F471817

General Info

Members Datasets Scaffolds Average Seq Length
641 249 627 66

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_1317364|Ga0496111_1317364_177_416
Length 79
Sequence MAYVYKPIGGFFFMKNGKVKWFNSEKGFGFIEAEDGNDVFVHYSAIQTEGFKTLEEGQEVSFEVVEGARGPQAANVTKK

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 2738541302 Pedobacter sp. CF074 Isolate Unclassified
4 2739367651 Pedobacter sp. OK291 Isolate Unclassified
5 2739367656 Pedobacter sp. CF523 Isolate Unclassified
6 2739367663 Pedobacter sp. YR510 Isolate Unclassified
7 2818991437 Pedobacter terrae 518 Isolate Unclassified
8 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
9 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
10 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
11 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
12 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
13 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
14 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
15 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
23 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
24 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
105 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
106 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
107 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
108 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
109 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
110 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
111 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
126 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
127 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
128 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
141 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
150 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
201 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
202 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
235 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
236 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
237 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
238 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
239 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
240 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
243 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
246 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
247 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 67.08
Metatranscriptomes 30.73
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.64
Nodule 0
Rhizoplane 8.11
Rhizosphere 69.27
Stem 0
Stem Tuber 0
Unclassified 9.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000867 3300002773 Bacteria 14936
2 JGI25150J39212_1000008 3300002774 Bacteria 253098
3 JGI25159J45721_1002854 3300002987 Bacteria 6338
4 JGI25159J45721_1010898 3300002987 Bacteria 2271
5 JGI25159J45721_1019285 3300002987 Bacteria 1347
6 JGI25159J45721_1028602 3300002987 Bacteria 929
7 JGI25151J46595_10000009 3300003187 Bacteria 296412
8 JGI25151J46595_10000014 3300003187 Bacteria 253098
9 JGI25151J46595_10000995 3300003187 Bacteria 21425
10 JGI25151J46595_10001946 3300003187 Bacteria 13072
11 JGI25151J46595_10002449 3300003187 Bacteria 11148
12 JGI25151J46595_10005677 3300003187 Bacteria 6414
13 JGI25151J46595_10008092 3300003187 Bacteria 5094
14 JGI25151J46595_10014184 3300003187 Bacteria 3560
15 JGI25151J46595_10017189 3300003187 Bacteria 3143
16 JGI25151J46595_10017353 3300003187 Bacteria 3123
17 JGI25151J46595_10018872 3300003187 Bacteria 2946
18 JGI25151J46595_10023751 3300003187 Bacteria 2519
19 JGI25151J46595_10052039 3300003187 Bacteria 1381
20 JGI25153J46596_10000020 3300003215 Bacteria 252978
21 rootH1_10000468 3300003316 Bacteria 17805
22 rootH1_10002180 3300003316 Bacteria 29373
23 rootL2_10056323 3300003322 Bacteria 23121
24 rootL2_10195243 3300003322 Bacteria 3180
25 Ga0006562J51391_1000133 3300003578 Bacteria 4060
26 Ga0055538_1000384 3300003751 Bacteria 18126
27 Ga0055532_1000088 3300003758 Bacteria 106291
28 Ga0055532_1007874 3300003758 Bacteria 1351
29 Ga0055532_1015471 3300003758 Bacteria 842
30 Ga0055536_1000226 3300003781 Bacteria 45469
31 Ga0055536_1036255 3300003781 Bacteria 1222
32 Ga0055528_1001866 3300003790 Bacteria 11999
33 Ga0055528_1017989 3300003790 Bacteria 2418
34 Ga0055530_10003368 3300003791 Bacteria 9150
35 Ga0055530_10122690 3300003791 Bacteria 502
36 Ga0065165_1095519 3300005262 Bacteria 751
37 Ga0065714_10081440 3300005288 Bacteria 2374
38 Ga0070670_100547616 3300005331 Bacteria 1032
39 Ga0070677_10321272 3300005333 Bacteria 793
40 Ga0070691_11033150 3300005341 Bacteria 514
41 Ga0070669_100187705 3300005353 Bacteria 1620
42 Ga0070669_100916458 3300005353 Bacteria 749
43 Ga0070675_100650047 3300005354 Bacteria 958
44 Ga0070675_101303823 3300005354 Bacteria 669
45 Ga0070671_100573741 3300005355 Bacteria 974
46 Ga0070671_100705786 3300005355 Bacteria 875
47 Ga0070659_100204291 3300005366 Bacteria 1627
48 Ga0070714_100791651 3300005435 Bacteria 918
49 Ga0070708_101104958 3300005445 Bacteria 742
50 Ga0070706_101091224 3300005467 Unclassified 735
51 Ga0068852_100948308 3300005616 Bacteria 878
52 Ga0068864_100754058 3300005618 Bacteria 954
53 Ga0068870_10586543 3300005840 Bacteria 755
54 Ga0068863_101537555 3300005841 Bacteria 674
55 Ga0070715_10265694 3300006163 Bacteria 903
56 Ga0070715_11057505 3300006163 Bacteria 509
57 Ga0075431_100869435 3300006847 Bacteria 872
58 Ga0075431_101090811 3300006847 Bacteria 763
59 Ga0099794_10056940 3300007265 Bacteria 1893
60 Ga0105251_10009354 3300009011 Bacteria 5793
61 Ga0105251_10027444 3300009011 Bacteria 2887
62 Ga0105251_10065266 3300009011 Bacteria 1704
63 Ga0105251_10147559 3300009011 Bacteria 1063
64 Ga0105251_10150055 3300009011 Bacteria 1053
65 Ga0105251_10220100 3300009011 Bacteria 855
66 Ga0105244_10033080 3300009036 Bacteria 2730
67 Ga0105244_10050015 3300009036 Bacteria 2133
68 Ga0105244_10051980 3300009036 Bacteria 2088
69 Ga0105244_10100296 3300009036 Bacteria 1417
70 Ga0105244_10108870 3300009036 Bacteria 1350
71 Ga0105244_10137690 3300009036 Bacteria 1176
72 Ga0105244_10216786 3300009036 Bacteria 899
73 Ga0105244_10506265 3300009036 Bacteria 556
74 Ga0105250_10000972 3300009092 Bacteria 16728
75 Ga0105250_10001672 3300009092 Bacteria 11739
76 Ga0105250_10050740 3300009092 Bacteria 1665
77 Ga0105250_10061743 3300009092 Bacteria 1507
78 Ga0105250_10086969 3300009092 Bacteria 1269
79 Ga0105250_10194057 3300009092 Bacteria 855
80 Ga0105250_10244575 3300009092 Bacteria 765
81 Ga0105250_10315493 3300009092 Bacteria 678
82 Ga0105245_13137182 3300009098 Bacteria 512
83 Ga0105247_10044820 3300009101 Bacteria 2713
84 Ga0114129_11006675 3300009147 Bacteria 1049
85 Ga0114129_12004420 3300009147 Bacteria 700
86 Ga0105243_10022074 3300009148 Bacteria 4836
87 Ga0105243_12781938 3300009148 Bacteria 530
88 Ga0105242_10051280 3300009176 Bacteria 3362
89 Ga0105242_10052645 3300009176 Bacteria 3322
90 Ga0105248_12054350 3300009177 Bacteria 649
91 Ga0105237_10004656 3300009545 Bacteria 15799
92 Ga0105249_10722686 3300009553 Bacteria 1057
93 Ga0105239_10809108 3300010375 Bacteria 1074
94 Ga0105239_11127562 3300010375 Bacteria 903
95 Ga0105246_10000485 3300011119 Bacteria 21476
96 Ga0105246_10089462 3300011119 Bacteria 2215
97 Ga0105246_10107969 3300011119 Bacteria 2039
98 Ga0105246_10281027 3300011119 Bacteria 1335
99 Ga0157371_10003000 3300013102 Bacteria 15675
100 Ga0157370_10000207 3300013104 Bacteria 74451
101 Ga0157370_10018370 3300013104 Bacteria 7033
102 Ga0157370_10019227 3300013104 Bacteria 6860
103 Ga0157370_11289423 3300013104 Bacteria 658
104 Ga0157369_10000071 3300013105 Bacteria 140377
105 Ga0157369_11616035 3300013105 Bacteria 659
106 Ga0157374_10056360 3300013296 Bacteria 3668
107 Ga0157374_10937897 3300013296 Bacteria 884
108 Ga0157378_10022291 3300013297 Bacteria 5575
109 Ga0157378_10241627 3300013297 Bacteria 1725
110 Ga0157372_10681016 3300013307 Bacteria 1197
111 Ga0157372_10877555 3300013307 Bacteria 1041
112 Ga0157375_12821651 3300013308 Bacteria 581
113 Ga0182008_10001007 3300014497 Bacteria 19580
114 Ga0157377_10128646 3300014745 Bacteria 1544
115 Ga0182006_1000218 3300015261 Bacteria 55915
116 Ga0182006_1000332 3300015261 Bacteria 40804
117 Ga0182007_10000006 3300015262 Bacteria 427355
118 Ga0183373_1001 3300015682 Bacteria 1410374
119 Ga0163161_10000309 3300017792 Bacteria 42593
120 Ga0163161_10000394 3300017792 Bacteria 36483
121 Ga0163161_10001366 3300017792 Bacteria 18108
122 Ga0163161_10004577 3300017792 Bacteria 9628
123 Ga0163161_10036311 3300017792 Bacteria 3529
124 Ga0163161_10247121 3300017792 Bacteria 1389
125 Ga0209784_100075 3300025224 Bacteria 139902
126 Ga0209566_100163 3300025225 Bacteria 74229
127 Ga0209566_101967 3300025225 Bacteria 4413
128 Ga0209147_100058 3300025229 Bacteria 252750
129 Ga0209147_100101 3300025229 Bacteria 161976
130 Ga0209147_100804 3300025229 Bacteria 15179
131 Ga0209147_101577 3300025229 Bacteria 7737
132 Ga0209147_101979 3300025229 Bacteria 5982
133 Ga0209147_103674 3300025229 Bacteria 2863
134 Ga0209147_106030 3300025229 Bacteria 1725
135 Ga0209147_107772 3300025229 Bacteria 1374
136 Ga0209437_100453 3300025233 Bacteria 33692
137 Ga0207425_1000007 3300025245 Bacteria 777411
138 Ga0209129_1000006 3300025258 Bacteria 777761
139 Ga0209673_1003112 3300025273 Bacteria 10159
140 Ga0209673_1025919 3300025273 Bacteria 1938
141 Ga0209130_1000339 3300025284 Bacteria 53895
142 Ga0209130_1001601 3300025284 Bacteria 14115
143 Ga0209130_1005233 3300025284 Bacteria 4576
144 Ga0209130_1026007 3300025284 Bacteria 1260
145 Ga0209130_1061687 3300025284 Bacteria 647
146 Ga0209676_1000090 3300025292 Bacteria 256336
147 Ga0209676_1002149 3300025292 Bacteria 14927
148 Ga0209676_1065880 3300025292 Bacteria 880
149 Ga0209025_1000001 3300025294 Bacteria 1888151
150 Ga0209025_1000089 3300025294 Bacteria 254130
151 Ga0209025_1000448 3300025294 Bacteria 80629
152 Ga0209025_1000517 3300025294 Bacteria 73456
153 Ga0209025_1001072 3300025294 Bacteria 39679
154 Ga0209025_1002054 3300025294 Bacteria 22919
155 Ga0209025_1002063 3300025294 Bacteria 22823
156 Ga0209025_1003433 3300025294 Bacteria 15018
157 Ga0209025_1005366 3300025294 Bacteria 10492
158 Ga0209025_1008647 3300025294 Bacteria 7280
159 Ga0209025_1008729 3300025294 Bacteria 7221
160 Ga0209025_1020338 3300025294 Bacteria 3636
161 Ga0209025_1028431 3300025294 Bacteria 2739
162 Ga0209025_1038582 3300025294 Bacteria 2098
163 Ga0209025_1050381 3300025294 Bacteria 1665
164 Ga0209025_1072334 3300025294 Bacteria 1216
165 Ga0209025_1106974 3300025294 Bacteria 869
166 Ga0209025_1109016 3300025294 Bacteria 855
167 Ga0209025_1135416 3300025294 Bacteria 707
168 Ga0209564_1041980 3300025295 Bacteria 1219
169 Ga0209758_1000016 3300025297 Bacteria 778557
170 Ga0209050_1000091 3300025298 Bacteria 253049
171 Ga0209050_1029751 3300025298 Bacteria 1738
172 Ga0207426_1012595 3300025302 Bacteria 3170
173 Ga0207696_1000759 3300025711 Bacteria 21303
174 Ga0207696_1000957 3300025711 Bacteria 17604
175 Ga0207696_1005278 3300025711 Bacteria 5384
176 Ga0207696_1006172 3300025711 Bacteria 4870
177 Ga0207696_1014863 3300025711 Bacteria 2655
178 Ga0207696_1064745 3300025711 Bacteria 1024
179 Ga0207655_1002615 3300025728 Bacteria 14305
180 Ga0207655_1031303 3300025728 Bacteria 2454
181 Ga0207655_1033182 3300025728 Bacteria 2344
182 Ga0207655_1073849 3300025728 Bacteria 1257
183 Ga0207655_1074361 3300025728 Bacteria 1250
184 Ga0207655_1087716 3300025728 Bacteria 1103
185 Ga0207655_1088728 3300025728 Bacteria 1094
186 Ga0207655_1100710 3300025728 Bacteria 996
187 Ga0207713_1002533 3300025735 Bacteria 13221
188 Ga0207713_1021180 3300025735 Bacteria 3123
189 Ga0207713_1028893 3300025735 Bacteria 2493
190 Ga0207713_1103844 3300025735 Bacteria 977
191 Ga0207713_1133394 3300025735 Bacteria 819
192 Ga0207713_1171541 3300025735 Bacteria 684
193 Ga0207713_1257845 3300025735 Bacteria 512
194 Ga0207710_10106730 3300025900 Bacteria 1326
195 Ga0207710_10455497 3300025900 Bacteria 661
196 Ga0207643_10228281 3300025908 Bacteria 1141
197 Ga0207671_10011917 3300025914 Bacteria 7030
198 Ga0207681_10203798 3300025923 Bacteria 1520
199 Ga0207681_10522044 3300025923 Bacteria 975
200 Ga0207681_11318323 3300025923 Bacteria 606
201 Ga0207650_10697353 3300025925 Bacteria 857
202 Ga0207659_10601039 3300025926 Bacteria 938
203 Ga0207690_11122075 3300025932 Bacteria 656
204 Ga0207686_10493300 3300025934 Bacteria 949
205 Ga0207709_10337117 3300025935 Bacteria 1134
206 Ga0207703_11460158 3300026035 Bacteria 658
207 Ga0207676_11449038 3300026095 Bacteria 683
208 Ga0207698_11568204 3300026142 Bacteria 674
209 Ga0209371_1023695 3300027312 Bacteria 1441
210 Ga0265336_10050893 3300028666 Bacteria 1252
211 Ga0237817_10116 3300030083 Bacteria 24644
212 Ga0237817_10185 3300030083 Bacteria 16640
213 Ga0237817_10225 3300030083 Bacteria 14416
214 Ga0268256_1026858 3300030500 Bacteria 1441
215 Ga0316177_1077413 3300030731 Bacteria 11719
216 Ga0316176_1040115 3300030732 Bacteria 64357
217 Ga0314311_1138905 3300030733 Bacteria 1473
218 Ga0316183_1058968 3300030742 Bacteria 25350
219 Ga0316181_1195464 3300030744 Bacteria 10018
220 Ga0316181_1278082 3300030744 Bacteria 956
221 Ga0316182_1070017 3300030745 Bacteria 684
222 Ga0307408_100020895 3300031548 Bacteria 4424
223 Ga0307408_100029296 3300031548 Bacteria 3812
224 Ga0307408_100494431 3300031548 Bacteria 1069
225 Ga0307408_100543009 3300031548 Bacteria 1024
226 Ga0307408_100789827 3300031548 Bacteria 861
227 Ga0307405_10000012 3300031731 Bacteria 233774
228 Ga0307405_11060768 3300031731 Bacteria 694
229 Ga0307405_11961522 3300031731 Bacteria 523
230 Ga0307410_11893244 3300031852 Bacteria 531
231 Ga0307406_11153987 3300031901 Bacteria 671
232 Ga0307407_10000038 3300031903 Bacteria 68710
233 Ga0307407_10964945 3300031903 Bacteria 657
234 Ga0307412_10103523 3300031911 Bacteria 2018
235 Ga0307412_10597100 3300031911 Bacteria 934
236 Ga0307409_100018796 3300031995 Bacteria 4659
237 Ga0307409_100088814 3300031995 Bacteria 2524
238 Ga0307409_100130985 3300031995 Bacteria 2143
239 Ga0307409_101193913 3300031995 Bacteria 784
240 Ga0307409_101413213 3300031995 Bacteria 722
241 Ga0307416_100000007 3300032002 Bacteria 433284
242 Ga0307416_100030544 3300032002 Bacteria 4044
243 Ga0307416_100045485 3300032002 Bacteria 3457
244 Ga0307416_100143998 3300032002 Bacteria 2172
245 Ga0307416_100152940 3300032002 Bacteria 2119
246 Ga0307416_101133367 3300032002 Bacteria 887
247 Ga0307416_101352499 3300032002 Bacteria 818
248 Ga0307414_10202896 3300032004 Bacteria 1614
249 Ga0316593_10178595 3300032168 Bacteria 780
250 Ga0395899_0481788 3300037312 Bacteria 808
251 Ga0395898_0411741 3300037466 Bacteria 1289
252 Ga0395898_0977656 3300037466 Bacteria 783
253 Ga0395898_1379592 3300037466 Bacteria 633
254 Ga0395898_1504428 3300037466 Bacteria 599
255 Ga0395901_0072903 3300038443 Bacteria 3580
256 Ga0395901_1285939 3300038443 Bacteria 694
257 Ga0395901_1669199 3300038443 Bacteria 589
258 Ga0237819_00033 3300038705 Bacteria 47134
259 Ga0237819_00069 3300038705 Bacteria 37429
260 Ga0237819_00222 3300038705 Bacteria 20663
261 Ga0451787_150981 3300041441 Bacteria 522
262 Ga0451789_0488552 3300041443 Bacteria 626
263 Ga0451855_1918519 3300041511 Bacteria 638
264 Ga0451577_0933433 3300042876 Bacteria 781
265 Ga0466972_0301390 3300044658 Bacteria 749
266 Ga0466972_0337291 3300044658 Bacteria 705
267 Ga0466961_0170223 3300044693 Bacteria 1355
268 Ga0453684_0000797 3300044712 Bacteria 107625
269 Ga0453684_0072937 3300044712 Bacteria 4331
270 Ga0453684_0147397 3300044712 Bacteria 2801
271 Ga0453684_0154297 3300044712 Bacteria 2724
272 Ga0466970_0466320 3300044765 Bacteria 725
273 Ga0466959_0577989 3300045049 Bacteria 757
274 Ga0451576_0184301 3300045051 Bacteria 2180
275 Ga0451576_0682827 3300045051 Eukaryota 1079
276 Ga0466967_0000150 3300045976 Bacteria 27396
277 Ga0466967_0085795 3300045976 Bacteria 2851
278 Ga0466967_0323350 3300045976 Bacteria 1488
279 Ga0466967_2423182 3300045976 Bacteria 520
280 Ga0495627_189492 3300046453 Bacteria 568
281 Ga0495603_0022270 3300046455 Bacteria 3837
282 Ga0495603_0252353 3300046455 Bacteria 1015
283 Ga0495580_0919818 3300046472 Unclassified 561
284 Ga0495605_0172769 3300046474 Bacteria 954
285 Ga0495605_0346574 3300046474 Bacteria 623
286 Ga0495584_0165989 3300046491 Bacteria 1122
287 Ga0495584_0187701 3300046491 Bacteria 1050
288 Ga0495585_0033639 3300046492 Bacteria 2901
289 Ga0495585_0052367 3300046492 Bacteria 2260
290 Ga0495594_0626071 3300046499 Bacteria 610
291 Ga0495607_0458796 3300046501 Bacteria 571
292 Ga0495610_0000060 3300046512 Bacteria 131116
293 Ga0495610_0017632 3300046512 Bacteria 4064
294 Ga0495631_0045430 3300046518 Bacteria 1934
295 Ga0495631_0141199 3300046518 Bacteria 1034
296 Ga0495637_0348827 3300046520 Bacteria 519
297 Ga0495609_0114665 3300046538 Bacteria 1161
298 Ga0495597_0252399 3300046542 Bacteria 693
299 Ga0495597_0262800 3300046542 Bacteria 676
300 Ga0495622_0033765 3300046557 Bacteria 2388
301 Ga0495622_0195864 3300046557 Bacteria 902
302 Ga0495622_0268125 3300046557 Bacteria 748
303 Ga0495633_0230786 3300046558 Bacteria 846
304 Ga0495633_0349195 3300046558 Bacteria 670
305 Ga0495668_0703620 3300046616 Bacteria 559
306 Ga0495661_0096745 3300046665 Bacteria 1669
307 Ga0495661_0145126 3300046665 Bacteria 1287
308 Ga0495661_0426606 3300046665 Bacteria 641
309 Ga0495670_0499077 3300046691 Bacteria 661
310 Ga0495670_0765073 3300046691 Bacteria 527
311 Ga0495589_0016929 3300046794 Bacteria 3743
312 Ga0495589_0225896 3300046794 Bacteria 879
313 Ga0495589_0356570 3300046794 Bacteria 673
314 Ga0495676_0223928 3300047321 Bacteria 1295
315 Ga0495676_0288437 3300047321 Bacteria 1109
316 Ga0495683_0016063 3300047323 Bacteria 3888
317 Ga0495683_0066595 3300047323 Bacteria 1774
318 Ga0495681_0204614 3300047470 Bacteria 799
319 Ga0495614_0115636 3300048089 Bacteria 1180
320 Ga0495614_0215910 3300048089 Bacteria 871
321 Ga0495626_0156768 3300048091 Bacteria 957
322 Ga0496100_0000291 3300048903 Bacteria 25201
323 Ga0496100_0002948 3300048903 Bacteria 8754
324 Ga0496101_0023551 3300048904 Bacteria 4255
325 Ga0496101_0263882 3300048904 Bacteria 1343
326 Ga0496101_0560757 3300048904 Bacteria 903
327 Ga0496102_0010426 3300048905 Bacteria 7992
328 Ga0496102_0091916 3300048905 Bacteria 2809
329 Ga0496102_0096109 3300048905 Bacteria 2747
330 Ga0496102_0335245 3300048905 Bacteria 1424
331 Ga0496102_1039593 3300048905 Bacteria 739
332 Ga0496102_1365013 3300048905 Bacteria 628
333 Ga0496103_0007550 3300048906 Bacteria 6479
334 Ga0496103_0021121 3300048906 Bacteria 3916
335 Ga0496103_0272074 3300048906 Bacteria 1090
336 Ga0496103_1044118 3300048906 Bacteria 507
337 Ga0496104_0001238 3300048907 Bacteria 21997
338 Ga0496104_0001710 3300048907 Bacteria 18952
339 Ga0496105_0000655 3300048908 Bacteria 23203
340 Ga0496105_0000827 3300048908 Bacteria 21031
341 Ga0496106_0012848 3300048909 Bacteria 6180
342 Ga0496106_0017084 3300048909 Bacteria 5370
343 Ga0496106_0856241 3300048909 Bacteria 719
344 Ga0496106_1177276 3300048909 Bacteria 598
345 Ga0496106_1185455 3300048909 Bacteria 596
346 Ga0496107_0000296 3300048910 Bacteria 26548
347 Ga0496107_0000352 3300048910 Bacteria 25045
348 Ga0496107_0346649 3300048910 Bacteria 1105
349 Ga0496107_0356117 3300048910 Bacteria 1089
350 Ga0496108_0005976 3300048911 Bacteria 9863
351 Ga0496108_0071598 3300048911 Bacteria 2925
352 Ga0496109_0021753 3300048912 Bacteria 5675
353 Ga0496109_0036427 3300048912 Bacteria 4440
354 Ga0496110_0093518 3300048913 Bacteria 2691
355 Ga0496110_0135677 3300048913 Bacteria 2224
356 Ga0496110_0189345 3300048913 Bacteria 1868
357 Ga0496110_0525592 3300048913 Bacteria 1076
358 Ga0496110_1664651 3300048913 Bacteria 548
359 Ga0496111_0024128 3300048914 Bacteria 4278
360 Ga0496111_0098615 3300048914 Bacteria 2145
361 Ga0496111_0576637 3300048914 Bacteria 825
362 Ga0496111_1317364 3300048914 Bacteria 508
363 Ga0496112_0002110 3300048915 Bacteria 15779
364 Ga0496112_0106574 3300048915 Bacteria 2772
365 Ga0496112_0204457 3300048915 Bacteria 1933
366 Ga0496113_0028055 3300048916 Bacteria 4044
367 Ga0496113_0049705 3300048916 Bacteria 3123
368 Ga0496114_0669443 3300048917 Bacteria 912
369 Ga0496114_0983038 3300048917 Bacteria 727
370 Ga0496115_0735610 3300048918 Bacteria 773
371 Ga0496115_0874403 3300048918 Bacteria 695
372 Ga0496116_0002717 3300048919 Bacteria 18216
373 Ga0496116_0004309 3300048919 Bacteria 13614
374 Ga0496116_0014479 3300048919 Bacteria 6294
375 Ga0496116_0048312 3300048919 Bacteria 2857
376 Ga0496116_0078423 3300048919 Bacteria 2060
377 Ga0496116_0107289 3300048919 Bacteria 1651
378 Ga0496116_0181560 3300048919 Bacteria 1126
379 Ga0496116_0342219 3300048919 Bacteria 689
380 Ga0496117_0012885 3300048920 Bacteria 7331
381 Ga0496117_0562349 3300048920 Unclassified 541
382 Ga0496118_0070306 3300048921 Bacteria 2528
383 Ga0496118_0085671 3300048921 Bacteria 2193
384 Ga0496119_0007723 3300048922 Bacteria 9613
385 Ga0496119_0047423 3300048922 Bacteria 2673
386 Ga0496120_0012145 3300048923 Bacteria 5875
387 Ga0496120_0254003 3300048923 Bacteria 824
388 Ga0496120_0489252 3300048923 Bacteria 530
389 Ga0496121_0054016 3300048924 Bacteria 3361
390 Ga0496121_0086698 3300048924 Bacteria 2460
391 Ga0496121_0784075 3300048924 Bacteria 562
392 Ga0496122_0000041 3300048925 Bacteria 282392
393 Ga0496122_0001846 3300048925 Bacteria 32295
394 Ga0496122_0003541 3300048925 Bacteria 20419
395 Ga0496122_0005848 3300048925 Bacteria 14445
396 Ga0496122_0114838 3300048925 Bacteria 1755
397 Ga0496122_0125266 3300048925 Bacteria 1646
398 Ga0496122_0141277 3300048925 Bacteria 1506
399 Ga0496122_0315574 3300048925 Bacteria 834
400 Ga0496123_0002062 3300048926 Bacteria 25924
401 Ga0496123_0010099 3300048926 Bacteria 8395
402 Ga0496123_0498646 3300048926 Bacteria 532
403 Ga0496124_0103024 3300048927 Bacteria 2309
404 Ga0496124_0300703 3300048927 Bacteria 1159
405 Ga0496124_0589940 3300048927 Bacteria 725
406 Ga0496124_0693278 3300048927 Bacteria 647
407 Ga0496125_0006817 3300048928 Bacteria 12258
408 Ga0496125_0037225 3300048928 Bacteria 4232
409 Ga0496125_0296042 3300048928 Bacteria 994
410 Ga0496126_0001264 3300048929 Bacteria 40755
411 Ga0496126_0031949 3300048929 Bacteria 4966
412 Ga0496126_0076002 3300048929 Bacteria 2980
413 Ga0496126_1122022 3300048929 Bacteria 583
414 Ga0501306_022650 3300049127 Bacteria 887
415 Ga0501306_029234 3300049127 Bacteria 811
416 Ga0501306_066841 3300049127 Bacteria 601
417 Ga0501306_091474 3300049127 Bacteria 535
418 Ga0501308_018014 3300049128 Bacteria 860
419 Ga0501308_041116 3300049128 Bacteria 651
420 Ga0501308_045061 3300049128 Bacteria 631
421 Ga0501308_074506 3300049128 Bacteria 532
422 Ga0501309_051234 3300049129 Bacteria 649
423 Ga0501309_060125 3300049129 Bacteria 610
424 Ga0501309_068602 3300049129 Bacteria 580
425 Ga0501309_088196 3300049129 Bacteria 527
426 Ga0501310_028539 3300049130 Bacteria 732
427 Ga0501310_039124 3300049130 Bacteria 655
428 Ga0501310_042666 3300049130 Bacteria 636
429 Ga0501310_044026 3300049130 Bacteria 629
430 Ga0501341_02594 3300049131 Bacteria 985
431 Ga0501341_07426 3300049131 Bacteria 686
432 Ga0501341_08197 3300049131 Bacteria 664
433 Ga0501341_13250 3300049131 Bacteria 565
434 Ga0501341_14847 3300049131 Bacteria 543
435 Ga0501343_004310 3300049132 Bacteria 1067
436 Ga0501343_012692 3300049132 Bacteria 702
437 Ga0501343_013953 3300049132 Bacteria 676
438 Ga0501343_020553 3300049132 Bacteria 582
439 Ga0501343_022700 3300049132 Bacteria 559
440 Ga0501343_024544 3300049132 Bacteria 542
441 Ga0501344_01950 3300049133 Bacteria 1036
442 Ga0501344_03700 3300049133 Bacteria 821
443 Ga0501344_07041 3300049133 Bacteria 657
444 Ga0501344_10959 3300049133 Bacteria 559
445 Ga0501345_01406 3300049134 Bacteria 922
446 Ga0501345_03833 3300049134 Bacteria 660
447 Ga0501304_014418 3300049160 Bacteria 732
448 Ga0501304_017582 3300049160 Bacteria 685
449 Ga0501304_021743 3300049160 Bacteria 640
450 Ga0501305_001129 3300049161 Bacteria 2511
451 Ga0501305_001192 3300049161 Bacteria 2475
452 Ga0501305_012428 3300049161 Bacteria 1164
453 Ga0501305_016385 3300049161 Bacteria 1056
454 Ga0501305_030730 3300049161 Bacteria 836
455 Ga0501305_045837 3300049161 Bacteria 723
456 Ga0501305_081101 3300049161 Bacteria 583
457 Ga0501305_117485 3300049161 Bacteria 508
458 Ga0501307_027013 3300049162 Bacteria 779
459 Ga0501307_029146 3300049162 Bacteria 758
460 Ga0501307_041820 3300049162 Bacteria 668
461 Ga0501342_02295 3300049163 Bacteria 644
462 Ga0501342_04017 3300049163 Bacteria 533
463 Ga0501290_037886 3300049513 Bacteria 713
464 Ga0501300_057544 3300049523 Bacteria 610
465 Ga0501311_003131 3300049527 Bacteria 1659
466 Ga0501311_018971 3300049527 Bacteria 918
467 Ga0501311_034666 3300049527 Bacteria 744
468 Ga0501311_055595 3300049527 Bacteria 629
469 Ga0501311_072220 3300049527 Bacteria 575
470 Ga0501311_073773 3300049527 Bacteria 570
471 Ga0501312_001813 3300049528 Bacteria 2194
472 Ga0501312_004756 3300049528 Bacteria 1616
473 Ga0501312_012147 3300049528 Bacteria 1181
474 Ga0501312_015380 3300049528 Bacteria 1085
475 Ga0501312_030417 3300049528 Bacteria 845
476 Ga0501312_041840 3300049528 Bacteria 751
477 Ga0501312_053845 3300049528 Bacteria 684
478 Ga0501313_014762 3300049529 Bacteria 927
479 Ga0501313_028022 3300049529 Bacteria 721
480 Ga0501313_028189 3300049529 Bacteria 719
481 Ga0501313_030745 3300049529 Bacteria 696
482 Ga0501313_062458 3300049529 Bacteria 529
483 Ga0501314_008322 3300049530 Bacteria 936
484 Ga0501314_024388 3300049530 Bacteria 645
485 Ga0501314_024600 3300049530 Bacteria 643
486 Ga0501314_046228 3300049530 Bacteria 518
487 Ga0501315_014823 3300049531 Bacteria 992
488 Ga0501315_027490 3300049531 Bacteria 803
489 Ga0501315_041586 3300049531 Bacteria 697
490 Ga0501315_042763 3300049531 Bacteria 690
491 Ga0501315_050881 3300049531 Bacteria 650
492 Ga0501315_084435 3300049531 Bacteria 543
493 Ga0501315_098125 3300049531 Bacteria 515
494 Ga0501316_004985 3300049532 Bacteria 1358
495 Ga0501316_031056 3300049532 Bacteria 715
496 Ga0501316_035900 3300049532 Bacteria 678
497 Ga0501316_079642 3300049532 Bacteria 506
498 Ga0501317_016328 3300049533 Bacteria 962
499 Ga0501317_027870 3300049533 Bacteria 804
500 Ga0501317_028186 3300049533 Bacteria 801
501 Ga0501317_045467 3300049533 Bacteria 683
502 Ga0501317_045531 3300049533 Bacteria 683
503 Ga0501317_046651 3300049533 Bacteria 677
504 Ga0501317_056789 3300049533 Bacteria 634
505 Ga0501317_100163 3300049533 Bacteria 522
506 Ga0501317_101264 3300049533 Bacteria 520
507 Ga0501318_008895 3300049534 Bacteria 1084
508 Ga0501318_023834 3300049534 Bacteria 793
509 Ga0501318_037387 3300049534 Bacteria 682
510 Ga0501319_006303 3300049535 Bacteria 872
511 Ga0501319_013869 3300049535 Bacteria 672
512 Ga0501319_033359 3300049535 Bacteria 502
513 Ga0501320_003370 3300049536 Bacteria 1351
514 Ga0501320_028390 3300049536 Bacteria 685
515 Ga0501320_028950 3300049536 Bacteria 680
516 Ga0501320_035660 3300049536 Bacteria 635
517 Ga0501321_001115 3300049537 Bacteria 2041
518 Ga0501321_028899 3300049537 Bacteria 731
519 Ga0501321_034372 3300049537 Bacteria 690
520 Ga0501321_074175 3300049537 Bacteria 534
521 Ga0501321_080451 3300049537 Bacteria 519
522 Ga0501322_010136 3300049538 Bacteria 722
523 Ga0501322_014565 3300049538 Bacteria 643
524 Ga0501322_015011 3300049538 Bacteria 637
525 Ga0501322_022371 3300049538 Bacteria 562
526 Ga0501323_004873 3300049539 Bacteria 1441
527 Ga0501323_008799 3300049539 Bacteria 1179
528 Ga0501323_016580 3300049539 Bacteria 940
529 Ga0501323_024182 3300049539 Bacteria 820
530 Ga0501323_040249 3300049539 Bacteria 683
531 Ga0501323_051709 3300049539 Bacteria 625
532 Ga0501324_006366 3300049540 Bacteria 993
533 Ga0501324_012194 3300049540 Bacteria 802
534 Ga0501324_020623 3300049540 Bacteria 672
535 Ga0501324_034340 3300049540 Bacteria 563
536 Ga0501325_004678 3300049541 Bacteria 1059
537 Ga0501325_025440 3300049541 Bacteria 650
538 Ga0501325_045804 3300049541 Bacteria 544
539 Ga0501326_02415 3300049542 Bacteria 918
540 Ga0501326_05121 3300049542 Bacteria 708
541 Ga0501326_09218 3300049542 Bacteria 581
542 Ga0501326_12175 3300049542 Bacteria 528
543 Ga0501327_00525 3300049543 Bacteria 1569
544 Ga0501327_04273 3300049543 Bacteria 814
545 Ga0501327_04558 3300049543 Bacteria 797
546 Ga0501327_08558 3300049543 Bacteria 652
547 Ga0501327_10501 3300049543 Bacteria 611
548 Ga0501327_14431 3300049543 Bacteria 552
549 Ga0501328_03259 3300049544 Bacteria 746
550 Ga0501328_04710 3300049544 Bacteria 669
551 Ga0501328_10646 3300049544 Bacteria 522
552 Ga0501329_00588 3300049545 Bacteria 1342
553 Ga0501329_08450 3300049545 Bacteria 618
554 Ga0501329_09124 3300049545 Bacteria 605
555 Ga0501329_11035 3300049545 Bacteria 572
556 Ga0501330_000757 3300049546 Bacteria 1503
557 Ga0501330_003240 3300049546 Bacteria 961
558 Ga0501330_004880 3300049546 Bacteria 841
559 Ga0501330_012793 3300049546 Bacteria 618
560 Ga0501330_016818 3300049546 Bacteria 564
561 Ga0501330_020977 3300049546 Bacteria 525
562 Ga0501331_04063 3300049547 Bacteria 807
563 Ga0501331_05972 3300049547 Bacteria 704
564 Ga0501331_10700 3300049547 Bacteria 574
565 Ga0501332_02033 3300049548 Bacteria 1109
566 Ga0501332_07927 3300049548 Bacteria 684
567 Ga0501333_007860 3300049549 Bacteria 727
568 Ga0501333_009428 3300049549 Bacteria 685
569 Ga0501333_009531 3300049549 Bacteria 683
570 Ga0501333_009940 3300049549 Bacteria 672
571 Ga0501333_019556 3300049549 Bacteria 534
572 Ga0501333_019589 3300049549 Bacteria 534
573 Ga0501333_021003 3300049549 Bacteria 521
574 Ga0501334_02380 3300049550 Bacteria 1113
575 Ga0501334_06149 3300049550 Bacteria 805
576 Ga0501334_07415 3300049550 Bacteria 755
577 Ga0501334_10261 3300049550 Bacteria 675
578 Ga0501334_11215 3300049550 Bacteria 655
579 Ga0501334_11544 3300049550 Bacteria 648
580 Ga0501334_17855 3300049550 Bacteria 556
581 Ga0501335_005475 3300049551 Bacteria 1134
582 Ga0501335_007703 3300049551 Bacteria 1000
583 Ga0501335_024288 3300049551 Bacteria 660
584 Ga0501335_034936 3300049551 Bacteria 579
585 Ga0501335_036214 3300049551 Bacteria 571
586 Ga0501335_040272 3300049551 Bacteria 549
587 Ga0501335_041362 3300049551 Bacteria 544
588 Ga0501335_045404 3300049551 Bacteria 526
589 Ga0501336_014187 3300049552 Bacteria 672
590 Ga0501336_020839 3300049552 Bacteria 596
591 Ga0501336_023431 3300049552 Bacteria 574
592 Ga0501337_007801 3300049553 Bacteria 751
593 Ga0501337_008453 3300049553 Bacteria 731
594 Ga0501337_009701 3300049553 Bacteria 694
595 Ga0501337_012083 3300049553 Bacteria 643
596 Ga0501337_015044 3300049553 Bacteria 595
597 Ga0501338_02460 3300049554 Bacteria 1056
598 Ga0501338_04009 3300049554 Bacteria 884
599 Ga0501338_05148 3300049554 Bacteria 806
600 Ga0501338_07580 3300049554 Bacteria 702
601 Ga0501338_08308 3300049554 Bacteria 679
602 Ga0501338_14627 3300049554 Bacteria 554
603 Ga0501338_18970 3300049554 Bacteria 506
604 Ga0501340_003564 3300049556 Bacteria 950
605 Ga0501340_007562 3300049556 Bacteria 751
606 Ga0501340_011652 3300049556 Bacteria 658
607 Ga0501340_023682 3300049556 Bacteria 528
608 Ga0501041_0346837 3300049577 Bacteria 938
609 Ga0501071_1482414 3300049587 Bacteria 524
610 Ga0501072_1466400 3300049588 Bacteria 527
611 Ga0501208_090222 3300049655 Bacteria 643
612 Ga0501217_113167 3300049661 Bacteria 781
613 Ga0501227_249114 3300049665 Bacteria 506
614 Ga0501243_119493 3300049675 Bacteria 545
615 Ga0501252_062523 3300049682 Bacteria 585
616 Ga0501234_046557 3300049707 Bacteria 717
617 Ga0501245_100362 3300049708 Bacteria 586
618 Ga0501245_146298 3300049708 Bacteria 518
619 Ga0501079_0745701 3300049741 Bacteria 771
620 Ga0501278_012389 3300049774 Bacteria 703
621 Ga0501212_021103 3300049851 Bacteria 1008
622 nmdc:mga0qj67_1496047_c1 3300050509 Bacteria 519
623 Ga0500634_0320466 3300053161 Bacteria 605
624 Ga0500645_167784 3300053730 Bacteria 600
625 Ga0587070_135606 3300059491 Bacteria 603
626 Ga0587067_084987 3300059640 Bacteria 707
627 Ga0587072_154891 3300059643 Bacteria 556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2585427687 2586208596 61
2 iso_pu_bacteria 2738541283 2738757182 61
3 iso_pu_bacteria 2738541302 2738853001 61
4 iso_pu_bacteria 2739367651 2739586371 61
5 iso_pu_bacteria 2739367656 2739617756 61
6 iso_pu_bacteria 2739367663 2739644860 61
7 iso_pu_bacteria 2818991437 2819549123 61
8 iso_pu_bacteria 2842722452 2842725627 61
9 iso_pu_bacteria 2842903701 2842903889 61
10 iso_pu_bacteria 2842909656 2842914443 61
11 iso_pu_bacteria 2849281842 2849283015 61
12 iso_pu_bacteria 2945997725 2946001146 61
13 iso_pu_bacteria 2954016120 2954018046 61
14 iso_pu_bacteria 2971410472 2971416569 63
15 3300002987 JGI25159J45721_1010898 JGI25159J45721_10108981 64
16 3300002987 JGI25159J45721_1019285 JGI25159J45721_10192852 64
17 3300003187 JGI25151J46595_10000995 JGI25151J46595_1000099521 64
18 3300003187 JGI25151J46595_10008092 JGI25151J46595_100080926 64
19 3300003187 JGI25151J46595_10017189 JGI25151J46595_100171893 64
20 3300003187 JGI25151J46595_10017353 JGI25151J46595_100173532 64
21 3300003187 JGI25151J46595_10023751 JGI25151J46595_100237513 64
22 3300003187 JGI25151J46595_10052039 JGI25151J46595_100520393 64
23 3300003316 rootH1_10000468 rootH1_1000046817 64
24 3300003316 rootH1_10002180 rootH1_1000218017 64
25 3300003322 rootL2_10056323 rootL2_1005632321 64
26 3300003322 rootL2_10195243 rootL2_101952431 64
27 3300003751 Ga0055538_1000384 Ga0055538_10003841 64
28 3300003758 Ga0055532_1015471 Ga0055532_10154712 64
29 3300003790 Ga0055528_1001866 Ga0055528_100186619 64
30 3300003790 Ga0055528_1017989 Ga0055528_10179893 64
31 3300005262 Ga0065165_1095519 Ga0065165_10955191 64
32 3300005331 Ga0070670_100547616 Ga0070670_1005476161 64
33 3300005333 Ga0070677_10321272 Ga0070677_103212722 64
34 3300005353 Ga0070669_100187705 Ga0070669_1001877051 64
35 3300005354 Ga0070675_100650047 Ga0070675_1006500471 64
36 3300005354 Ga0070675_101303823 Ga0070675_1013038231 64
37 3300005355 Ga0070671_100573741 Ga0070671_1005737412 64
38 3300005355 Ga0070671_100705786 Ga0070671_1007057862 64
39 3300005366 Ga0070659_100204291 Ga0070659_1002042912 64
40 3300005618 Ga0068864_100754058 Ga0068864_1007540582 64
41 3300005840 Ga0068870_10586543 Ga0068870_105865431 64
42 3300006163 Ga0070715_10265694 Ga0070715_102656942 64
43 3300007265 Ga0099794_10056940 Ga0099794_100569403 64
44 3300009011 Ga0105251_10009354 Ga0105251_100093544 64
45 3300009011 Ga0105251_10027444 Ga0105251_100274442 64
46 3300009011 Ga0105251_10065266 Ga0105251_100652662 64
47 3300009011 Ga0105251_10150055 Ga0105251_101500552 64
48 3300009011 Ga0105251_10220100 Ga0105251_102201002 64
49 3300009036 Ga0105244_10033080 Ga0105244_100330802 64
50 3300009036 Ga0105244_10051980 Ga0105244_100519803 64
51 3300009036 Ga0105244_10100296 Ga0105244_101002962 64
52 3300009036 Ga0105244_10108870 Ga0105244_101088702 64
53 3300009036 Ga0105244_10137690 Ga0105244_101376902 64
54 3300009036 Ga0105244_10216786 Ga0105244_102167861 64
55 3300009036 Ga0105244_10506265 Ga0105244_105062651 64
56 3300009092 Ga0105250_10001672 Ga0105250_100016723 64
57 3300009092 Ga0105250_10050740 Ga0105250_100507401 64
58 3300009092 Ga0105250_10061743 Ga0105250_100617433 64
59 3300009092 Ga0105250_10086969 Ga0105250_100869692 64
60 3300009092 Ga0105250_10194057 Ga0105250_101940572 64
61 3300009092 Ga0105250_10244575 Ga0105250_102445752 64
62 3300009092 Ga0105250_10315493 Ga0105250_103154931 64
63 3300009098 Ga0105245_13137182 Ga0105245_131371821 64
64 3300009101 Ga0105247_10044820 Ga0105247_100448203 64
65 3300009147 Ga0114129_11006675 Ga0114129_110066751 64
66 3300009148 Ga0105243_10022074 Ga0105243_100220742 64
67 3300009176 Ga0105242_10051280 Ga0105242_100512802 64
68 3300009176 Ga0105242_10052645 Ga0105242_100526452 64
69 3300009177 Ga0105248_12054350 Ga0105248_120543501 64
70 3300009553 Ga0105249_10722686 Ga0105249_107226861 64
71 3300010375 Ga0105239_10809108 Ga0105239_108091082 64
72 3300010375 Ga0105239_11127562 Ga0105239_111275622 64
73 3300011119 Ga0105246_10000485 Ga0105246_1000048522 64
74 3300011119 Ga0105246_10089462 Ga0105246_100894623 64
75 3300011119 Ga0105246_10107969 Ga0105246_101079692 64
76 3300011119 Ga0105246_10281027 Ga0105246_102810272 64
77 3300013296 Ga0157374_10056360 Ga0157374_100563606 64
78 3300013296 Ga0157374_10937897 Ga0157374_109378972 64
79 3300013297 Ga0157378_10022291 Ga0157378_100222913 64
80 3300013297 Ga0157378_10241627 Ga0157378_102416272 64
81 3300013307 Ga0157372_10681016 Ga0157372_106810162 64
82 3300014745 Ga0157377_10128646 Ga0157377_101286462 64
83 3300025224 Ga0209784_100075 Ga0209784_10007551 64
84 3300025225 Ga0209566_101967 Ga0209566_1019672 64
85 3300025229 Ga0209147_100101 Ga0209147_10010151 64
86 3300025229 Ga0209147_100804 Ga0209147_1008046 64
87 3300025229 Ga0209147_101979 Ga0209147_1019797 64
88 3300025229 Ga0209147_106030 Ga0209147_1060302 64
89 3300025233 Ga0209437_100453 Ga0209437_10045319 64
90 3300025273 Ga0209673_1003112 Ga0209673_10031122 64
91 3300025273 Ga0209673_1025919 Ga0209673_10259192 64
92 3300025284 Ga0209130_1001601 Ga0209130_100160112 64
93 3300025284 Ga0209130_1026007 Ga0209130_10260072 64
94 3300025292 Ga0209676_1065880 Ga0209676_10658801 64
95 3300025294 Ga0209025_1000517 Ga0209025_100051760 64
96 3300025294 Ga0209025_1005366 Ga0209025_10053668 64
97 3300025294 Ga0209025_1008647 Ga0209025_10086473 64
98 3300025294 Ga0209025_1008729 Ga0209025_10087295 64
99 3300025294 Ga0209025_1050381 Ga0209025_10503813 64
100 3300025294 Ga0209025_1109016 Ga0209025_11090161 64
101 3300025294 Ga0209025_1135416 Ga0209025_11354162 64
102 3300025295 Ga0209564_1041980 Ga0209564_10419802 64
103 3300025298 Ga0209050_1029751 Ga0209050_10297512 64
104 3300025302 Ga0207426_1012595 Ga0207426_10125952 64
105 3300025711 Ga0207696_1000759 Ga0207696_100075912 64
106 3300025711 Ga0207696_1005278 Ga0207696_10052782 64
107 3300025728 Ga0207655_1031303 Ga0207655_10313034 64
108 3300025728 Ga0207655_1033182 Ga0207655_10331821 64
109 3300025728 Ga0207655_1074361 Ga0207655_10743612 64
110 3300025728 Ga0207655_1100710 Ga0207655_11007102 64
111 3300025735 Ga0207713_1002533 Ga0207713_100253310 64
112 3300025735 Ga0207713_1021180 Ga0207713_10211804 64
113 3300025735 Ga0207713_1103844 Ga0207713_11038442 64
114 3300025735 Ga0207713_1171541 Ga0207713_11715412 64
115 3300025900 Ga0207710_10106730 Ga0207710_101067301 64
116 3300025908 Ga0207643_10228281 Ga0207643_102282811 64
117 3300025923 Ga0207681_10203798 Ga0207681_102037982 64
118 3300025923 Ga0207681_10522044 Ga0207681_105220442 64
119 3300025925 Ga0207650_10697353 Ga0207650_106973532 64
120 3300025926 Ga0207659_10601039 Ga0207659_106010392 64
121 3300025932 Ga0207690_11122075 Ga0207690_111220751 64
122 3300025934 Ga0207686_10493300 Ga0207686_104933002 64
123 3300025935 Ga0207709_10337117 Ga0207709_103371172 64
124 3300031548 Ga0307408_100020895 Ga0307408_1000208952 64
125 3300031548 Ga0307408_100543009 Ga0307408_1005430091 64
126 3300031995 Ga0307409_101413213 Ga0307409_1014132131 64
127 3300032002 Ga0307416_100045485 Ga0307416_1000454852 64
128 3300032002 Ga0307416_100143998 Ga0307416_1001439982 64
129 3300038443 Ga0395901_0072903 Ga0395901_0072903_579_791 64
130 3300041511 Ga0451855_1918519 Ga0451855_1918519_47_253 64
131 3300042876 Ga0451577_0933433 Ga0451577_0933433_103_303 64
132 3300044658 Ga0466972_0301390 Ga0466972_0301390_120_317 64
133 3300044693 Ga0466961_0170223 Ga0466961_0170223_536_733 64
134 3300044712 Ga0453684_0154297 Ga0453684_0154297_1629_1829 64
135 3300044765 Ga0466970_0466320 Ga0466970_0466320_285_482 64
136 3300045049 Ga0466959_0577989 Ga0466959_0577989_377_574 64
137 3300045976 Ga0466967_2423182 Ga0466967_2423182_296_493 64
138 3300046455 Ga0495603_0022270 Ga0495603_0022270_615_812 64
139 3300046455 Ga0495603_0252353 Ga0495603_0252353_375_572 64
140 3300046474 Ga0495605_0346574 Ga0495605_0346574_166_363 64
141 3300046491 Ga0495584_0165989 Ga0495584_0165989_644_841 64
142 3300046491 Ga0495584_0187701 Ga0495584_0187701_197_394 64
143 3300046492 Ga0495585_0033639 Ga0495585_0033639_1059_1256 64
144 3300046492 Ga0495585_0052367 Ga0495585_0052367_518_715 64
145 3300046518 Ga0495631_0045430 Ga0495631_0045430_1100_1297 64
146 3300046518 Ga0495631_0141199 Ga0495631_0141199_821_1018 64
147 3300046557 Ga0495622_0268125 Ga0495622_0268125_177_374 64
148 3300046616 Ga0495668_0703620 Ga0495668_0703620_70_267 64
149 3300046665 Ga0495661_0145126 Ga0495661_0145126_323_520 64
150 3300046691 Ga0495670_0499077 Ga0495670_0499077_68_265 64
151 3300046794 Ga0495589_0225896 Ga0495589_0225896_252_449 64
152 3300046794 Ga0495589_0356570 Ga0495589_0356570_352_549 64
153 3300047321 Ga0495676_0223928 Ga0495676_0223928_780_977 64
154 3300047321 Ga0495676_0288437 Ga0495676_0288437_786_983 64
155 3300047323 Ga0495683_0016063 Ga0495683_0016063_1650_1847 64
156 3300047323 Ga0495683_0066595 Ga0495683_0066595_296_493 64
157 3300048089 Ga0495614_0115636 Ga0495614_0115636_577_774 64
158 3300048089 Ga0495614_0215910 Ga0495614_0215910_569_766 64
159 3300048091 Ga0495626_0156768 Ga0495626_0156768_541_738 64
160 3300048903 Ga0496100_0000291 Ga0496100_0000291_24815_25012 64
161 3300048903 Ga0496100_0002948 Ga0496100_0002948_4118_4315 64
162 3300048904 Ga0496101_0023551 Ga0496101_0023551_1210_1407 64
163 3300048904 Ga0496101_0263882 Ga0496101_0263882_847_1044 64
164 3300048905 Ga0496102_0010426 Ga0496102_0010426_412_609 64
165 3300048905 Ga0496102_0091916 Ga0496102_0091916_1241_1438 64
166 3300048906 Ga0496103_0007550 Ga0496103_0007550_6008_6205 64
167 3300048906 Ga0496103_0021121 Ga0496103_0021121_3420_3617 64
168 3300048907 Ga0496104_0001238 Ga0496104_0001238_7635_7832 64
169 3300048907 Ga0496104_0001710 Ga0496104_0001710_14940_15137 64
170 3300048908 Ga0496105_0000655 Ga0496105_0000655_14742_14939 64
171 3300048908 Ga0496105_0000827 Ga0496105_0000827_3486_3683 64
172 3300048909 Ga0496106_0012848 Ga0496106_0012848_1437_1634 64
173 3300048909 Ga0496106_0017084 Ga0496106_0017084_4094_4291 64
174 3300048910 Ga0496107_0000296 Ga0496107_0000296_7082_7279 64
175 3300048910 Ga0496107_0000352 Ga0496107_0000352_20591_20788 64
176 3300048911 Ga0496108_0005976 Ga0496108_0005976_8528_8725 64
177 3300048911 Ga0496108_0071598 Ga0496108_0071598_438_635 64
178 3300048912 Ga0496109_0021753 Ga0496109_0021753_4257_4454 64
179 3300048912 Ga0496109_0036427 Ga0496109_0036427_428_625 64
180 3300048913 Ga0496110_0093518 Ga0496110_0093518_1418_1615 64
181 3300048913 Ga0496110_0189345 Ga0496110_0189345_1372_1569 64
182 3300048914 Ga0496111_0024128 Ga0496111_0024128_2083_2280 64
183 3300048914 Ga0496111_0098615 Ga0496111_0098615_403_600 64
184 3300048914 Ga0496111_0576637 Ga0496111_0576637_44_241 64
185 3300048915 Ga0496112_0002110 Ga0496112_0002110_11767_11964 64
186 3300048915 Ga0496112_0106574 Ga0496112_0106574_1437_1634 64
187 3300048916 Ga0496113_0028055 Ga0496113_0028055_3420_3617 64
188 3300048916 Ga0496113_0049705 Ga0496113_0049705_1788_1985 64
189 3300048917 Ga0496114_0669443 Ga0496114_0669443_666_863 64
190 3300048918 Ga0496115_0735610 Ga0496115_0735610_430_627 64
191 3300048919 Ga0496116_0002717 Ga0496116_0002717_4776_4973 64
192 3300048919 Ga0496116_0014479 Ga0496116_0014479_1088_1285 64
193 3300048919 Ga0496116_0048312 Ga0496116_0048312_453_650 64
194 3300048919 Ga0496116_0078423 Ga0496116_0078423_1494_1691 64
195 3300048919 Ga0496116_0107289 Ga0496116_0107289_607_804 64
196 3300048919 Ga0496116_0181560 Ga0496116_0181560_584_781 64
197 3300048919 Ga0496116_0342219 Ga0496116_0342219_444_641 64
198 3300048920 Ga0496117_0012885 Ga0496117_0012885_3777_3974 64
199 3300048921 Ga0496118_0070306 Ga0496118_0070306_265_462 64
200 3300048921 Ga0496118_0085671 Ga0496118_0085671_732_929 64
201 3300048922 Ga0496119_0007723 Ga0496119_0007723_2134_2331 64
202 3300048922 Ga0496119_0047423 Ga0496119_0047423_2053_2250 64
203 3300048923 Ga0496120_0012145 Ga0496120_0012145_1418_1615 64
204 3300048923 Ga0496120_0489252 Ga0496120_0489252_244_441 64
205 3300048924 Ga0496121_0054016 Ga0496121_0054016_2095_2292 64
206 3300048924 Ga0496121_0086698 Ga0496121_0086698_592_789 64
207 3300048924 Ga0496121_0784075 Ga0496121_0784075_31_228 64
208 3300048925 Ga0496122_0003541 Ga0496122_0003541_15061_15258 64
209 3300048925 Ga0496122_0005848 Ga0496122_0005848_312_509 64
210 3300048925 Ga0496122_0114838 Ga0496122_0114838_141_338 64
211 3300048925 Ga0496122_0125266 Ga0496122_0125266_1279_1476 64
212 3300048925 Ga0496122_0315574 Ga0496122_0315574_200_397 64
213 3300048926 Ga0496123_0010099 Ga0496123_0010099_6904_7101 64
214 3300048926 Ga0496123_0498646 Ga0496123_0498646_212_409 64
215 3300048927 Ga0496124_0103024 Ga0496124_0103024_1549_1746 64
216 3300048927 Ga0496124_0300703 Ga0496124_0300703_898_1095 64
217 3300048927 Ga0496124_0589940 Ga0496124_0589940_94_291 64
218 3300048927 Ga0496124_0693278 Ga0496124_0693278_386_583 64
219 3300048928 Ga0496125_0006817 Ga0496125_0006817_7805_8002 64
220 3300048928 Ga0496125_0037225 Ga0496125_0037225_2088_2285 64
221 3300048929 Ga0496126_0031949 Ga0496126_0031949_2555_2752 64
222 3300048929 Ga0496126_0076002 Ga0496126_0076002_1461_1658 64
223 3300049127 Ga0501306_029234 Ga0501306_029234_517_714 64
224 3300049161 Ga0501305_001129 Ga0501305_001129_2079_2276 64
225 3300049527 Ga0501311_003131 Ga0501311_003131_97_294 64
226 3300049528 Ga0501312_001813 Ga0501312_001813_97_294 64
227 3300049531 Ga0501315_084435 Ga0501315_084435_250_447 64
228 3300049539 Ga0501323_004873 Ga0501323_004873_1147_1344 64
229 3300049540 Ga0501324_034340 Ga0501324_034340_267_464 64
230 3300049551 Ga0501335_045404 Ga0501335_045404_279_476 64
231 3300049577 Ga0501041_0346837 Ga0501041_0346837_549_746 64
232 3300049587 Ga0501071_1482414 Ga0501071_1482414_315_512 64
233 3300049588 Ga0501072_1466400 Ga0501072_1466400_154_351 64
234 3300049661 Ga0501217_113167 Ga0501217_113167_185_382 64
235 3300049741 Ga0501079_0745701 Ga0501079_0745701_21_218 64
236 3300059640 Ga0587067_084987 Ga0587067_084987_58_255 64
237 3300059643 Ga0587072_154891 Ga0587072_154891_312_509 64
238 3300002773 JGI25152J39213_1000867 JGI25152J39213_100086710 65
239 3300002774 JGI25150J39212_1000008 JGI25150J39212_100000890 65
240 3300002987 JGI25159J45721_1002854 JGI25159J45721_10028543 65
241 3300002987 JGI25159J45721_1028602 JGI25159J45721_10286021 65
242 3300003187 JGI25151J46595_10000009 JGI25151J46595_1000000948 65
243 3300003187 JGI25151J46595_10000014 JGI25151J46595_1000001490 65
244 3300003187 JGI25151J46595_10001946 JGI25151J46595_100019462 65
245 3300003187 JGI25151J46595_10002449 JGI25151J46595_100024495 65
246 3300003187 JGI25151J46595_10005677 JGI25151J46595_100056771 65
247 3300003187 JGI25151J46595_10014184 JGI25151J46595_100141843 65
248 3300003187 JGI25151J46595_10018872 JGI25151J46595_100188724 65
249 3300003215 JGI25153J46596_10000020 JGI25153J46596_1000002090 65
250 3300003578 Ga0006562J51391_1000133 Ga0006562J51391_10001336 65
251 3300003758 Ga0055532_1000088 Ga0055532_100008820 65
252 3300003758 Ga0055532_1007874 Ga0055532_10078742 65
253 3300003781 Ga0055536_1000226 Ga0055536_10002265 65
254 3300003781 Ga0055536_1036255 Ga0055536_10362552 65
255 3300003791 Ga0055530_10003368 Ga0055530_100033685 65
256 3300003791 Ga0055530_10122690 Ga0055530_101226901 65
257 3300005288 Ga0065714_10081440 Ga0065714_100814402 65
258 3300005341 Ga0070691_11033150 Ga0070691_110331501 65
259 3300005353 Ga0070669_100916458 Ga0070669_1009164581 65
260 3300005435 Ga0070714_100791651 Ga0070714_1007916512 65
261 3300005445 Ga0070708_101104958 Ga0070708_1011049582 65
262 3300005467 Ga0070706_101091224 Ga0070706_1010912241 65
263 3300005616 Ga0068852_100948308 Ga0068852_1009483082 65
264 3300005841 Ga0068863_101537555 Ga0068863_1015375552 65
265 3300006163 Ga0070715_11057505 Ga0070715_110575052 65
266 3300006847 Ga0075431_100869435 Ga0075431_1008694352 65
267 3300006847 Ga0075431_101090811 Ga0075431_1010908112 65
268 3300009011 Ga0105251_10147559 Ga0105251_101475592 65
269 3300009036 Ga0105244_10050015 Ga0105244_100500152 65
270 3300009092 Ga0105250_10000972 Ga0105250_1000097218 65
271 3300009147 Ga0114129_12004420 Ga0114129_120044202 65
272 3300009148 Ga0105243_12781938 Ga0105243_127819381 65
273 3300009545 Ga0105237_10004656 Ga0105237_100046569 65
274 3300013102 Ga0157371_10003000 Ga0157371_1000300018 65
275 3300013104 Ga0157370_10000207 Ga0157370_1000020710 65
276 3300013104 Ga0157370_10018370 Ga0157370_100183705 65
277 3300013104 Ga0157370_10019227 Ga0157370_100192275 65
278 3300013104 Ga0157370_11289423 Ga0157370_112894231 65
279 3300013105 Ga0157369_10000071 Ga0157369_1000007124 65
280 3300013105 Ga0157369_11616035 Ga0157369_116160352 65
281 3300013307 Ga0157372_10877555 Ga0157372_108775551 65
282 3300013308 Ga0157375_12821651 Ga0157375_128216511 65
283 3300014497 Ga0182008_10001007 Ga0182008_1000100713 65
284 3300015261 Ga0182006_1000218 Ga0182006_100021845 65
285 3300015261 Ga0182006_1000332 Ga0182006_100033216 65
286 3300015262 Ga0182007_10000006 Ga0182007_10000006295 65
287 3300015682 Ga0183373_1001 Ga0183373_10011136 65
288 3300017792 Ga0163161_10000309 Ga0163161_100003095 65
289 3300017792 Ga0163161_10000394 Ga0163161_1000039413 65
290 3300017792 Ga0163161_10001366 Ga0163161_1000136614 65
291 3300017792 Ga0163161_10004577 Ga0163161_100045779 65
292 3300017792 Ga0163161_10036311 Ga0163161_100363115 65
293 3300017792 Ga0163161_10247121 Ga0163161_102471212 65
294 3300025225 Ga0209566_100163 Ga0209566_10016316 65
295 3300025229 Ga0209147_100058 Ga0209147_10005819 65
296 3300025229 Ga0209147_101577 Ga0209147_1015776 65
297 3300025229 Ga0209147_103674 Ga0209147_1036741 65
298 3300025229 Ga0209147_107772 Ga0209147_1077722 65
299 3300025245 Ga0207425_1000007 Ga0207425_100000785 65
300 3300025258 Ga0209129_1000006 Ga0209129_100000685 65
301 3300025284 Ga0209130_1000339 Ga0209130_100033933 65
302 3300025284 Ga0209130_1005233 Ga0209130_10052332 65
303 3300025284 Ga0209130_1061687 Ga0209130_10616871 65
304 3300025292 Ga0209676_1000090 Ga0209676_100009035 65
305 3300025292 Ga0209676_1002149 Ga0209676_100214917 65
306 3300025294 Ga0209025_1000001 Ga0209025_10000011994 65
307 3300025294 Ga0209025_1000089 Ga0209025_100008987 65
308 3300025294 Ga0209025_1000448 Ga0209025_100044869 65
309 3300025294 Ga0209025_1001072 Ga0209025_100107212 65
310 3300025294 Ga0209025_1002054 Ga0209025_100205413 65
311 3300025294 Ga0209025_1002063 Ga0209025_100206321 65
312 3300025294 Ga0209025_1003433 Ga0209025_10034334 65
313 3300025294 Ga0209025_1020338 Ga0209025_10203381 65
314 3300025294 Ga0209025_1028431 Ga0209025_10284312 65
315 3300025294 Ga0209025_1038582 Ga0209025_10385823 65
316 3300025294 Ga0209025_1072334 Ga0209025_10723342 65
317 3300025294 Ga0209025_1106974 Ga0209025_11069742 65
318 3300025297 Ga0209758_1000016 Ga0209758_100001685 65
319 3300025298 Ga0209050_1000091 Ga0209050_100009135 65
320 3300025711 Ga0207696_1000957 Ga0207696_100095713 65
321 3300025711 Ga0207696_1006172 Ga0207696_10061725 65
322 3300025711 Ga0207696_1014863 Ga0207696_10148631 65
323 3300025711 Ga0207696_1064745 Ga0207696_10647451 65
324 3300025728 Ga0207655_1002615 Ga0207655_10026154 65
325 3300025728 Ga0207655_1073849 Ga0207655_10738492 65
326 3300025728 Ga0207655_1087716 Ga0207655_10877161 65
327 3300025728 Ga0207655_1088728 Ga0207655_10887282 65
328 3300025735 Ga0207713_1028893 Ga0207713_10288933 65
329 3300025735 Ga0207713_1133394 Ga0207713_11333942 65
330 3300025735 Ga0207713_1257845 Ga0207713_12578452 65
331 3300025900 Ga0207710_10455497 Ga0207710_104554971 65
332 3300025914 Ga0207671_10011917 Ga0207671_100119178 65
333 3300025923 Ga0207681_11318323 Ga0207681_113183231 65
334 3300026035 Ga0207703_11460158 Ga0207703_114601582 65
335 3300026095 Ga0207676_11449038 Ga0207676_114490381 65
336 3300026142 Ga0207698_11568204 Ga0207698_115682041 65
337 3300027312 Ga0209371_1023695 Ga0209371_10236954 65
338 3300028666 Ga0265336_10050893 Ga0265336_100508933 65
339 3300030083 Ga0237817_10116 Ga0237817_1011622 65
340 3300030083 Ga0237817_10185 Ga0237817_101852 65
341 3300030083 Ga0237817_10225 Ga0237817_1022515 65
342 3300030500 Ga0268256_1026858 Ga0268256_10268582 65
343 3300030731 Ga0316177_1077413 Ga0316177_10774139 65
344 3300030732 Ga0316176_1040115 Ga0316176_104011560 65
345 3300030733 Ga0314311_1138905 Ga0314311_11389052 65
346 3300030742 Ga0316183_1058968 Ga0316183_105896813 65
347 3300030744 Ga0316181_1195464 Ga0316181_11954644 65
348 3300030744 Ga0316181_1278082 Ga0316181_12780822 65
349 3300030745 Ga0316182_1070017 Ga0316182_10700172 65
350 3300031548 Ga0307408_100029296 Ga0307408_1000292963 65
351 3300031548 Ga0307408_100494431 Ga0307408_1004944312 65
352 3300031548 Ga0307408_100789827 Ga0307408_1007898271 65
353 3300031731 Ga0307405_10000012 Ga0307405_1000001218 65
354 3300031731 Ga0307405_11060768 Ga0307405_110607681 65
355 3300031731 Ga0307405_11961522 Ga0307405_119615222 65
356 3300031852 Ga0307410_11893244 Ga0307410_118932441 65
357 3300031901 Ga0307406_11153987 Ga0307406_111539872 65
358 3300031903 Ga0307407_10000038 Ga0307407_100000381 65
359 3300031903 Ga0307407_10964945 Ga0307407_109649451 65
360 3300031911 Ga0307412_10103523 Ga0307412_101035232 65
361 3300031911 Ga0307412_10597100 Ga0307412_105971002 65
362 3300031995 Ga0307409_100018796 Ga0307409_1000187962 65
363 3300031995 Ga0307409_100088814 Ga0307409_1000888144 65
364 3300031995 Ga0307409_100130985 Ga0307409_1001309852 65
365 3300031995 Ga0307409_101193913 Ga0307409_1011939131 65
366 3300032002 Ga0307416_100000007 Ga0307416_1000000071 65
367 3300032002 Ga0307416_100030544 Ga0307416_1000305443 65
368 3300032002 Ga0307416_100152940 Ga0307416_1001529403 65
369 3300032002 Ga0307416_101133367 Ga0307416_1011333672 65
370 3300032002 Ga0307416_101352499 Ga0307416_1013524991 65
371 3300032004 Ga0307414_10202896 Ga0307414_102028962 65
372 3300032168 Ga0316593_10178595 Ga0316593_101785951 65
373 3300037312 Ga0395899_0481788 Ga0395899_0481788_569_769 65
374 3300037466 Ga0395898_0411741 Ga0395898_0411741_983_1219 65
375 3300037466 Ga0395898_0977656 Ga0395898_0977656_193_393 65
376 3300037466 Ga0395898_1379592 Ga0395898_1379592_389_589 65
377 3300037466 Ga0395898_1504428 Ga0395898_1504428_278_478 65
378 3300038443 Ga0395901_1285939 Ga0395901_1285939_399_599 65
379 3300038443 Ga0395901_1669199 Ga0395901_1669199_112_348 65
380 3300038705 Ga0237819_00033 Ga0237819_00033_36149_36352 65
381 3300038705 Ga0237819_00069 Ga0237819_00069_19050_19253 65
382 3300038705 Ga0237819_00222 Ga0237819_00222_17280_17483 65
383 3300041441 Ga0451787_150981 Ga0451787_150981_90_290 65
384 3300041443 Ga0451789_0488552 Ga0451789_0488552_126_323 65
385 3300044658 Ga0466972_0337291 Ga0466972_0337291_193_393 65
386 3300044712 Ga0453684_0000797 Ga0453684_0000797_100689_100898 65
387 3300044712 Ga0453684_0072937 Ga0453684_0072937_1625_1828 65
388 3300044712 Ga0453684_0147397 Ga0453684_0147397_867_1076 65
389 3300045051 Ga0451576_0184301 Ga0451576_0184301_847_1047 65
390 3300045051 Ga0451576_0682827 Ga0451576_0682827_186_386 65
391 3300045976 Ga0466967_0000150 Ga0466967_0000150_18910_19110 65
392 3300045976 Ga0466967_0085795 Ga0466967_0085795_774_977 65
393 3300045976 Ga0466967_0323350 Ga0466967_0323350_190_390 65
394 3300046453 Ga0495627_189492 Ga0495627_189492_328_525 65
395 3300046472 Ga0495580_0919818 Ga0495580_0919818_28_237 65
396 3300046474 Ga0495605_0172769 Ga0495605_0172769_473_673 65
397 3300046499 Ga0495594_0626071 Ga0495594_0626071_65_265 65
398 3300046501 Ga0495607_0458796 Ga0495607_0458796_321_521 65
399 3300046512 Ga0495610_0000060 Ga0495610_0000060_2102_2299 65
400 3300046512 Ga0495610_0017632 Ga0495610_0017632_2104_2301 65
401 3300046520 Ga0495637_0348827 Ga0495637_0348827_174_374 65
402 3300046538 Ga0495609_0114665 Ga0495609_0114665_460_657 65
403 3300046542 Ga0495597_0252399 Ga0495597_0252399_31_231 65
404 3300046542 Ga0495597_0262800 Ga0495597_0262800_18_218 65
405 3300046557 Ga0495622_0033765 Ga0495622_0033765_420_620 65
406 3300046557 Ga0495622_0195864 Ga0495622_0195864_538_738 65
407 3300046558 Ga0495633_0230786 Ga0495633_0230786_442_639 65
408 3300046558 Ga0495633_0349195 Ga0495633_0349195_43_240 65
409 3300046665 Ga0495661_0096745 Ga0495661_0096745_1108_1308 65
410 3300046665 Ga0495661_0426606 Ga0495661_0426606_167_367 65
411 3300046691 Ga0495670_0765073 Ga0495670_0765073_28_228 65
412 3300046794 Ga0495589_0016929 Ga0495589_0016929_653_853 65
413 3300047470 Ga0495681_0204614 Ga0495681_0204614_424_621 65
414 3300048904 Ga0496101_0560757 Ga0496101_0560757_335_535 65
415 3300048905 Ga0496102_0096109 Ga0496102_0096109_156_356 65
416 3300048905 Ga0496102_0335245 Ga0496102_0335245_380_580 65
417 3300048905 Ga0496102_1039593 Ga0496102_1039593_68_271 65
418 3300048905 Ga0496102_1365013 Ga0496102_1365013_201_401 65
419 3300048906 Ga0496103_0272074 Ga0496103_0272074_195_395 65
420 3300048906 Ga0496103_1044118 Ga0496103_1044118_218_418 65
421 3300048909 Ga0496106_0856241 Ga0496106_0856241_115_315 65
422 3300048909 Ga0496106_1177276 Ga0496106_1177276_124_324 65
423 3300048909 Ga0496106_1185455 Ga0496106_1185455_215_415 65
424 3300048910 Ga0496107_0346649 Ga0496107_0346649_141_341 65
425 3300048910 Ga0496107_0356117 Ga0496107_0356117_151_351 65
426 3300048913 Ga0496110_0135677 Ga0496110_0135677_1485_1688 65
427 3300048913 Ga0496110_0525592 Ga0496110_0525592_42_242 65
428 3300048913 Ga0496110_1664651 Ga0496110_1664651_297_500 65
429 3300048914 Ga0496111_1317364 Ga0496111_1317364_177_416 65
430 3300048915 Ga0496112_0204457 Ga0496112_0204457_1523_1723 65
431 3300048917 Ga0496114_0983038 Ga0496114_0983038_259_462 65
432 3300048918 Ga0496115_0874403 Ga0496115_0874403_155_355 65
433 3300048919 Ga0496116_0004309 Ga0496116_0004309_6599_6799 65
434 3300048920 Ga0496117_0562349 Ga0496117_0562349_94_291 65
435 3300048923 Ga0496120_0254003 Ga0496120_0254003_276_476 65
436 3300048925 Ga0496122_0000041 Ga0496122_0000041_181338_181538 65
437 3300048925 Ga0496122_0001846 Ga0496122_0001846_26063_26260 65
438 3300048925 Ga0496122_0141277 Ga0496122_0141277_178_378 65
439 3300048926 Ga0496123_0002062 Ga0496123_0002062_1954_2151 65
440 3300048928 Ga0496125_0296042 Ga0496125_0296042_480_680 65
441 3300048929 Ga0496126_0001264 Ga0496126_0001264_24815_25015 65
442 3300048929 Ga0496126_1122022 Ga0496126_1122022_43_246 65
443 3300049127 Ga0501306_022650 Ga0501306_022650_543_743 65
444 3300049127 Ga0501306_066841 Ga0501306_066841_96_296 65
445 3300049127 Ga0501306_091474 Ga0501306_091474_187_387 65
446 3300049128 Ga0501308_018014 Ga0501308_018014_531_731 65
447 3300049128 Ga0501308_041116 Ga0501308_041116_289_489 65
448 3300049128 Ga0501308_045061 Ga0501308_045061_293_493 65
449 3300049128 Ga0501308_074506 Ga0501308_074506_187_387 65
450 3300049129 Ga0501309_051234 Ga0501309_051234_142_342 65
451 3300049129 Ga0501309_060125 Ga0501309_060125_75_275 65
452 3300049129 Ga0501309_068602 Ga0501309_068602_230_430 65
453 3300049129 Ga0501309_088196 Ga0501309_088196_190_390 65
454 3300049130 Ga0501310_028539 Ga0501310_028539_141_341 65
455 3300049130 Ga0501310_039124 Ga0501310_039124_293_493 65
456 3300049130 Ga0501310_042666 Ga0501310_042666_275_475 65
457 3300049130 Ga0501310_044026 Ga0501310_044026_139_339 65
458 3300049131 Ga0501341_02594 Ga0501341_02594_750_950 65
459 3300049131 Ga0501341_07426 Ga0501341_07426_324_524 65
460 3300049131 Ga0501341_08197 Ga0501341_08197_152_352 65
461 3300049131 Ga0501341_13250 Ga0501341_13250_141_341 65
462 3300049131 Ga0501341_14847 Ga0501341_14847_211_411 65
463 3300049132 Ga0501343_004310 Ga0501343_004310_727_927 65
464 3300049132 Ga0501343_012692 Ga0501343_012692_340_540 65
465 3300049132 Ga0501343_013953 Ga0501343_013953_147_347 65
466 3300049132 Ga0501343_020553 Ga0501343_020553_115_315 65
467 3300049132 Ga0501343_022700 Ga0501343_022700_62_262 65
468 3300049132 Ga0501343_024544 Ga0501343_024544_218_439 65
469 3300049133 Ga0501344_01950 Ga0501344_01950_708_908 65
470 3300049133 Ga0501344_03700 Ga0501344_03700_327_527 65
471 3300049133 Ga0501344_07041 Ga0501344_07041_302_502 65
472 3300049133 Ga0501344_10959 Ga0501344_10959_132_332 65
473 3300049134 Ga0501345_01406 Ga0501345_01406_592_792 65
474 3300049134 Ga0501345_03833 Ga0501345_03833_297_497 65
475 3300049160 Ga0501304_014418 Ga0501304_014418_141_341 65
476 3300049160 Ga0501304_017582 Ga0501304_017582_307_507 65
477 3300049160 Ga0501304_021743 Ga0501304_021743_135_335 65
478 3300049161 Ga0501305_001192 Ga0501305_001192_188_388 65
479 3300049161 Ga0501305_012428 Ga0501305_012428_825_1025 65
480 3300049161 Ga0501305_016385 Ga0501305_016385_145_345 65
481 3300049161 Ga0501305_030730 Ga0501305_030730_240_440 65
482 3300049161 Ga0501305_045837 Ga0501305_045837_139_339 65
483 3300049161 Ga0501305_081101 Ga0501305_081101_215_415 65
484 3300049161 Ga0501305_117485 Ga0501305_117485_121_321 65
485 3300049162 Ga0501307_027013 Ga0501307_027013_399_599 65
486 3300049162 Ga0501307_029146 Ga0501307_029146_419_619 65
487 3300049162 Ga0501307_041820 Ga0501307_041820_308_508 65
488 3300049163 Ga0501342_02295 Ga0501342_02295_330_530 65
489 3300049163 Ga0501342_04017 Ga0501342_04017_49_249 65
490 3300049513 Ga0501290_037886 Ga0501290_037886_154_354 65
491 3300049523 Ga0501300_057544 Ga0501300_057544_341_541 65
492 3300049527 Ga0501311_018971 Ga0501311_018971_469_669 65
493 3300049527 Ga0501311_034666 Ga0501311_034666_294_494 65
494 3300049527 Ga0501311_055595 Ga0501311_055595_268_468 65
495 3300049527 Ga0501311_072220 Ga0501311_072220_247_447 65
496 3300049527 Ga0501311_073773 Ga0501311_073773_91_291 65
497 3300049528 Ga0501312_004756 Ga0501312_004756_152_352 65
498 3300049528 Ga0501312_012147 Ga0501312_012147_803_1003 65
499 3300049528 Ga0501312_015380 Ga0501312_015380_146_346 65
500 3300049528 Ga0501312_030417 Ga0501312_030417_375_575 65
501 3300049528 Ga0501312_041840 Ga0501312_041840_402_602 65
502 3300049528 Ga0501312_053845 Ga0501312_053845_308_508 65
503 3300049529 Ga0501313_014762 Ga0501313_014762_588_788 65
504 3300049529 Ga0501313_028022 Ga0501313_028022_343_543 65
505 3300049529 Ga0501313_028189 Ga0501313_028189_77_277 65
506 3300049529 Ga0501313_030745 Ga0501313_030745_326_526 65
507 3300049529 Ga0501313_062458 Ga0501313_062458_179_379 65
508 3300049530 Ga0501314_008322 Ga0501314_008322_143_343 65
509 3300049530 Ga0501314_024388 Ga0501314_024388_142_342 65
510 3300049530 Ga0501314_024600 Ga0501314_024600_307_507 65
511 3300049530 Ga0501314_046228 Ga0501314_046228_100_300 65
512 3300049531 Ga0501315_014823 Ga0501315_014823_62_262 65
513 3300049531 Ga0501315_027490 Ga0501315_027490_429_629 65
514 3300049531 Ga0501315_041586 Ga0501315_041586_183_383 65
515 3300049531 Ga0501315_042763 Ga0501315_042763_328_528 65
516 3300049531 Ga0501315_050881 Ga0501315_050881_26_226 65
517 3300049531 Ga0501315_098125 Ga0501315_098125_291_491 65
518 3300049532 Ga0501316_004985 Ga0501316_004985_255_455 65
519 3300049532 Ga0501316_031056 Ga0501316_031056_341_541 65
520 3300049532 Ga0501316_035900 Ga0501316_035900_305_505 65
521 3300049532 Ga0501316_079642 Ga0501316_079642_181_381 65
522 3300049533 Ga0501317_016328 Ga0501317_016328_727_927 65
523 3300049533 Ga0501317_027870 Ga0501317_027870_585_785 65
524 3300049533 Ga0501317_028186 Ga0501317_028186_373_573 65
525 3300049533 Ga0501317_045467 Ga0501317_045467_307_507 65
526 3300049533 Ga0501317_045531 Ga0501317_045531_318_518 65
527 3300049533 Ga0501317_046651 Ga0501317_046651_329_529 65
528 3300049533 Ga0501317_056789 Ga0501317_056789_148_348 65
529 3300049533 Ga0501317_100163 Ga0501317_100163_145_345 65
530 3300049533 Ga0501317_101264 Ga0501317_101264_142_342 65
531 3300049534 Ga0501318_008895 Ga0501318_008895_747_947 65
532 3300049534 Ga0501318_023834 Ga0501318_023834_424_624 65
533 3300049534 Ga0501318_037387 Ga0501318_037387_155_355 65
534 3300049535 Ga0501319_006303 Ga0501319_006303_533_733 65
535 3300049535 Ga0501319_013869 Ga0501319_013869_308_508 65
536 3300049535 Ga0501319_033359 Ga0501319_033359_49_249 65
537 3300049536 Ga0501320_003370 Ga0501320_003370_731_931 65
538 3300049536 Ga0501320_028390 Ga0501320_028390_323_523 65
539 3300049536 Ga0501320_028950 Ga0501320_028950_342_542 65
540 3300049536 Ga0501320_035660 Ga0501320_035660_263_463 65
541 3300049537 Ga0501321_001115 Ga0501321_001115_1777_1977 65
542 3300049537 Ga0501321_028899 Ga0501321_028899_383_583 65
543 3300049537 Ga0501321_034372 Ga0501321_034372_311_511 65
544 3300049537 Ga0501321_074175 Ga0501321_074175_236_436 65
545 3300049537 Ga0501321_080451 Ga0501321_080451_140_340 65
546 3300049538 Ga0501322_010136 Ga0501322_010136_383_583 65
547 3300049538 Ga0501322_014565 Ga0501322_014565_307_507 65
548 3300049538 Ga0501322_015011 Ga0501322_015011_301_501 65
549 3300049538 Ga0501322_022371 Ga0501322_022371_214_414 65
550 3300049539 Ga0501323_008799 Ga0501323_008799_147_347 65
551 3300049539 Ga0501323_016580 Ga0501323_016580_36_236 65
552 3300049539 Ga0501323_024182 Ga0501323_024182_68_268 65
553 3300049539 Ga0501323_040249 Ga0501323_040249_309_509 65
554 3300049539 Ga0501323_051709 Ga0501323_051709_168_368 65
555 3300049540 Ga0501324_006366 Ga0501324_006366_142_342 65
556 3300049540 Ga0501324_012194 Ga0501324_012194_307_507 65
557 3300049540 Ga0501324_020623 Ga0501324_020623_302_502 65
558 3300049541 Ga0501325_004678 Ga0501325_004678_730_930 65
559 3300049541 Ga0501325_025440 Ga0501325_025440_340_540 65
560 3300049541 Ga0501325_045804 Ga0501325_045804_214_414 65
561 3300049542 Ga0501326_02415 Ga0501326_02415_194_394 65
562 3300049542 Ga0501326_05121 Ga0501326_05121_159_359 65
563 3300049542 Ga0501326_09218 Ga0501326_09218_250_450 65
564 3300049542 Ga0501326_12175 Ga0501326_12175_183_383 65
565 3300049543 Ga0501327_00525 Ga0501327_00525_1076_1276 65
566 3300049543 Ga0501327_04273 Ga0501327_04273_124_324 65
567 3300049543 Ga0501327_04558 Ga0501327_04558_519_719 65
568 3300049543 Ga0501327_08558 Ga0501327_08558_151_351 65
569 3300049543 Ga0501327_10501 Ga0501327_10501_334_534 65
570 3300049543 Ga0501327_14431 Ga0501327_14431_146_346 65
571 3300049544 Ga0501328_03259 Ga0501328_03259_511_711 65
572 3300049544 Ga0501328_04710 Ga0501328_04710_146_346 65
573 3300049544 Ga0501328_10646 Ga0501328_10646_127_327 65
574 3300049545 Ga0501329_00588 Ga0501329_00588_133_333 65
575 3300049545 Ga0501329_08450 Ga0501329_08450_289_489 65
576 3300049545 Ga0501329_09124 Ga0501329_09124_328_528 65
577 3300049545 Ga0501329_11035 Ga0501329_11035_129_329 65
578 3300049546 Ga0501330_000757 Ga0501330_000757_1172_1372 65
579 3300049546 Ga0501330_003240 Ga0501330_003240_733_933 65
580 3300049546 Ga0501330_004880 Ga0501330_004880_505_705 65
581 3300049546 Ga0501330_012793 Ga0501330_012793_128_328 65
582 3300049546 Ga0501330_016818 Ga0501330_016818_351_551 65
583 3300049546 Ga0501330_020977 Ga0501330_020977_185_385 65
584 3300049547 Ga0501331_04063 Ga0501331_04063_141_341 65
585 3300049547 Ga0501331_05972 Ga0501331_05972_340_540 65
586 3300049547 Ga0501331_10700 Ga0501331_10700_240_440 65
587 3300049548 Ga0501332_02033 Ga0501332_02033_123_323 65
588 3300049548 Ga0501332_07927 Ga0501332_07927_326_526 65
589 3300049549 Ga0501333_007860 Ga0501333_007860_395_595 65
590 3300049549 Ga0501333_009428 Ga0501333_009428_323_523 65
591 3300049549 Ga0501333_009531 Ga0501333_009531_323_523 65
592 3300049549 Ga0501333_009940 Ga0501333_009940_332_532 65
593 3300049549 Ga0501333_019556 Ga0501333_019556_321_521 65
594 3300049549 Ga0501333_019589 Ga0501333_019589_226_426 65
595 3300049549 Ga0501333_021003 Ga0501333_021003_85_285 65
596 3300049550 Ga0501334_02380 Ga0501334_02380_227_427 65
597 3300049550 Ga0501334_06149 Ga0501334_06149_486_686 65
598 3300049550 Ga0501334_07415 Ga0501334_07415_130_330 65
599 3300049550 Ga0501334_10261 Ga0501334_10261_297_497 65
600 3300049550 Ga0501334_11215 Ga0501334_11215_325_525 65
601 3300049550 Ga0501334_11544 Ga0501334_11544_175_375 65
602 3300049550 Ga0501334_17855 Ga0501334_17855_129_329 65
603 3300049551 Ga0501335_005475 Ga0501335_005475_218_418 65
604 3300049551 Ga0501335_007703 Ga0501335_007703_341_541 65
605 3300049551 Ga0501335_024288 Ga0501335_024288_137_337 65
606 3300049551 Ga0501335_034936 Ga0501335_034936_79_279 65
607 3300049551 Ga0501335_036214 Ga0501335_036214_100_300 65
608 3300049551 Ga0501335_040272 Ga0501335_040272_301_501 65
609 3300049551 Ga0501335_041362 Ga0501335_041362_15_215 65
610 3300049552 Ga0501336_014187 Ga0501336_014187_143_343 65
611 3300049552 Ga0501336_020839 Ga0501336_020839_370_570 65
612 3300049552 Ga0501336_023431 Ga0501336_023431_216_416 65
613 3300049553 Ga0501337_007801 Ga0501337_007801_129_329 65
614 3300049553 Ga0501337_008453 Ga0501337_008453_308_508 65
615 3300049553 Ga0501337_009701 Ga0501337_009701_469_669 65
616 3300049553 Ga0501337_012083 Ga0501337_012083_69_269 65
617 3300049553 Ga0501337_015044 Ga0501337_015044_317_517 65
618 3300049554 Ga0501338_02460 Ga0501338_02460_729_929 65
619 3300049554 Ga0501338_04009 Ga0501338_04009_586_786 65
620 3300049554 Ga0501338_05148 Ga0501338_05148_480_680 65
621 3300049554 Ga0501338_07580 Ga0501338_07580_340_540 65
622 3300049554 Ga0501338_08308 Ga0501338_08308_301_501 65
623 3300049554 Ga0501338_14627 Ga0501338_14627_222_422 65
624 3300049554 Ga0501338_18970 Ga0501338_18970_178_402 65
625 3300049556 Ga0501340_003564 Ga0501340_003564_715_915 65
626 3300049556 Ga0501340_007562 Ga0501340_007562_300_500 65
627 3300049556 Ga0501340_011652 Ga0501340_011652_330_530 65
628 3300049556 Ga0501340_023682 Ga0501340_023682_183_383 65
629 3300049655 Ga0501208_090222 Ga0501208_090222_266_466 65
630 3300049665 Ga0501227_249114 Ga0501227_249114_206_406 65
631 3300049675 Ga0501243_119493 Ga0501243_119493_323_523 65
632 3300049682 Ga0501252_062523 Ga0501252_062523_185_385 65
633 3300049707 Ga0501234_046557 Ga0501234_046557_151_351 65
634 3300049708 Ga0501245_100362 Ga0501245_100362_84_284 65
635 3300049708 Ga0501245_146298 Ga0501245_146298_181_381 65
636 3300049774 Ga0501278_012389 Ga0501278_012389_336_536 65
637 3300049851 Ga0501212_021103 Ga0501212_021103_290_490 65
638 3300050509 nmdc:mga0qj67_1496047_c1 nmdc:mga0qj67_1496047_c1_124_324 65
639 3300053161 Ga0500634_0320466 Ga0500634_0320466_333_530 65
640 3300053730 Ga0500645_167784 Ga0500645_167784_353_550 65
641 3300059491 Ga0587070_135606 Ga0587070_135606_62_265 65

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

15

79

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ktc-assembly1.cif.gz_A crystal structure of ybx1 csd with m5c rna 0.9368 2 62
5ytx-assembly1.cif.gz_A crystal structure of yb1 cold-shock domain in complex with ucaacu 0.9366 2 62
5ytv-assembly1.cif.gz_A crystal structure of yb1 cold-shock domain in complex with ucaucu 0.936 2 62
6a6l-assembly1.cif.gz_A crystal structure of the cold shock domain of yb-1 in complex with m5c rna 0.9359 2 62
1hza-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.9337 1 65
ID Description Score Start End Superfamily
5ytvA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.936 2 62 2.40.50.140
5jx4A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.919 1 65 2.40.50.140
af_P91306_55_138_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9159 2 62 2.40.50.140
2haxB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9135 1 35 2.40.50.140
af_P0A976_2_68_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9076 2 62 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A497YCC2-F1-model_v4 Putative cold-shock DNA-binding protein 1.011 2 65 GO:0003677
GO:0005737
GO:0016020
AF-Q1AWL7-F1-model_v4 Cold-shock DNA-binding protein family 0.9856 2 65 GO:0003677
GO:0005737
AF-A0A1I3AA10-F1-model_v4 Cold-shock DNA-binding protein family 0.9819 1 65 GO:0003677
GO:0005737
AF-A0A838JVN6-F1-model_v4 Cold shock domain-containing protein 0.9802 4 65 GO:0003676
GO:0005737
AF-A0A6G8QF29-F1-model_v4 CSD domain-containing protein 0.98 2 65 GO:0003676
GO:0005737

Feature Viewer

pLDDT pTM Quality
93.9 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map