria 719
141 Ga0105247_10009758 3300009101 Bacteria 5821
142 Ga0114129_11392270 3300009147 Bacteria 866
143 Ga0114129_12013424 3300009147 Bacteria 698
144 Ga0105243_10196904 3300009148 Bacteria 1764
145 Ga0105243_10249666 3300009148 Bacteria 1583
146 Ga0105243_10422516 3300009148 Bacteria 1244
147 Ga0105243_11024942 3300009148 Bacteria 829
148 Ga0105241_10003448 3300009174 Bacteria 11768
149 Ga0105241_10073234 3300009174 Bacteria 2664
150 Ga0105241_10238703 3300009174 Bacteria 1535
151 Ga0105241_11570240 3300009174 Unclassified 635
152 Ga0105241_12297428 3300009174 Bacteria 537
153 Ga0105242_10008633 3300009176 Bacteria 7822
154 Ga0105242_10257231 3300009176 Bacteria 1576
155 Ga0105242_10936336 3300009176 Bacteria 869
156 Ga0105242_11175518 3300009176 Bacteria 785
157 Ga0105237_10006358 3300009545 Bacteria 13124
158 Ga0105237_10038771 3300009545 Bacteria 4811
159 Ga0105237_10108718 3300009545 Bacteria 2764
160 Ga0105237_10247519 3300009545 Bacteria 1784
161 Ga0105237_10326104 3300009545 Bacteria 1539
162 Ga0105237_11161481 3300009545 Bacteria 779
163 Ga0105238_10031695 3300009551 Bacteria 5380
164 Ga0105238_10056808 3300009551 Bacteria 3926
165 Ga0105238_11501311 3300009551 Viruses 703
166 Ga0105238_11851420 3300009551 Bacteria 636
167 Ga0105249_10266020 3300009553 Bacteria 1706
168 Ga0105249_11571753 3300009553 Bacteria 730
169 Ga0105239_10009426 3300010375 Bacteria 11005
170 Ga0105239_10064486 3300010375 Bacteria 4021
171 Ga0105239_10291138 3300010375 Bacteria 1839
172 Ga0105239_10556101 3300010375 Bacteria 1307
173 Ga0105246_10013416 3300011119 Bacteria 5137
174 Ga0105246_10321995 3300011119 Bacteria 1257
175 Ga0157322_1017984 3300012490 Bacteria 654
176 Ga0157341_1015857 3300012494 Bacteria 697
177 Ga0157324_1010714 3300012506 Bacteria 782
178 Ga0154016_114911 3300013045 Bacteria 685
179 Ga0157373_10142063 3300013100 Bacteria 1688
180 Ga0157373_10151307 3300013100 Bacteria 1632
181 Ga0157371_10265202 3300013102 Bacteria 1239
182 Ga0157371_10299670 3300013102 Bacteria 1164
183 Ga0157371_11118619 3300013102 Bacteria 605
184 Ga0157370_10100153 3300013104 Bacteria 2715
185 Ga0157370_10238384 3300013104 Bacteria 1683
186 Ga0157370_11835462 3300013104 Bacteria 544
187 Ga0157369_10000558 3300013105 Bacteria 48978
188 Ga0157369_10020789 3300013105 Bacteria 7336
189 Ga0157369_10206818 3300013105 Bacteria 2058
190 Ga0157369_10676725 3300013105 Bacteria 1063
191 Ga0157369_11965305 3300013105 Unclassified 593
192 Ga0157374_10050676 3300013296 Bacteria 3860
193 Ga0157374_10504650 3300013296 Bacteria 1214
194 Ga0157374_10955424 3300013296 Bacteria 876
195 Ga0157378_11010582 3300013297 Bacteria 866
196 Ga0157372_10326526 3300013307 Bacteria 1786
197 Ga0157372_10590498 3300013307 Bacteria 1295
198 Ga0157372_10686146 3300013307 Bacteria 1192
199 Ga0157372_10784751 3300013307 Bacteria 1107
200 Ga0157372_11670364 3300013307 Bacteria 733
201 Ga0157375_10060660 3300013308 Bacteria 3752
202 Ga0163163_11123217 3300014325 Bacteria 849
203 Ga0157380_10072468 3300014326 Bacteria 2790
204 Ga0157380_11842811 3300014326 Bacteria 665
205 Ga0157377_11212374 3300014745 Bacteria 585
206 Ga0157379_10427004 3300014968 Bacteria 1221
207 Ga0157376_10384268 3300014969 Bacteria 1353
208 Ga0197907_10073727 3300020069 Bacteria 1306
209 Ga0197907_10131703 3300020069 Bacteria 1591
210 Ga0197907_10136630 3300020069 Bacteria 1223
211 Ga0197907_10374786 3300020069 Bacteria 677
212 Ga0197907_10770193 3300020069 Bacteria 647
213 Ga0197907_10901808 3300020069 Bacteria 1291
214 Ga0197907_11302759 3300020069 Bacteria 519
215 Ga0197907_11392812 3300020069 Bacteria 697
216 Ga0206356_10133533 3300020070 Bacteria 1595
217 Ga0206356_10429381 3300020070 Bacteria 2197
218 Ga0206356_10579576 3300020070 Bacteria 1033
219 Ga0206356_10667707 3300020070 Bacteria 642
220 Ga0206356_10725694 3300020070 Bacteria 682
221 Ga0206356_11113678 3300020070 Bacteria 716
222 Ga0206356_11266540 3300020070 Bacteria 553
223 Ga0206356_11290798 3300020070 Bacteria 868
224 Ga0206356_11329628 3300020070 Bacteria 1430
225 Ga0206356_11770868 3300020070 Bacteria 690
226 Ga0206356_11902497 3300020070 Bacteria 1270
227 Ga0206349_1516129 3300020075 Bacteria 803
228 Ga0206349_1653571 3300020075 Unclassified 971
229 Ga0206349_1658494 3300020075 Bacteria 708
230 Ga0206349_1926064 3300020075 Bacteria 733
231 Ga0206355_1021328 3300020076 Unclassified 554
232 Ga0206355_1315587 3300020076 Bacteria 549
233 Ga0206351_10350394 3300020077 Bacteria 1150
234 Ga0206351_10386798 3300020077 Bacteria 743
235 Ga0206351_10572006 3300020077 Bacteria 767
236 Ga0206351_10602002 3300020077 Bacteria 1780
237 Ga0206351_10723018 3300020077 Bacteria 1522
238 Ga0206351_10802626 3300020077 Bacteria 869
239 Ga0206351_10877758 3300020077 Bacteria 932
240 Ga0206351_10975176 3300020077 Bacteria 890
241 Ga0206352_10545586 3300020078 Bacteria 1124
242 Ga0206352_10664819 3300020078 Bacteria 540
243 Ga0206352_11134172 3300020078 Bacteria 808
244 Ga0206352_11184610 3300020078 Bacteria 1269
245 Ga0206350_10008600 3300020080 Bacteria 1254
246 Ga0206350_10106865 3300020080 Bacteria 926
247 Ga0206350_10287112 3300020080 Bacteria 1380
248 Ga0206350_10329360 3300020080 Bacteria 618
249 Ga0206350_10382195 3300020080 Bacteria 1628
250 Ga0206350_10436039 3300020080 Bacteria 1257
251 Ga0206350_10668316 3300020080 Bacteria 2214
252 Ga0206350_11047726 3300020080 Bacteria 674
253 Ga0206350_11166521 3300020080 Bacteria 805
254 Ga0206350_11264632 3300020080 Bacteria 752
255 Ga0206350_11325029 3300020080 Bacteria 1044
256 Ga0206350_11611949 3300020080 Bacteria 1173
257 Ga0206354_10157966 3300020081 Bacteria 1238
258 Ga0206354_11124229 3300020081 Bacteria 2204
259 Ga0206354_11676962 3300020081 Bacteria 646
260 Ga0206353_10176860 3300020082 Bacteria 892
261 Ga0206353_10358230 3300020082 Bacteria 990
262 Ga0206353_10453957 3300020082 Bacteria 835
263 Ga0154015_1381234 3300020610 Bacteria 1420
264 Ga0154015_1549133 3300020610 Bacteria 775
265 Ga0213876_10578691 3300021384 Bacteria 597
266 Ga0224712_10001173 3300022467 Bacteria 5862
267 Ga0224712_10015294 3300022467 Bacteria 2493
268 Ga0224712_10039498 3300022467 Bacteria 1770
269 Ga0224712_10051777 3300022467 Bacteria 1600
270 Ga0224712_10054370 3300022467 Bacteria 1571
271 Ga0224712_10071107 3300022467 Bacteria 1413
272 Ga0224712_10132375 3300022467 Bacteria 1090
273 Ga0224712_10172177 3300022467 Bacteria 971
274 Ga0224712_10271630 3300022467 Unclassified 787
275 Ga0224712_10333524 3300022467 Bacteria 714
276 Ga0224712_10496693 3300022467 Bacteria 589
277 Ga0224712_10660045 3300022467 Bacteria 513
278 Ga0224712_10671645 3300022467 Unclassified 509
279 Ga0224712_10683285 3300022467 Bacteria 504
280 Ga0207710_10021577 3300025900 Bacteria 2761
281 Ga0207647_10008777 3300025904 Bacteria 7216
282 Ga0207647_10034570 3300025904 Bacteria 3225
283 Ga0207699_11432218 3300025906 Bacteria 511
284 Ga0207645_10389608 3300025907 Bacteria 936
285 Ga0207705_10006912 3300025909 Bacteria 8381
286 Ga0207705_10090177 3300025909 Bacteria 2244
287 Ga0207705_10372238 3300025909 Bacteria 1103
288 Ga0207684_10248006 3300025910 Bacteria 1536
289 Ga0207654_10029721 3300025911 Bacteria 2995
290 Ga0207654_10213621 3300025911 Bacteria 1276
291 Ga0207707_10048850 3300025912 Bacteria 3686
292 Ga0207707_10289220 3300025912 Bacteria 1418
293 Ga0207707_10440307 3300025912 Bacteria 1116
294 Ga0207707_10695939 3300025912 Bacteria 854
295 Ga0207695_10058849 3300025913 Bacteria 3988
296 Ga0207695_10203262 3300025913 Bacteria 1894
297 Ga0207695_10209301 3300025913 Bacteria 1862
298 Ga0207695_11271887 3300025913 Bacteria 616
299 Ga0207671_10000421 3300025914 Bacteria 58859
300 Ga0207671_10006610 3300025914 Bacteria 10285
301 Ga0207671_10157802 3300025914 Bacteria 1756
302 Ga0207671_10250895 3300025914 Bacteria 1391
303 Ga0207671_10669903 3300025914 Bacteria 826
304 Ga0207660_10015995 3300025917 Bacteria 4959
305 Ga0207662_10352988 3300025918 Bacteria 988
306 Ga0207657_10013218 3300025919 Bacteria 8103
307 Ga0207657_10378001 3300025919 Bacteria 1116
308 Ga0207649_10077753 3300025920 Bacteria 2139
309 Ga0207649_10645386 3300025920 Bacteria 817
310 Ga0207649_11086916 3300025920 Bacteria 631
311 Ga0207652_10088089 3300025921 Bacteria 2723
312 Ga0207652_10480845 3300025921 Bacteria 1119
313 Ga0207652_11529778 3300025921 Bacteria 571
314 Ga0207646_10505528 3300025922 Bacteria 1089
315 Ga0207646_10956781 3300025922 Bacteria 758
316 Ga0207681_10097971 3300025923 Bacteria 2109
317 Ga0207694_10004812 3300025924 Bacteria 10483
318 Ga0207694_10340011 3300025924 Bacteria 1241
319 Ga0207687_10059913 3300025927 Bacteria 2683
320 Ga0207664_10093475 3300025929 Bacteria 2470
321 Ga0207664_10949717 3300025929 Bacteria 771
322 Ga0207664_11220772 3300025929 Bacteria 670
323 Ga0207690_10037848 3300025932 Bacteria 3135
324 Ga0207706_10005983 3300025933 Bacteria 11312
325 Ga0207706_10805975 3300025933 Bacteria 797
326 Ga0207686_10010612 3300025934 Bacteria 5020
327 Ga0207686_10151443 3300025934 Bacteria 1615
328 Ga0207686_11328888 3300025934 Bacteria 591
329 Ga0207709_10127026 3300025935 Bacteria 1731
330 Ga0207709_10129739 3300025935 Bacteria 1716
331 Ga0207709_10292218 3300025935 Bacteria 1208
332 Ga0207691_10017877 3300025940 Bacteria 6719
333 Ga0207689_10107159 3300025942 Bacteria 2297
334 Ga0207661_10629263 3300025944 Bacteria 986
335 Ga0207661_12056145 3300025944 Bacteria 517
336 Ga0207679_11072877 3300025945 Bacteria 739
337 Ga0207667_10015432 3300025949 Bacteria 8677
338 Ga0207667_10129485 3300025949 Bacteria 2599
339 Ga0207667_10270731 3300025949 Bacteria 1736
340 Ga0207667_10437875 3300025949 Bacteria 1329
341 Ga0207668_10731275 3300025972 Bacteria 872
342 Ga0207640_10046152 3300025981 Bacteria 2801
343 Ga0207640_10340305 3300025981 Bacteria 1201
344 Ga0207658_10108017 3300025986 Bacteria 2194
345 Ga0207658_11035970 3300025986 Bacteria 749
346 Ga0207677_10497373 3300026023 Bacteria 1053
347 Ga0207677_11280280 3300026023 Bacteria 673
348 Ga0207639_10435533 3300026041 Bacteria 1188
349 Ga0207639_10687336 3300026041 Bacteria 949
350 Ga0207639_10781459 3300026041 Bacteria 889
351 Ga0207639_10967542 3300026041 Bacteria 797
352 Ga0207639_11040024 3300026041 Bacteria 767
353 Ga0207678_10028708 3300026067 Bacteria 4856
354 Ga0207678_10383956 3300026067 Bacteria 1214
355 Ga0207678_10778237 3300026067 Bacteria 844
356 Ga0207678_11526577 3300026067 Bacteria 589
357 Ga0207702_10035061 3300026078 Bacteria 4196
358 Ga0207702_10169633 3300026078 Bacteria 2000
359 Ga0207702_10394052 3300026078 Bacteria 1334
360 Ga0207648_10185781 3300026089 Bacteria 1841
361 Ga0207648_10472896 3300026089 Bacteria 1144
362 Ga0207676_10338567 3300026095 Bacteria 1387
363 Ga0207674_10045093 3300026116 Bacteria 4538
364 Ga0207674_11350808 3300026116 Bacteria 682
365 Ga0207675_100068423 3300026118 Bacteria 3318
366 Ga0207675_101062000 3300026118 Bacteria 829
367 Ga0207675_102176943 3300026118 Bacteria 570
368 Ga0207683_10355032 3300026121 Bacteria 1346
369 Ga0207698_10188588 3300026142 Bacteria 1834
370 Ga0207698_10445413 3300026142 Bacteria 1249
371 Ga0207698_10850770 3300026142 Bacteria 917
372 Ga0207698_11175366 3300026142 Bacteria 781
373 Ga0209813_10347680 3300027866 Unclassified 586
374 Ga0268266_10106682 3300028379 Bacteria 2476
375 Ga0268266_10185568 3300028379 Bacteria 1896
376 Ga0268265_11739012 3300028380 Bacteria 630
377 Ga0307517_10214019 3300028786 Bacteria 1182
378 Ga0265339_10151332 3300031249 Bacteria 1173
379 Ga0265327_10004236 3300031251 Bacteria 12863
380 Ga0265316_10184219 3300031344 Bacteria 1553
381 Ga0307513_10180753 3300031456 Bacteria 1973
382 Ga0307408_101200665 3300031548 Bacteria 707
383 Ga0307508_10208659 3300031616 Bacteria 1554
384 Ga0307516_10140445 3300031730 Bacteria 2186
385 Ga0307412_12016632 3300031911 Bacteria 534
386 Ga0307409_100162783 3300031995 Bacteria 1954
387 Ga0307409_101210962 3300031995 Bacteria 779
388 Ga0307416_100791029 3300032002 Bacteria 1044
389 Ga0307416_102067524 3300032002 Bacteria 672
390 Ga0307416_103314403 3300032002 Bacteria 539
391 Ga0373949_0077059 3300035090 Bacteria 883
392 Ga0373952_0022903 3300035092 Bacteria 1331
393 Ga0373960_0135659 3300035121 Bacteria 829
394 Ga0373943_0705751 3300035170 Bacteria 598
395 Ga0373946_0546413 3300035171 Bacteria 597
396 Ga0373955_0215417 3300035172 Bacteria 1146
397 Ga0373942_0046297 3300035207 Bacteria 1205
398 Ga0373947_0505879 3300035725 Bacteria 821
399 Ga0373937_0043188 3300036401 Bacteria 4114
400 Ga0373937_1131694 3300036401 Bacteria 731
401 Ga0373937_1466330 3300036401 Bacteria 630
402 Ga0373925_0216272 3300037068 Bacteria 1528
403 Ga0373925_0229499 3300037068 Bacteria 1484
404 Ga0395900_0228700 3300037418 Bacteria 1871
405 Ga0395898_0862664 3300037466 Bacteria 844
406 Ga0395898_1225314 3300037466 Bacteria 681
407 Ga0395905_0229878 3300037471 Bacteria 1734
408 Ga0395901_1484006 3300038443 Bacteria 634
409 Ga0436365_0331179 3300039437 Bacteria 887
410 Ga0436360_0354387 3300039438 Bacteria 2420
411 Ga0436361_0968864 3300039447 Bacteria 603
412 Ga0436362_0376699 3300039453 Bacteria 2712
413 Ga0439438_035401 3300041405 Bacteria 1312
414 Ga0451789_0100037 3300041443 Bacteria 507
415 Ga0451791_0290458 3300041451 Bacteria 747
416 Ga0451793_0601438 3300041452 Bacteria 555
417 Ga0451798_0979328 3300041458 Bacteria 1143
418 Ga0451833_0296526 3300041491 Bacteria 562
419 Ga0451837_0052104 3300041494 Bacteria 710
420 Ga0451841_0342067 3300041498 Bacteria 644
421 Ga0451853_1518694 3300041512 Bacteria 551
422 Ga0450898_086294 3300042134 Bacteria 643
423 Ga0439446_0006661 3300042156 Bacteria 3021
424 Ga0439434_0044765 3300042435 Bacteria 1364
425 Ga0466966_0282392 3300044684 Bacteria 998
426 Ga0466963_0679369 3300044694 Bacteria 727
427 Ga0453684_1385916 3300044712 Bacteria 730
428 Ga0466970_0959422 3300044765 Bacteria 504
429 Ga0466957_0183020 3300044842 Bacteria 1369
430 Ga0466960_0066119 3300044901 Bacteria 1787
431 Ga0466959_0041001 3300045049 Bacteria 3419
432 Ga0451576_0103779 3300045051 Bacteria 2957
433 Ga0466967_0427347 3300045976 Bacteria 1292
434 Ga0466967_1762344 3300045976 Bacteria 616
435 Ga0495592_0364096 3300046454 Bacteria 924
436 Ga0495603_0036301 3300046455 Bacteria 2959
437 Ga0495603_0229280 3300046455 Bacteria 1071
438 Ga0495629_0290907 3300046459 Bacteria 1120
439 Ga0495629_1086536 3300046459 Bacteria 518
440 Ga0495641_0078586 3300046461 Bacteria 1479
441 Ga0495653_0048298 3300046463 Bacteria 3286
442 Ga0495653_0262112 3300046463 Bacteria 1142
443 Ga0495639_0258474 3300046475 Bacteria 862
444 Ga0495662_0395564 3300046476 Bacteria 679
445 Ga0495584_0172526 3300046491 Bacteria 1099
446 Ga0495584_0505422 3300046491 Bacteria 616
447 Ga0495585_0198850 3300046492 Bacteria 1022
448 Ga0495594_0420241 3300046499 Bacteria 760
449 Ga0495583_0206182 3300046506 Bacteria 798
450 Ga0495608_0136514 3300046511 Bacteria 1567
451 Ga0495618_0425921 3300046514 Bacteria 809
452 Ga0495630_0281531 3300046517 Bacteria 1270
453 Ga0495630_0440109 3300046517 Bacteria 999
454 Ga0495630_0546876 3300046517 Bacteria 888
455 Ga0495643_0218168 3300046522 Bacteria 906
456 Ga0495644_0050527 3300046523 Bacteria 1561
457 Ga0495652_0138262 3300046529 Bacteria 1919
458 Ga0495586_0343140 3300046535 Bacteria 857
459 Ga0495609_0354849 3300046538 Bacteria 591
460 Ga0495621_0298957 3300046539 Bacteria 667
461 Ga0495667_0108889 3300046559 Bacteria 1790
462 Ga0495667_0123535 3300046559 Bacteria 1671
463 Ga0495656_0018932 3300046615 Bacteria 2651
464 Ga0495656_0222603 3300046615 Bacteria 944
465 Ga0495656_0385663 3300046615 Bacteria 731
466 Ga0495668_0137531 3300046616 Bacteria 1337
467 Ga0495634_0171542 3300046642 Bacteria 1363
468 Ga0495635_0056961 3300046663 Bacteria 2690
469 Ga0495635_0165262 3300046663 Bacteria 1506
470 Ga0495588_0213810 3300046674 Bacteria 1018
471 Ga0495657_0099477 3300046675 Bacteria 1855
472 Ga0495647_0235456 3300046681 Bacteria 812
473 Ga0495624_0355458 3300046690 Bacteria 881
474 Ga0495670_0140894 3300046691 Bacteria 1261
475 Ga0495671_0228129 3300046692 Bacteria 901
476 Ga0495671_0501355 3300046692 Bacteria 579
477 Ga0495581_0266852 3300047315 Bacteria 1001
478 Ga0495676_0548595 3300047321 Bacteria 756
479 Ga0495680_0683312 3300047322 Bacteria 679
480 Ga0495673_0124004 3300047469 Bacteria 1021
481 Ga0495684_0493553 3300047471 Bacteria 843
482 Ga0495684_0530179 3300047471 Bacteria 805
483 Ga0495686_0000655 3300047472 Bacteria 47295
484 Ga0496100_0084406 3300048903 Bacteria 2153
485 Ga0496100_0103707 3300048903 Bacteria 1964
486 Ga0496100_0621257 3300048903 Bacteria 840
487 Ga0496100_1197544 3300048903 Bacteria 599
488 Ga0496101_0054622 3300048904 Bacteria 2884
489 Ga0496101_0264051 3300048904 Bacteria 1343
490 Ga0496101_0693817 3300048904 Bacteria 804
491 Ga0496102_0000212 3300048905 Bacteria 77755
492 Ga0496102_0037710 3300048905 Bacteria 4361
493 Ga0496102_0365261 3300048905 Bacteria 1359
494 Ga0496103_0000147 3300048906 Bacteria 73208
495 Ga0496103_0374923 3300048906 Bacteria 914
496 Ga0496104_0119244 3300048907 Bacteria 2533
497 Ga0496104_0245281 3300048907 Bacteria 1704
498 Ga0496104_0280264 3300048907 Bacteria 1580
499 Ga0496104_0440185 3300048907 Bacteria 1215
500 Ga0496104_1743955 3300048907 Bacteria 525
501 Ga0496105_0487391 3300048908 Bacteria 969
502 Ga0496106_0483060 3300048909 Bacteria 995
503 Ga0496106_0575496 3300048909 Bacteria 903
504 Ga0496107_0733875 3300048910 Bacteria 725
505 Ga0496107_0776927 3300048910 Bacteria 702
506 Ga0496108_0006645 3300048911 Bacteria 9367
507 Ga0496108_0030246 3300048911 Bacteria 4488
508 Ga0496109_0046211 3300048912 Bacteria 3954
509 Ga0496109_0081876 3300048912 Bacteria 2974
510 Ga0496110_0630236 3300048913 Bacteria 971
511 Ga0496110_0836535 3300048913 Bacteria 825
512 Ga0496111_0123737 3300048914 Bacteria 1911
513 Ga0496112_0007079 3300048915 Bacteria 9912
514 Ga0496112_0460140 3300048915 Bacteria 1210
515 Ga0496112_0518760 3300048915 Bacteria 1126
516 Ga0496112_0706794 3300048915 Bacteria 936
517 Ga0496113_0214810 3300048916 Bacteria 1532
518 Ga0496113_0702002 3300048916 Bacteria 807
519 Ga0496113_0882362 3300048916 Bacteria 708
520 Ga0496113_0920726 3300048916 Bacteria 691
521 Ga0496113_1544105 3300048916 Bacteria 512
522 Ga0496114_0005157 3300048917 Bacteria 10194
523 Ga0496114_0866345 3300048917 Bacteria 784
524 Ga0496115_0610432 3300048918 Bacteria 866
525 Ga0496117_0107311 3300048920 Bacteria 1749
526 Ga0496119_0028694 3300048922 Bacteria 3791
527 Ga0496121_0037898 3300048924 Bacteria 4277
528 Ga0501031_0045513 3300049568 Bacteria 2863
529 Ga0501031_0073191 3300049568 Bacteria 2231
530 Ga0501031_0133432 3300049568 Bacteria 1622
531 Ga0501031_0583851 3300049568 Bacteria 719
532 Ga0501032_0104174 3300049569 Bacteria 1880
533 Ga0501032_0165331 3300049569 Bacteria 1452
534 Ga0501033_0512498 3300049570 Bacteria 829
535 Ga0501034_0025944 3300049571 Bacteria 5969
536 Ga0501036_0055542 3300049572 Bacteria 3355
537 Ga0501036_1246097 3300049572 Bacteria 605
538 Ga0501036_1273742 3300049572 Bacteria 598
539 Ga0501037_0152201 3300049573 Bacteria 1653
540 Ga0501037_0336011 3300049573 Bacteria 1044
541 Ga0501038_0806230 3300049574 Bacteria 697
542 Ga0501038_0909177 3300049574 Bacteria 649
543 Ga0501039_0067118 3300049575 Bacteria 2786
544 Ga0501039_0139338 3300049575 Bacteria 1905
545 Ga0501039_0260368 3300049575 Bacteria 1363
546 Ga0501039_0377963 3300049575 Bacteria 1113
547 Ga0501040_0265219 3300049576 Bacteria 1226
548 Ga0501040_0365876 3300049576 Bacteria 1034
549 Ga0501040_0500659 3300049576 Bacteria 876
550 Ga0501040_0702248 3300049576 Bacteria 731
551 Ga0501040_0790377 3300049576 Bacteria 687
552 Ga0501041_0035171 3300049577 Bacteria 3035
553 Ga0501041_0042445 3300049577 Bacteria 2764
554 Ga0501041_0319675 3300049577 Bacteria 979
555 Ga0501041_0341717 3300049577 Bacteria 945
556 Ga0501041_0475814 3300049577 Bacteria 794
557 Ga0501041_0516107 3300049577 Bacteria 761
558 Ga0501042_0210319 3300049578 Bacteria 1403
559 Ga0501042_0502007 3300049578 Bacteria 881
560 Ga0501042_0537160 3300049578 Bacteria 850
561 Ga0501043_0318020 3300049579 Bacteria 1187
562 Ga0501046_0528706 3300049580 Bacteria 842
563 Ga0501046_0672576 3300049580 Bacteria 731
564 Ga0501047_0100354 3300049581 Bacteria 2774
565 Ga0501048_0017362 3300049582 Bacteria 5303
566 Ga0501048_0223780 3300049582 Bacteria 1335
567 Ga0501048_0745797 3300049582 Bacteria 703
568 Ga0501067_0013960 3300049583 Bacteria 4450
569 Ga0501067_0744225 3300049583 Bacteria 552
570 Ga0501068_0054594 3300049584 Bacteria 2420
571 Ga0501069_0121673 3300049585 Bacteria 1491
572 Ga0501069_0465367 3300049585 Bacteria 752
573 Ga0501070_0015455 3300049586 Bacteria 6422
574 Ga0501070_0102026 3300049586 Bacteria 2373
575 Ga0501070_1304953 3300049586 Bacteria 554
576 Ga0501071_0051146 3300049587 Bacteria 2977
577 Ga0501071_0209850 3300049587 Bacteria 1464
578 Ga0501071_0614730 3300049587 Bacteria 836
579 Ga0501071_0957711 3300049587 Bacteria 661
580 Ga0501072_0205421 3300049588 Bacteria 1570
581 Ga0501072_0590694 3300049588 Bacteria 876
582 Ga0501075_0087688 3300049591 Bacteria 2359
583 Ga0501075_0513063 3300049591 Bacteria 915
584 Ga0501075_0778266 3300049591 Bacteria 728
585 Ga0501076_0067609 3300049592 Bacteria 2853
586 Ga0501076_0088793 3300049592 Bacteria 2485
587 Ga0501077_0097824 3300049593 Bacteria 1860
588 Ga0501079_0168115 3300049741 Bacteria 1710
589 Ga0501079_1166153 3300049741 Bacteria 607
590 Ga0501079_1261197 3300049741 Bacteria 582
591 Ga0501080_0114110 3300049742 Bacteria 2505
592 Ga0501080_0682665 3300049742 Bacteria 907
593 Ga0501080_0890369 3300049742 Bacteria 776
594 Ga0501081_0233239 3300049743 Bacteria 1341
595 Ga0501081_0340671 3300049743 Bacteria 1104
596 Ga0501081_1097561 3300049743 Bacteria 602
597 Ga0501081_1455828 3300049743 Bacteria 520
598 Ga0501035_0348725 3300049822 Bacteria 1239
599 Ga0501045_0020288 3300049824 Bacteria 4747
600 Ga0501045_0294758 3300049824 Bacteria 1207
601 nmdc:mga03683_182255_c1 3300050489 Bacteria 958
602 nmdc:mga03683_44913_c1 3300050489 Bacteria 1827
603 nmdc:mga00v17_787885_c1 3300050491 Bacteria 606
604 nmdc:mga0yw44_1212327_c1 3300050492 Bacteria 509
605 nmdc:mga0yw44_473934_c1 3300050492 Bacteria 849
606 nmdc:mga0k408_680486_c1 3300050493 Bacteria 604
607 nmdc:mga07m45_2934_c1 3300050496 Bacteria 8096
608 nmdc:mga07m45_29615_c1 3300050496 Bacteria 3029
609 nmdc:mga09592_866329_c1 3300050508 Bacteria 761
610 nmdc:mga0qj67_170306_c1 3300050509 Bacteria 1768
611 nmdc:mga06r32_396126_c1 3300050510 Bacteria 1363
612 nmdc:mga08y16_781933_c1 3300050511 Bacteria 949
613 nmdc:mga0n895_115696_c1 3300050512 Bacteria 2700
614 nmdc:mga0n895_297969_c1 3300050512 Bacteria 1635
615 nmdc:mga0rr50_75878_c1 3300050513 Bacteria 2579
616 nmdc:mga08x19_242111_c1 3300050514 Bacteria 1244
617 nmdc:mga08x19_246852_c1 3300050514 Unclassified 1232
618 nmdc:mga0a205_1066324_c1 3300050515 Bacteria 655
619 nmdc:mga0a205_497080_c1 3300050515 Bacteria 1077
620 Ga0495595_0285507 3300053084 Bacteria 829
621 Ga0495619_0034827 3300053085 Bacteria 3274
622 Ga0495619_0119386 3300053085 Bacteria 1807
623 Ga0495619_0212173 3300053085 Bacteria 1341
624 Ga0500644_0530600 3300053088 Bacteria 519
625 Ga0500568_0009415 3300053139 Bacteria 4645
626 Ga0500616_0000110 3300053153 Bacteria 152339
627 Ga0500636_0184481 3300053177 Bacteria 1117
628 Ga0501084_0091134 3300054114 Bacteria 2560
629 Ga0501084_0108358 3300054114 Bacteria 2334
630 Ga0501084_1825445 3300054114 Bacteria 508
631 Ga0587073_0301695 3300059492 Bacteria 522
632 Ga0587086_062196 3300059507 Unclassified 625
633 Ga0587076_171471 3300059645 Unclassified 540
634 Ga0587079_065829 3300059647 Unclassified 797
635 Ga0587102_012864 3300059649 Unclassified 859
636 Ga0587114_082085 3300059655 Bacteria 601
637 Ga0587114_127336 3300059655 Bacteria 521
638 Ga0587111_0171276 3300060346 Unclassified 597
639 Ga0501082_0222346 3300060353 Bacteria 1643
640 Ga0530510_0388082 3300061734 Bacteria 1051
641 Ga0530510_0670244 3300061734 Bacteria 790
642 2643893449 2643221576 Bacteria 5214352
643 2643962499 2643221590 Bacteria 5214697
644 Ga0307413_10515911
645 LJQas_1008771
646 Ga0070658_10004936
647 Ga0070658_10050241
648 Ga0070658_10052522
649 Ga0070658_10162390
650 Ga0070676_10169461
651 Ga0070683_100097497
652 Ga0070683_100160568
653 Ga0070683_100550830
654 Ga0070683_100740168
655 Ga0070683_100901586
656 Ga0068869_100157732
657 Ga0068869_100570496
658 Ga0070680_100154635
659 Ga0070682_100089314
660 Ga0070682_100931883
661 Ga0068868_100331130
662 Ga0070660_100037933
663 Ga0070660_101355771
664 Ga0070689_100512192
665 Ga0070691_10095235
666 Ga0070661_100124012
667 Ga0070661_101094179
668 Ga0070692_10611809
669 Ga0070692_10953337
670 Ga0070675_100124314
671 Ga0070674_100488671
672 Ga0070659_100037414
673 Ga0070667_100444137
674 Ga0070709_10296815
675 Ga0070714_100021544
676 Ga0070714_100270600
677 Ga0070714_100383323
678 Ga0070714_100465284
679 Ga0070713_101079240
680 Ga0070701_10129123
681 Ga0070705_100671202
682 Ga0070694_100382228
683 Ga0070694_101940099
684 Ga0070663_100150447
685 Ga0070663_100398804
686 Ga0070663_101552641
687 Ga0070678_100313802
688 Ga0070662_100157689
689 Ga0070662_100334300
690 Ga0070662_100793578
691 Ga0070662_101229965
692 Ga0070681_10022501
693 Ga0070681_10880687
694 Ga0070681_11182161
695 Ga0068867_100063712
696 Ga0068867_100413979
697 Ga0068867_100732109
698 Ga0070706_100361447
699 Ga0070706_101082684
700 Ga0070707_100498913
701 Ga0070698_100040383
702 Ga0070698_101302676
703 Ga0070679_100101531
704 Ga0070679_100583354
705 Ga0070679_101123733
706 Ga0070679_102067359
707 Ga0070684_100237536
708 Ga0070697_100710881
709 Ga0070697_100978389
710 Ga0068853_100182590
711 Ga0068853_100400910
712 Ga0068853_100522744
713 Ga0070686_100071394
714 Ga0070686_100315387
715 Ga0070695_100006674
716 Ga0070695_101070877
717 Ga0070696_100188579
718 Ga0070696_101241612
719 Ga0070693_100018776
720 Ga0070665_100001640
721 Ga0070665_100125879
722 Ga0070665_101068030
723 Ga0070704_100032636
724 Ga0070704_100332817
725 Ga0068855_100015844
726 Ga0068855_100024671
727 Ga0068855_100237534
728 Ga0068855_100260523
729 Ga0070664_100319278
730 Ga0068857_100008374
731 Ga0068857_100054017
732 Ga0068854_100020113
733 Ga0068854_100068533
734 Ga0068854_101130161
735 Ga0068856_100029951
736 Ga0068856_100062910
737 Ga0068856_102615213
738 Ga0070702_100099095
739 Ga0070702_100212620
740 Ga0070702_100217769
741 Ga0068852_100007714
742 Ga0068852_100605135
743 Ga0068852_100621377
744 Ga0068859_100002859
745 Ga0068859_100086069
746 Ga0068858_100795561
747 Ga0068860_101893963
748 Ga0068862_100806184
749 Ga0070717_10000010
750 Ga0070717_10044645
751 Ga0070717_10503010
752 Ga0075364_10264659
753 Ga0075364_10670418
754 Ga0075364_10955430
755 Ga0070712_100931354
756 Ga0075362_10018487
757 Ga0075362_10218900
758 Ga0075367_10038909
759 Ga0075366_10218147
760 Ga0075366_10503694
761 Ga0097621_101914951
762 Ga0075370_10000751
763 Ga0075428_101657475
764 Ga0075430_100127222
765 Ga0075431_100504364
766 Ga0075431_100594959
767 Ga0075433_11086565
768 Ga0075434_100434736
769 Ga0075436_100039244
770 Ga0097620_100002859
771 Ga0097620_100086071
772 Ga0075435_100689614
773 Ga0105240_10031383
774 Ga0105240_10048878
775 Ga0105240_10243500
776 Ga0105240_10609778
777 Ga0105240_11031983
778 Ga0105240_11148464
779 Ga0111539_10045281
780 Ga0105245_10001047
781 Ga0105245_10406790
782 Ga0105245_10514745
783 Ga0105245_11526724
784 Ga0105247_10009758
785 Ga0114129_11392270
786 Ga0114129_12013424
787 Ga0105243_10196904
788 Ga0105243_10249666
789 Ga0105243_10422516
790 Ga0105243_11024942
791 Ga0105241_10003448
792 Ga0105241_10073234
793 Ga0105241_10238703
794 Ga0105241_11570240
795 Ga0105241_12297428
796 Ga0105242_10008633
797 Ga0105242_10257231
798 Ga0105242_10936336
799 Ga0105242_11175518
800 Ga0105237_10006358
801 Ga0105237_10038771
802 Ga0105237_10108718
803 Ga0105237_10247519
804 Ga0105237_10326104
805 Ga0105237_11161481
806 Ga0105238_10031695
807 Ga0105238_10056808
808 Ga0105238_11501311
809 Ga0105238_11851420
810 Ga0105249_10266020
811 Ga0105249_11571753
812 Ga0105239_10009426
813 Ga0105239_10064486
814 Ga0105239_10291138
815 Ga0105239_10556101
816 Ga0105246_10013416
817 Ga0105246_10321995
818 Ga0157322_1017984
819 Ga0157341_1015857
820 Ga0157324_1010714
821 Ga0154016_114911
822 Ga0157373_10142063
823 Ga0157373_10151307
824 Ga0157371_10265202
825 Ga0157371_10299670
826 Ga0157371_11118619
827 Ga0157370_10100153
828 Ga0157370_10238384
829 Ga0157370_11835462
830 Ga0157369_10000558
831 Ga0157369_10020789
832 Ga0157369_10206818
833 Ga0157369_10676725
834 Ga0157369_11965305
835 Ga0157374_10050676
836 Ga0157374_10504650
837 Ga0157374_10955424
838 Ga0157378_11010582
839 Ga0157372_10326526
840 Ga0157372_10590498
841 Ga0157372_10686146
842 Ga0157372_10784751
843 Ga0157372_11670364
844 Ga0157375_10060660
845 Ga0163163_11123217
846 Ga0157380_10072468
847 Ga0157380_11842811
848 Ga0157377_11212374
849 Ga0157379_10427004
850 Ga0157376_10384268
851 Ga0197907_10073727
852 Ga0197907_10131703
853 Ga0197907_10136630
854 Ga0197907_10374786
855 Ga0197907_10770193
856 Ga0197907_10901808
857 Ga0197907_11302759
858 Ga0197907_11392812
859 Ga0206356_10133533
860 Ga0206356_10429381
861 Ga0206356_10579576
862 Ga0206356_10667707
863 Ga0206356_10725694
864 Ga0206356_11113678
865 Ga0206356_11266540
866 Ga0206356_11290798
867 Ga0206356_11329628
868 Ga0206356_11770868
869 Ga0206356_11902497
870 Ga0206349_1516129
871 Ga0206349_1653571
872 Ga0206349_1658494
873 Ga0206349_1926064
874 Ga0206355_1021328
875 Ga0206355_1315587
876 Ga0206351_10350394
877 Ga0206351_10386798
878 Ga0206351_10572006
879 Ga0206351_10602002
880 Ga0206351_10723018
881 Ga0206351_10802626
882 Ga0206351_10877758
883 Ga0206351_10975176
884 Ga0206352_10545586
885 Ga0206352_10664819
886 Ga0206352_11134172
887 Ga0206352_11184610
888 Ga0206350_10008600
889 Ga0206350_10106865
890 Ga0206350_10287112
891 Ga0206350_10329360
892 Ga0206350_10382195
893 Ga0206350_10436039
894 Ga0206350_10668316
895 Ga0206350_11047726
896 Ga0206350_11166521
897 Ga0206350_11264632
898 Ga0206350_11325029
899 Ga0206350_11611949
900 Ga0206354_10157966
901 Ga0206354_11124229
902 Ga0206354_11676962
903 Ga0206353_10176860
904 Ga0206353_10358230
905 Ga0206353_10453957
906 Ga0154015_1381234
907 Ga0154015_1549133
908 Ga0213876_10578691
909 Ga0224712_10001173
910 Ga0224712_10015294
911 Ga0224712_10039498
912 Ga0224712_10051777
913 Ga0224712_10054370
914 Ga0224712_10071107
915 Ga0224712_10132375
916 Ga0224712_10172177
917 Ga0224712_10271630
918 Ga0224712_10333524
919 Ga0224712_10496693
920 Ga0224712_10660045
921 Ga0224712_10671645
922 Ga0224712_10683285
923 Ga0207710_10021577
924 Ga0207647_10008777
925 Ga0207647_10034570
926 Ga0207699_11432218
927 Ga0207645_10389608
928 Ga0207705_10006912
929 Ga0207705_10090177
930 Ga0207705_10372238
931 Ga0207684_10248006
932 Ga0207654_10029721
933 Ga0207654_10213621
934 Ga0207707_10048850
935 Ga0207707_10289220
936 Ga0207707_10440307
937 Ga0207707_10695939
938 Ga0207695_10058849
939 Ga0207695_10203262
940 Ga0207695_10209301
941 Ga0207695_11271887
942 Ga0207671_10000421
943 Ga0207671_10006610
944 Ga0207671_10157802
945 Ga0207671_10250895
946 Ga0207671_10669903
947 Ga0207660_10015995
948 Ga0207662_10352988
949 Ga0207657_10013218
950 Ga0207657_10378001
951 Ga0207649_10077753
952 Ga0207649_10645386
953 Ga0207649_11086916
954 Ga0207652_10088089
955 Ga0207652_10480845
956 Ga0207652_11529778
957 Ga0207646_10505528
958 Ga0207646_10956781
959 Ga0207681_10097971
960 Ga0207694_10004812
961 Ga0207694_10340011
962 Ga0207687_10059913
963 Ga0207664_10093475
964 Ga0207664_10949717
965 Ga0207664_11220772
966 Ga0207690_10037848
967 Ga0207706_10005983
968 Ga0207706_10805975
969 Ga0207686_10010612
970 Ga0207686_10151443
971 Ga0207686_11328888
972 Ga0207709_10127026
973 Ga0207709_10129739
974 Ga0207709_10292218
975 Ga0207691_10017877
976 Ga0207689_10107159
977 Ga0207661_10629263
978 Ga0207661_12056145
979 Ga0207679_11072877
980 Ga0207667_10015432
981 Ga0207667_10129485
982 Ga0207667_10270731
983 Ga0207667_10437875
984 Ga0207668_10731275
985 Ga0207640_10046152
986 Ga0207640_10340305
987 Ga0207658_10108017
988 Ga0207658_11035970
989 Ga0207677_10497373
990 Ga0207677_11280280
991 Ga0207639_10435533
992 Ga0207639_10687336
993 Ga0207639_10781459
994 Ga0207639_10967542
995 Ga0207639_11040024
996 Ga0207678_10028708
997 Ga0207678_10383956
998 Ga0207678_10778237
999 Ga0207678_11526577
1000 Ga0207702_10035061
1001 Ga0207702_10169633
1002 Ga0207702_10394052
1003 Ga0207648_10185781
1004 Ga0207648_10472896
1005 Ga0207676_10338567
1006 Ga0207674_10045093
1007 Ga0207674_11350808
1008 Ga0207675_100068423
1009 Ga0207675_101062000
1010 Ga0207675_102176943
1011 Ga0207683_10355032
1012 Ga0207698_10188588
1013 Ga0207698_10445413
1014 Ga0207698_10850770
1015 Ga0207698_11175366
1016 Ga0209813_10347680
1017 Ga0268266_10106682
1018 Ga0268266_10185568
1019 Ga0268265_11739012
1020 Ga0307517_10214019
1021 Ga0265339_10151332
1022 Ga0265327_10004236
1023 Ga0265316_10184219
1024 Ga0307513_10180753
1025 Ga0307408_101200665
1026 Ga0307508_10208659
1027 Ga0307516_10140445
1028 Ga0307412_12016632
1029 Ga0307409_100162783
1030 Ga0307409_101210962
1031 Ga0307416_100791029
1032 Ga0307416_102067524
1033 Ga0307416_103314403
1034 Ga0373949_0077059
1035 Ga0373952_0022903
1036 Ga0373960_0135659
1037 Ga0373943_0705751
1038 Ga0373946_0546413
1039 Ga0373955_0215417
1040 Ga0373942_0046297
1041 Ga0373947_0505879
1042 Ga0373937_0043188
1043 Ga0373937_1131694
1044 Ga0373937_1466330
1045 Ga0373925_0216272
1046 Ga0373925_0229499
1047 Ga0395900_0228700
1048 Ga0395898_0862664
1049 Ga0395898_1225314
1050 Ga0395905_0229878
1051 Ga0395901_1484006
1052 Ga0436365_0331179
1053 Ga0436360_0354387
1054 Ga0436361_0968864
1055 Ga0436362_0376699
1056 Ga0439438_035401
1057 Ga0451789_0100037
1058 Ga0451791_0290458
1059 Ga0451793_0601438
1060 Ga0451798_0979328
1061 Ga0451833_0296526
1062 Ga0451837_0052104
1063 Ga0451841_0342067
1064 Ga0451853_1518694
1065 Ga0450898_086294
1066 Ga0439446_0006661
1067 Ga0439434_0044765
1068 Ga0466966_0282392
1069 Ga0466963_0679369
1070 Ga0453684_1385916
1071 Ga0466970_0959422
1072 Ga0466957_0183020
1073 Ga0466960_0066119
1074 Ga0466959_0041001
1075 Ga0451576_0103779
1076 Ga0466967_0427347
1077 Ga0466967_1762344
1078 Ga0495592_0364096
1079 Ga0495603_0036301
1080 Ga0495603_0229280
1081 Ga0495629_0290907
1082 Ga0495629_1086536
1083 Ga0495641_0078586
1084 Ga0495653_0048298
1085 Ga0495653_0262112
1086 Ga0495639_0258474
1087 Ga0495662_0395564
1088 Ga0495584_0172526
1089 Ga0495584_0505422
1090 Ga0495585_0198850
1091 Ga0495594_0420241
1092 Ga0495583_0206182
1093 Ga0495608_0136514
1094 Ga0495618_0425921
1095 Ga0495630_0281531
1096 Ga0495630_0440109
1097 Ga0495630_0546876
1098 Ga0495643_0218168
1099 Ga0495644_0050527
1100 Ga0495652_0138262
1101 Ga0495586_0343140
1102 Ga0495609_0354849
1103 Ga0495621_0298957
1104 Ga0495667_0108889
1105 Ga0495667_0123535
1106 Ga0495656_0018932
1107 Ga0495656_0222603
1108 Ga0495656_0385663
1109 Ga0495668_0137531
1110 Ga0495634_0171542
1111 Ga0495635_0056961
1112 Ga0495635_0165262
1113 Ga0495588_0213810
1114 Ga0495657_0099477
1115 Ga0495647_0235456
1116 Ga0495624_0355458
1117 Ga0495670_0140894
1118 Ga0495671_0228129
1119 Ga0495671_0501355
1120 Ga0495581_0266852
1121 Ga0495676_0548595
1122 Ga0495680_0683312
1123 Ga0495673_0124004
1124 Ga0495684_0493553
1125 Ga0495684_0530179
1126 Ga0495686_0000655
1127 Ga0496100_0084406
1128 Ga0496100_0103707
1129 Ga0496100_0621257
1130 Ga0496100_1197544
1131 Ga0496101_0054622
1132 Ga0496101_0264051
1133 Ga0496101_0693817
1134 Ga0496102_0000212
1135 Ga0496102_0037710
1136 Ga0496102_0365261
1137 Ga0496103_0000147
1138 Ga0496103_0374923
1139 Ga0496104_0119244
1140 Ga0496104_0245281
1141 Ga0496104_0280264
1142 Ga0496104_0440185
1143 Ga0496104_1743955
1144 Ga0496105_0487391
1145 Ga0496106_0483060
1146 Ga0496106_0575496
1147 Ga0496107_0733875
1148 Ga0496107_0776927
1149 Ga0496108_0006645
1150 Ga0496108_0030246
1151 Ga0496109_0046211
1152 Ga0496109_0081876
1153 Ga0496110_0630236
1154 Ga0496110_0836535
1155 Ga0496111_0123737
1156 Ga0496112_0007079
1157 Ga0496112_0460140
1158 Ga0496112_0518760
1159 Ga0496112_0706794
1160 Ga0496113_0214810
1161 Ga0496113_0702002
1162 Ga0496113_0882362
1163 Ga0496113_0920726
1164 Ga0496113_1544105
1165 Ga0496114_0005157
1166 Ga0496114_0866345
1167 Ga0496115_0610432
1168 Ga0496117_0107311
1169 Ga0496119_0028694
1170 Ga0496121_0037898
1171 Ga0501031_0045513
1172 Ga0501031_0073191
1173 Ga0501031_0133432
1174 Ga0501031_0583851
1175 Ga0501032_0104174
1176 Ga0501032_0165331
1177 Ga0501033_0512498
1178 Ga0501034_0025944
1179 Ga0501036_0055542
1180 Ga0501036_1246097
1181 Ga0501036_1273742
1182 Ga0501037_0152201
1183 Ga0501037_0336011
1184 Ga0501038_0806230
1185 Ga0501038_0909177
1186 Ga0501039_0067118
1187 Ga0501039_0139338
1188 Ga0501039_0260368
1189 Ga0501039_0377963
1190 Ga0501040_0265219
1191 Ga0501040_0365876
1192 Ga0501040_0500659
1193 Ga0501040_0702248
1194 Ga0501040_0790377
1195 Ga0501041_0035171
1196 Ga0501041_0042445
1197 Ga0501041_0319675
1198 Ga0501041_0341717
1199 Ga0501041_0475814
1200 Ga0501041_0516107
1201 Ga0501042_0210319
1202 Ga0501042_0502007
1203 Ga0501042_0537160
1204 Ga0501043_0318020
1205 Ga0501046_0528706
1206 Ga0501046_0672576
1207 Ga0501047_0100354
1208 Ga0501048_0017362
1209 Ga0501048_0223780
1210 Ga0501048_0745797
1211 Ga0501067_0013960
1212 Ga0501067_0744225
1213 Ga0501068_0054594
1214 Ga0501069_0121673
1215 Ga0501069_0465367
1216 Ga0501070_0015455
1217 Ga0501070_0102026
1218 Ga0501070_1304953
1219 Ga0501071_0051146
1220 Ga0501071_0209850
1221 Ga0501071_0614730
1222 Ga0501071_0957711
1223 Ga0501072_0205421
1224 Ga0501072_0590694
1225 Ga0501075_0087688
1226 Ga0501075_0513063
1227 Ga0501075_0778266
1228 Ga0501076_0067609
1229 Ga0501076_0088793
1230 Ga0501077_0097824
1231 Ga0501079_0168115
1232 Ga0501079_1166153
1233 Ga0501079_1261197
1234 Ga0501080_0114110
1235 Ga0501080_0682665
1236 Ga0501080_0890369
1237 Ga0501081_0233239
1238 Ga0501081_0340671
1239 Ga0501081_1097561
1240 Ga0501081_1455828
1241 Ga0501035_0348725
1242 Ga0501045_0020288
1243 Ga0501045_0294758
1244 nmdc:mga03683_182255_c1
1245 nmdc:mga03683_44913_c1
1246 nmdc:mga00v17_787885_c1
1247 nmdc:mga0yw44_1212327_c1
1248 nmdc:mga0yw44_473934_c1
1249 nmdc:mga0k408_680486_c1
1250 nmdc:mga07m45_2934_c1
1251 nmdc:mga07m45_29615_c1
1252 nmdc:mga09592_866329_c1
1253 nmdc:mga0qj67_170306_c1
1254 nmdc:mga06r32_396126_c1
1255 nmdc:mga08y16_781933_c1
1256 nmdc:mga0n895_115696_c1
1257 nmdc:mga0n895_297969_c1
1258 nmdc:mga0rr50_75878_c1
1259 nmdc:mga08x19_242111_c1
1260 nmdc:mga08x19_246852_c1
1261 nmdc:mga0a205_1066324_c1
1262 nmdc:mga0a205_497080_c1
1263 Ga0495595_0285507
1264 Ga0495619_0034827
1265 Ga0495619_0119386
1266 Ga0495619_0212173
1267 Ga0500644_0530600
1268 Ga0500568_0009415
1269 Ga0500616_0000110
1270 Ga0500636_0184481
1271 Ga0501084_0091134
1272 Ga0501084_0108358
1273 Ga0501084_1825445
1274 Ga0587073_0301695
1275 Ga0587086_062196
1276 Ga0587076_171471
1277 Ga0587079_065829
1278 Ga0587102_012864
1279 Ga0587114_082085
1280 Ga0587114_127336
1281 Ga0587111_0171276
1282 Ga0501082_0222346
1283 Ga0530510_0388082
1284 Ga0530510_0670244
1285 2643893449
1286 2643962499

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map