F471772

General Info

Members Datasets Scaffolds Average Seq Length
641 264 1282 232

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100000895|Ga0075428_10000089518
Length 261
Sequence MSQVSTSSPPSPHPLEALIEEAFERRNEITPANVQTPLFRGLSQILHELNVGKIRVAEKRDGAWVTNQWVKKAVLLYFRTHDNRVMQVEGRDGWFDKVPVRFQGWSDAQFRDGGFRVVPTAIVRSGAFIGRNVVLMPSYVNVHLSGGAGIGGVLEPLQANPTVIEDHCFIGARSEIVEGVIVEAHSVISMGVFIGQSTKIYDRSTGEVLYGRVPSGSVVVPGSLPSADGKYSLSCAVIVKRVDAETRAKTSINELLRLAAP

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
178 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
184 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
199 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
200 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
201 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
202 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.18
Nodule 0
Rhizoplane 1.56
Rhizosphere 95.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100000895 3300006844 Bacteria 31408
2 JGI24736J21556_1015963 3300001904 Bacteria 1199
3 JGI24741J21665_1000979 3300001915 Bacteria 8576
4 JGI24740J21852_10000295 3300001979 Bacteria 21265
5 Ga0055525_1000021 3300003759 Bacteria 370802
6 Ga0065712_10018366 3300005290 Bacteria 2682
7 Ga0065712_10041820 3300005290 Bacteria 1332
8 Ga0065712_10115241 3300005290 Bacteria 1754
9 Ga0065712_10139172 3300005290 Bacteria 1450
10 Ga0065715_10018591 3300005293 Bacteria 2315
11 Ga0065715_10103794 3300005293 Bacteria 2984
12 Ga0065715_10239153 3300005293 Bacteria 1205
13 Ga0065707_10082284 3300005295 Bacteria 17401
14 Ga0065707_10175209 3300005295 Bacteria 1447
15 Ga0065707_10232757 3300005295 Bacteria 1183
16 Ga0070658_10319967 3300005327 Bacteria 1325
17 Ga0070676_10008163 3300005328 Bacteria 5632
18 Ga0070690_100016479 3300005330 Bacteria 4428
19 Ga0070670_100001799 3300005331 Bacteria 17470
20 Ga0070670_100026658 3300005331 Bacteria 4972
21 Ga0070670_100043965 3300005331 Bacteria 3840
22 Ga0070670_100112450 3300005331 Bacteria 2347
23 Ga0070677_10017195 3300005333 Bacteria 2585
24 Ga0070677_10053136 3300005333 Bacteria 1646
25 Ga0068869_100021055 3300005334 Bacteria 4482
26 Ga0068869_100034022 3300005334 Bacteria 3602
27 Ga0068869_100042136 3300005334 Bacteria 3272
28 Ga0068869_100119398 3300005334 Bacteria 2015
29 Ga0070666_10016507 3300005335 Bacteria 4723
30 Ga0070666_10044262 3300005335 Bacteria 2981
31 Ga0070680_100000287 3300005336 Bacteria 33654
32 Ga0070680_100001212 3300005336 Bacteria 18569
33 Ga0070680_100146616 3300005336 Bacteria 1980
34 Ga0070682_100035848 3300005337 Bacteria 3030
35 Ga0070682_100242956 3300005337 Bacteria 1293
36 Ga0070682_100344449 3300005337 Bacteria 1109
37 Ga0068868_100034995 3300005338 Bacteria 3881
38 Ga0068868_100385706 3300005338 Bacteria 1206
39 Ga0070660_100025577 3300005339 Bacteria 4388
40 Ga0070689_100056458 3300005340 Bacteria 3044
41 Ga0070689_100119306 3300005340 Bacteria 2106
42 Ga0070689_100145996 3300005340 Bacteria 1905
43 Ga0070689_100225210 3300005340 Bacteria 1540
44 Ga0070689_100358952 3300005340 Bacteria 1224
45 Ga0070691_10016393 3300005341 Bacteria 3402
46 Ga0070691_10019182 3300005341 Bacteria 3155
47 Ga0070691_10079837 3300005341 Bacteria 1600
48 Ga0070687_100149290 3300005343 Bacteria 1370
49 Ga0070661_100010099 3300005344 Bacteria 6557
50 Ga0070661_100033211 3300005344 Bacteria 3737
51 Ga0070661_100071165 3300005344 Bacteria 2559
52 Ga0070661_100342910 3300005344 Bacteria 1171
53 Ga0070692_10017922 3300005345 Bacteria 3395
54 Ga0070668_100041915 3300005347 Bacteria 3508
55 Ga0070668_100162673 3300005347 Bacteria 1812
56 Ga0070669_100013101 3300005353 Bacteria 5891
57 Ga0070669_100023443 3300005353 Bacteria 4420
58 Ga0070669_100141290 3300005353 Bacteria 1856
59 Ga0070669_100151250 3300005353 Bacteria 1797
60 Ga0070675_100003052 3300005354 Bacteria 12647
61 Ga0070675_100004801 3300005354 Bacteria 10310
62 Ga0070675_100014269 3300005354 Bacteria 6263
63 Ga0070675_100042047 3300005354 Bacteria 3733
64 Ga0070675_100067002 3300005354 Bacteria 2970
65 Ga0070675_100069358 3300005354 Bacteria 2920
66 Ga0070675_100084769 3300005354 Bacteria 2646
67 Ga0070675_100092663 3300005354 Bacteria 2533
68 Ga0070675_100162215 3300005354 Bacteria 1923
69 Ga0070675_100265398 3300005354 Bacteria 1505
70 Ga0070671_100031248 3300005355 Bacteria 4398
71 Ga0070674_100000138 3300005356 Bacteria 33808
72 Ga0070674_100018121 3300005356 Bacteria 4444
73 Ga0070674_100114647 3300005356 Bacteria 1985
74 Ga0070673_100011738 3300005364 Bacteria 5990
75 Ga0070673_100442272 3300005364 Bacteria 1168
76 Ga0070688_100013620 3300005365 Bacteria 4591
77 Ga0070688_100019414 3300005365 Bacteria 3937
78 Ga0070688_100027487 3300005365 Bacteria 3390
79 Ga0070688_100086386 3300005365 Bacteria 2041
80 Ga0070659_100046635 3300005366 Bacteria 3397
81 Ga0070659_100157392 3300005366 Bacteria 1856
82 Ga0070667_100020893 3300005367 Bacteria 5438
83 Ga0070667_100044827 3300005367 Bacteria 3716
84 Ga0070667_100164721 3300005367 Bacteria 1955
85 Ga0070667_100225866 3300005367 Bacteria 1668
86 Ga0070714_100002249 3300005435 Bacteria 14201
87 Ga0070711_100242531 3300005439 Bacteria 1410
88 Ga0070700_100028324 3300005441 Bacteria 3330
89 Ga0070700_100125760 3300005441 Bacteria 1723
90 Ga0070700_100134619 3300005441 Bacteria 1672
91 Ga0070694_100379294 3300005444 Bacteria 1102
92 Ga0070663_100010996 3300005455 Bacteria 5662
93 Ga0070663_100299793 3300005455 Bacteria 1286
94 Ga0070678_100029491 3300005456 Bacteria 3757
95 Ga0070678_100036523 3300005456 Bacteria 3440
96 Ga0070678_100076440 3300005456 Bacteria 2522
97 Ga0070678_100144739 3300005456 Bacteria 1906
98 Ga0070678_100193271 3300005456 Bacteria 1674
99 Ga0070678_100342802 3300005456 Bacteria 1282
100 Ga0070662_100011093 3300005457 Bacteria 5932
101 Ga0070662_100014497 3300005457 Bacteria 5269
102 Ga0070662_100038119 3300005457 Bacteria 3412
103 Ga0070681_10000864 3300005458 Bacteria 25499
104 Ga0070681_10005214 3300005458 Bacteria 12548
105 Ga0070681_10012481 3300005458 Bacteria 8430
106 Ga0070681_10549694 3300005458 Bacteria 1068
107 Ga0068867_100168740 3300005459 Bacteria 1732
108 Ga0068867_100240308 3300005459 Bacteria 1468
109 Ga0070685_10122931 3300005466 Bacteria 1614
110 Ga0070685_10246908 3300005466 Bacteria 1181
111 Ga0070685_10279939 3300005466 Bacteria 1116
112 Ga0070698_100034123 3300005471 Bacteria 5270
113 Ga0070679_100000184 3300005530 Bacteria 50485
114 Ga0070679_100011219 3300005530 Bacteria 8543
115 Ga0070679_100098923 3300005530 Bacteria 2904
116 Ga0070679_100212489 3300005530 Bacteria 1898
117 Ga0070679_100233378 3300005530 Bacteria 1799
118 Ga0070684_100033473 3300005535 Bacteria 4388
119 Ga0068853_100007466 3300005539 Bacteria 8750
120 Ga0070672_100062028 3300005543 Bacteria 2949
121 Ga0070686_100115289 3300005544 Bacteria 1837
122 Ga0070695_100084181 3300005545 Bacteria 2109
123 Ga0070696_100018051 3300005546 Bacteria 4765
124 Ga0070696_100024758 3300005546 Bacteria 4079
125 Ga0070693_100010076 3300005547 Bacteria 4718
126 Ga0070665_100083120 3300005548 Bacteria 3207
127 Ga0070665_100272314 3300005548 Bacteria 1695
128 Ga0068855_100005793 3300005563 Bacteria 15085
129 Ga0068855_100058338 3300005563 Bacteria 4521
130 Ga0068855_100207540 3300005563 Bacteria 2203
131 Ga0070664_100015600 3300005564 Bacteria 6216
132 Ga0070664_100019591 3300005564 Bacteria 5568
133 Ga0070664_100036653 3300005564 Bacteria 4120
134 Ga0070664_100048140 3300005564 Bacteria 3603
135 Ga0070664_100048221 3300005564 Bacteria 3600
136 Ga0070664_100294036 3300005564 Bacteria 1466
137 Ga0068857_100043783 3300005577 Bacteria 3970
138 Ga0068857_100095636 3300005577 Bacteria 2662
139 Ga0068857_100103263 3300005577 Bacteria 2559
140 Ga0068857_100241339 3300005577 Bacteria 1654
141 Ga0068854_100007978 3300005578 Bacteria 6780
142 Ga0068854_100014513 3300005578 Bacteria 5195
143 Ga0068854_100370309 3300005578 Bacteria 1178
144 Ga0068856_100061038 3300005614 Bacteria 3724
145 Ga0068856_100616923 3300005614 Bacteria 1105
146 Ga0070702_100414471 3300005615 Bacteria 967
147 Ga0068852_100028097 3300005616 Bacteria 4598
148 Ga0068852_100045393 3300005616 Bacteria 3737
149 Ga0068852_100102068 3300005616 Bacteria 2591
150 Ga0068852_100422050 3300005616 Bacteria 1316
151 Ga0068859_100043950 3300005617 Bacteria 4490
152 Ga0068859_100060289 3300005617 Bacteria 3823
153 Ga0068859_100069914 3300005617 Bacteria 3546
154 Ga0068859_100830384 3300005617 Bacteria 1011
155 Ga0068864_100088631 3300005618 Bacteria 2726
156 Ga0068864_100146001 3300005618 Bacteria 2138
157 Ga0068861_100122437 3300005719 Bacteria 2100
158 Ga0068861_100389663 3300005719 Bacteria 1233
159 Ga0068851_10027550 3300005834 Bacteria 2801
160 Ga0068870_10004434 3300005840 Bacteria 6045
161 Ga0068870_10072080 3300005840 Bacteria 1887
162 Ga0068870_10114130 3300005840 Bacteria 1547
163 Ga0068863_100004611 3300005841 Bacteria 13576
164 Ga0068863_100014503 3300005841 Bacteria 7589
165 Ga0068858_100021791 3300005842 Bacteria 5986
166 Ga0068858_100084325 3300005842 Bacteria 2956
167 Ga0068860_100123580 3300005843 Bacteria 2480
168 Ga0068860_100294159 3300005843 Bacteria 1589
169 Ga0068862_100017985 3300005844 Bacteria 5888
170 Ga0068862_100047701 3300005844 Bacteria 3656
171 Ga0068862_100106929 3300005844 Bacteria 2453
172 Ga0068862_100518693 3300005844 Bacteria 1134
173 Ga0068862_100541952 3300005844 Bacteria 1110
174 Ga0075368_10051188 3300006042 Bacteria 1642
175 Ga0075364_10197025 3300006051 Bacteria 1365
176 Ga0070712_100088848 3300006175 Bacteria 2259
177 Ga0075362_10010047 3300006177 Bacteria 3682
178 Ga0075366_10000621 3300006195 Bacteria 16666
179 Ga0097621_100047113 3300006237 Bacteria 3491
180 Ga0097621_100102646 3300006237 Bacteria 2408
181 Ga0097621_100369004 3300006237 Bacteria 1280
182 Ga0075370_10019238 3300006353 Bacteria 3717
183 Ga0068871_100031844 3300006358 Bacteria 4161
184 Ga0068871_100111915 3300006358 Bacteria 2297
185 Ga0068871_100181064 3300006358 Bacteria 1811
186 Ga0068871_100339855 3300006358 Bacteria 1325
187 Ga0075428_100016006 3300006844 Bacteria 8294
188 Ga0075428_100026953 3300006844 Bacteria 6365
189 Ga0075428_100035008 3300006844 Bacteria 5536
190 Ga0075430_100008366 3300006846 Bacteria 8739
191 Ga0075430_100013779 3300006846 Bacteria 6888
192 Ga0075430_100058431 3300006846 Bacteria 3242
193 Ga0075431_100006365 3300006847 Bacteria 11721
194 Ga0075431_100017931 3300006847 Bacteria 7200
195 Ga0075431_100068071 3300006847 Bacteria 3674
196 Ga0075431_100223532 3300006847 Bacteria 1920
197 Ga0075431_100417751 3300006847 Bacteria 1341
198 Ga0075433_10000666 3300006852 Bacteria 23239
199 Ga0075433_10001678 3300006852 Bacteria 16484
200 Ga0075433_10011126 3300006852 Bacteria 7237
201 Ga0075434_100000526 3300006871 Bacteria 29136
202 Ga0075434_100069248 3300006871 Bacteria 3518
203 Ga0075429_100010914 3300006880 Bacteria 7859
204 Ga0075429_100015181 3300006880 Bacteria 6676
205 Ga0075429_100130296 3300006880 Bacteria 2200
206 Ga0068865_100035380 3300006881 Bacteria 3358
207 Ga0068865_100041840 3300006881 Bacteria 3120
208 Ga0068865_100053794 3300006881 Bacteria 2794
209 Ga0068865_100181281 3300006881 Bacteria 1622
210 Ga0068865_100189961 3300006881 Bacteria 1588
211 Ga0075436_100039863 3300006914 Bacteria 3241
212 Ga0097620_100043953 3300006931 Bacteria 4490
213 Ga0097620_100060284 3300006931 Bacteria 3823
214 Ga0097620_100069915 3300006931 Bacteria 3546
215 Ga0097620_100830349 3300006931 Bacteria 1011
216 Ga0105240_10067672 3300009093 Bacteria 4427
217 Ga0105240_10074569 3300009093 Bacteria 4188
218 Ga0105240_10092165 3300009093 Bacteria 3700
219 Ga0105240_10246089 3300009093 Bacteria 2071
220 Ga0105240_10320288 3300009093 Bacteria 1768
221 Ga0111539_10000235 3300009094 Bacteria 66044
222 Ga0111539_10020945 3300009094 Bacteria 8050
223 Ga0111539_10032317 3300009094 Bacteria 6356
224 Ga0111539_10079218 3300009094 Bacteria 3864
225 Ga0111539_10083404 3300009094 Bacteria 3759
226 Ga0111539_10566888 3300009094 Bacteria 1322
227 Ga0111539_10705732 3300009094 Bacteria 1174
228 Ga0105245_10726898 3300009098 Bacteria 1027
229 Ga0105247_10006110 3300009101 Bacteria 7486
230 Ga0114129_10012207 3300009147 Bacteria 12222
231 Ga0114129_10053222 3300009147 Bacteria 5677
232 Ga0105243_10128464 3300009148 Bacteria 2147
233 Ga0105242_10039811 3300009176 Bacteria 3784
234 Ga0105248_10027451 3300009177 Bacteria 6338
235 Ga0105248_10267023 3300009177 Bacteria 1926
236 Ga0105237_10033245 3300009545 Bacteria 5225
237 Ga0105237_10133064 3300009545 Bacteria 2481
238 Ga0105249_10138074 3300009553 Bacteria 2335
239 Ga0105249_10453358 3300009553 Bacteria 1322
240 Ga0105249_10927615 3300009553 Bacteria 938
241 Ga0105239_10157333 3300010375 Bacteria 2538
242 Ga0105246_10173713 3300011119 Bacteria 1652
243 Ga0157371_10014254 3300013102 Bacteria 6010
244 Ga0157371_10108313 3300013102 Bacteria 1972
245 Ga0157370_10016115 3300013104 Bacteria 7576
246 Ga0157370_10056649 3300013104 Bacteria 3730
247 Ga0157370_10085541 3300013104 Bacteria 2963
248 Ga0157370_10142723 3300013104 Bacteria 2231
249 Ga0157370_10156143 3300013104 Bacteria 2123
250 Ga0157369_10009102 3300013105 Bacteria 11366
251 Ga0157369_10040972 3300013105 Bacteria 5055
252 Ga0157369_10057704 3300013105 Bacteria 4187
253 Ga0157369_10467011 3300013105 Bacteria 1306
254 Ga0157374_10097989 3300013296 Bacteria 2806
255 Ga0157374_10124943 3300013296 Bacteria 2486
256 Ga0157374_10268129 3300013296 Bacteria 1683
257 Ga0157374_10754541 3300013296 Bacteria 988
258 Ga0157378_10042411 3300013297 Bacteria 4039
259 Ga0163162_10054549 3300013306 Bacteria 4021
260 Ga0163162_10123635 3300013306 Bacteria 2693
261 Ga0157372_10011344 3300013307 Bacteria 9478
262 Ga0157372_10021724 3300013307 Bacteria 6937
263 Ga0157375_10055644 3300013308 Bacteria 3902
264 Ga0157375_10107756 3300013308 Bacteria 2880
265 Ga0157375_10223831 3300013308 Bacteria 2040
266 Ga0157375_10244335 3300013308 Bacteria 1955
267 Ga0163163_10153480 3300014325 Bacteria 2346
268 Ga0163163_10312138 3300014325 Bacteria 1625
269 Ga0157380_10003522 3300014326 Bacteria 10759
270 Ga0157380_10015998 3300014326 Bacteria 5523
271 Ga0157380_10039346 3300014326 Bacteria 3677
272 Ga0157380_10205254 3300014326 Bacteria 1752
273 Ga0157377_10003990 3300014745 Bacteria 6733
274 Ga0157379_10044391 3300014968 Bacteria 3968
275 Ga0157379_10083926 3300014968 Bacteria 2855
276 Ga0157379_10335931 3300014968 Bacteria 1381
277 Ga0157376_10008635 3300014969 Bacteria 7364
278 Ga0157376_10227946 3300014969 Bacteria 1729
279 Ga0157376_10497475 3300014969 Bacteria 1197
280 Ga0163161_10006908 3300017792 Bacteria 7852
281 Ga0163161_10251216 3300017792 Bacteria 1378
282 Ga0206356_11586751 3300020070 Bacteria 991
283 Ga0206354_11397654 3300020081 Bacteria 8777
284 Ga0206353_10296797 3300020082 Bacteria 2146
285 Ga0213872_10000090 3300021361 Bacteria 83813
286 Ga0209563_100005 3300025230 Bacteria 1774893
287 Ga0207697_10001775 3300025315 Bacteria 11568
288 Ga0207656_10018203 3300025321 Bacteria 2762
289 Ga0207656_10062158 3300025321 Bacteria 1641
290 Ga0207682_10008028 3300025893 Bacteria 4192
291 Ga0207682_10010169 3300025893 Bacteria 3692
292 Ga0207682_10011886 3300025893 Bacteria 3400
293 Ga0207682_10013704 3300025893 Bacteria 3157
294 Ga0207682_10024220 3300025893 Bacteria 2402
295 Ga0207710_10012554 3300025900 Bacteria 3565
296 Ga0207688_10001390 3300025901 Bacteria 12582
297 Ga0207680_10034167 3300025903 Bacteria 2907
298 Ga0207680_10078295 3300025903 Bacteria 2070
299 Ga0207680_10103984 3300025903 Bacteria 1830
300 Ga0207647_10001422 3300025904 Bacteria 18347
301 Ga0207699_10432575 3300025906 Bacteria 941
302 Ga0207645_10003224 3300025907 Bacteria 12470
303 Ga0207645_10054630 3300025907 Bacteria 2551
304 Ga0207645_10213351 3300025907 Bacteria 1272
305 Ga0207643_10005757 3300025908 Bacteria 6624
306 Ga0207643_10018149 3300025908 Bacteria 3854
307 Ga0207643_10057528 3300025908 Bacteria 2214
308 Ga0207643_10116218 3300025908 Bacteria 1580
309 Ga0207705_10001662 3300025909 Bacteria 17678
310 Ga0207705_10001681 3300025909 Bacteria 17606
311 Ga0207705_10002398 3300025909 Bacteria 14472
312 Ga0207705_10040809 3300025909 Bacteria 3330
313 Ga0207707_10000070 3300025912 Bacteria 103288
314 Ga0207707_10000167 3300025912 Bacteria 69037
315 Ga0207707_10000572 3300025912 Bacteria 37383
316 Ga0207707_10001575 3300025912 Bacteria 21010
317 Ga0207707_10003912 3300025912 Bacteria 13215
318 Ga0207707_10274874 3300025912 Bacteria 1460
319 Ga0207707_10410289 3300025912 Bacteria 1162
320 Ga0207695_10003211 3300025913 Bacteria 23282
321 Ga0207695_10014436 3300025913 Bacteria 9358
322 Ga0207695_10175661 3300025913 Bacteria 2064
323 Ga0207671_10030564 3300025914 Bacteria 4016
324 Ga0207671_10636800 3300025914 Bacteria 849
325 Ga0207660_10000278 3300025917 Bacteria 33836
326 Ga0207660_10001469 3300025917 Bacteria 15858
327 Ga0207660_10002443 3300025917 Bacteria 12199
328 Ga0207660_10003345 3300025917 Bacteria 10460
329 Ga0207660_10005257 3300025917 Bacteria 8416
330 Ga0207660_10083001 3300025917 Bacteria 2359
331 Ga0207660_10186977 3300025917 Bacteria 1611
332 Ga0207662_10096850 3300025918 Bacteria 1823
333 Ga0207657_10000798 3300025919 Bacteria 33363
334 Ga0207657_10003730 3300025919 Bacteria 16192
335 Ga0207649_10005500 3300025920 Bacteria 6857
336 Ga0207649_10010206 3300025920 Bacteria 5156
337 Ga0207649_10015290 3300025920 Bacteria 4312
338 Ga0207649_10249891 3300025920 Bacteria 1277
339 Ga0207649_10324850 3300025920 Bacteria 1131
340 Ga0207652_10000078 3300025921 Bacteria 106265
341 Ga0207652_10000209 3300025921 Bacteria 61861
342 Ga0207652_10000552 3300025921 Bacteria 37934
343 Ga0207652_10036135 3300025921 Bacteria 4176
344 Ga0207652_10119381 3300025921 Bacteria 2345
345 Ga0207652_10213905 3300025921 Bacteria 1736
346 Ga0207652_10323997 3300025921 Bacteria 1391
347 Ga0207681_10045968 3300025923 Bacteria 2935
348 Ga0207681_10050469 3300025923 Bacteria 2815
349 Ga0207681_10352983 3300025923 Bacteria 1178
350 Ga0207694_10080586 3300025924 Bacteria 2555
351 Ga0207694_10293858 3300025924 Bacteria 1336
352 Ga0207650_10015839 3300025925 Bacteria 5258
353 Ga0207650_10042530 3300025925 Bacteria 3333
354 Ga0207650_10069059 3300025925 Bacteria 2654
355 Ga0207650_10111135 3300025925 Bacteria 2122
356 Ga0207650_10270378 3300025925 Bacteria 1381
357 Ga0207650_10328213 3300025925 Bacteria 1254
358 Ga0207659_10002803 3300025926 Bacteria 10389
359 Ga0207659_10021309 3300025926 Bacteria 4300
360 Ga0207659_10050769 3300025926 Bacteria 2948
361 Ga0207659_10081493 3300025926 Bacteria 2393
362 Ga0207659_10105943 3300025926 Bacteria 2128
363 Ga0207659_10116563 3300025926 Bacteria 2039
364 Ga0207659_10270734 3300025926 Bacteria 1385
365 Ga0207659_10295679 3300025926 Bacteria 1328
366 Ga0207659_10319927 3300025926 Bacteria 1280
367 Ga0207659_10431905 3300025926 Bacteria 1106
368 Ga0207664_10005762 3300025929 Bacteria 8472
369 Ga0207644_10005986 3300025931 Bacteria 7927
370 Ga0207644_10021577 3300025931 Bacteria 4390
371 Ga0207644_10138268 3300025931 Bacteria 1873
372 Ga0207644_10255296 3300025931 Bacteria 1400
373 Ga0207690_10007758 3300025932 Bacteria 6371
374 Ga0207690_10267351 3300025932 Bacteria 1327
375 Ga0207706_10021131 3300025933 Bacteria 5848
376 Ga0207706_10037404 3300025933 Bacteria 4310
377 Ga0207706_10123431 3300025933 Bacteria 2278
378 Ga0207706_10225870 3300025933 Bacteria 1639
379 Ga0207670_10206811 3300025936 Bacteria 1494
380 Ga0207669_10000385 3300025937 Bacteria 19529
381 Ga0207669_10014039 3300025937 Bacteria 4003
382 Ga0207669_10100319 3300025937 Bacteria 1912
383 Ga0207669_10147928 3300025937 Bacteria 1641
384 Ga0207704_10013192 3300025938 Bacteria 4128
385 Ga0207704_10054093 3300025938 Bacteria 2445
386 Ga0207704_10090858 3300025938 Bacteria 2005
387 Ga0207704_10391762 3300025938 Bacteria 1094
388 Ga0207691_10008749 3300025940 Bacteria 9709
389 Ga0207691_10021589 3300025940 Bacteria 6078
390 Ga0207691_10024350 3300025940 Bacteria 5694
391 Ga0207691_10027112 3300025940 Bacteria 5375
392 Ga0207711_10058470 3300025941 Bacteria 3318
393 Ga0207711_10065669 3300025941 Bacteria 3137
394 Ga0207711_10370300 3300025941 Bacteria 1328
395 Ga0207689_10004478 3300025942 Bacteria 12668
396 Ga0207689_10007581 3300025942 Bacteria 9510
397 Ga0207689_10094144 3300025942 Bacteria 2461
398 Ga0207661_10001380 3300025944 Bacteria 16307
399 Ga0207679_10017015 3300025945 Bacteria 4837
400 Ga0207679_10022511 3300025945 Bacteria 4293
401 Ga0207679_10044229 3300025945 Bacteria 3212
402 Ga0207679_10156059 3300025945 Bacteria 1864
403 Ga0207667_10000740 3300025949 Bacteria 42529
404 Ga0207667_10002142 3300025949 Bacteria 24749
405 Ga0207667_10005909 3300025949 Bacteria 14906
406 Ga0207667_10015600 3300025949 Bacteria 8619
407 Ga0207667_10380919 3300025949 Bacteria 1437
408 Ga0207651_10008331 3300025960 Bacteria 5593
409 Ga0207651_10031951 3300025960 Bacteria 3373
410 Ga0207651_10144483 3300025960 Bacteria 1842
411 Ga0207651_10224867 3300025960 Bacteria 1520
412 Ga0207668_10093448 3300025972 Bacteria 2216
413 Ga0207668_10198924 3300025972 Bacteria 1594
414 Ga0207640_10017753 3300025981 Bacteria 4169
415 Ga0207640_10112806 3300025981 Bacteria 1931
416 Ga0207658_10027495 3300025986 Bacteria 3997
417 Ga0207658_10249003 3300025986 Bacteria 1509
418 Ga0207677_10261043 3300026023 Bacteria 1412
419 Ga0207677_10572344 3300026023 Bacteria 987
420 Ga0207703_10016453 3300026035 Bacteria 5767
421 Ga0207703_10128199 3300026035 Bacteria 2187
422 Ga0207639_10000538 3300026041 Bacteria 26056
423 Ga0207639_10001582 3300026041 Bacteria 15289
424 Ga0207639_10010304 3300026041 Bacteria 6470
425 Ga0207639_10190434 3300026041 Bacteria 1752
426 Ga0207678_10001285 3300026067 Bacteria 23199
427 Ga0207678_10002669 3300026067 Bacteria 16192
428 Ga0207678_10048216 3300026067 Bacteria 3682
429 Ga0207678_10096935 3300026067 Bacteria 2520
430 Ga0207678_10312607 3300026067 Bacteria 1351
431 Ga0207708_10008516 3300026075 Bacteria 7593
432 Ga0207708_10130917 3300026075 Bacteria 1961
433 Ga0207702_10010276 3300026078 Bacteria 7841
434 Ga0207702_10068640 3300026078 Bacteria 3046
435 Ga0207702_10087768 3300026078 Bacteria 2716
436 Ga0207641_10015782 3300026088 Bacteria 6188
437 Ga0207641_10144886 3300026088 Bacteria 2147
438 Ga0207648_10012789 3300026089 Bacteria 7841
439 Ga0207648_10101767 3300026089 Bacteria 2517
440 Ga0207648_10291863 3300026089 Bacteria 1460
441 Ga0207676_10033927 3300026095 Bacteria 3861
442 Ga0207676_10036309 3300026095 Bacteria 3748
443 Ga0207676_10048033 3300026095 Bacteria 3311
444 Ga0207674_10000973 3300026116 Bacteria 37480
445 Ga0207674_10019256 3300026116 Bacteria 7398
446 Ga0207674_10030160 3300026116 Bacteria 5705
447 Ga0207674_10052053 3300026116 Bacteria 4177
448 Ga0207674_10059017 3300026116 Bacteria 3884
449 Ga0207674_10157621 3300026116 Bacteria 2225
450 Ga0207674_10400711 3300026116 Bacteria 1326
451 Ga0207675_100004450 3300026118 Bacteria 13541
452 Ga0207675_100016979 3300026118 Bacteria 6802
453 Ga0207675_100084309 3300026118 Bacteria 2982
454 Ga0207675_100093803 3300026118 Bacteria 2824
455 Ga0207675_100291576 3300026118 Bacteria 1587
456 Ga0207683_10005525 3300026121 Bacteria 10832
457 Ga0207683_10040974 3300026121 Bacteria 4043
458 Ga0207683_10043887 3300026121 Bacteria 3908
459 Ga0207683_10108850 3300026121 Bacteria 2480
460 Ga0207683_10113222 3300026121 Bacteria 2430
461 Ga0207683_10483636 3300026121 Bacteria 1143
462 Ga0207683_10599829 3300026121 Bacteria 1019
463 Ga0207698_10004709 3300026142 Bacteria 8344
464 Ga0207698_10011383 3300026142 Bacteria 5767
465 Ga0207698_10037073 3300026142 Bacteria 3587
466 Ga0209983_1008003 3300027665 Bacteria 2161
467 Ga0209974_10018118 3300027876 Bacteria 2335
468 Ga0207428_10003486 3300027907 Bacteria 15254
469 Ga0207428_10007575 3300027907 Bacteria 9896
470 Ga0268266_10527589 3300028379 Bacteria 1129
471 Ga0268265_10088622 3300028380 Bacteria 2466
472 Ga0268265_10098696 3300028380 Bacteria 2353
473 Ga0268265_10300776 3300028380 Bacteria 1444
474 Ga0268264_10117734 3300028381 Bacteria 2337
475 Ga0265334_10000092 3300028573 Bacteria 64246
476 Ga0265336_10000258 3300028666 Bacteria 37749
477 Ga0265324_10000102 3300029957 Bacteria 67780
478 Ga0265332_10007325 3300031238 Bacteria 4990
479 Ga0265328_10003970 3300031239 Bacteria 6503
480 Ga0307513_10011247 3300031456 Bacteria 11139
481 Ga0307513_10019319 3300031456 Bacteria 8115
482 Ga0307513_10038751 3300031456 Bacteria 5290
483 Ga0307513_10051417 3300031456 Bacteria 4446
484 Ga0307513_10068232 3300031456 Bacteria 3726
485 Ga0307513_10191725 3300031456 Bacteria 1895
486 Ga0307408_100156150 3300031548 Bacteria 1807
487 Ga0265313_10000109 3300031595 Bacteria 83136
488 Ga0316576_10199435 3300031727 Bacteria 1508
489 Ga0307410_10173463 3300031852 Bacteria 1627
490 Ga0307412_10189118 3300031911 Bacteria 1555
491 Ga0307415_100135216 3300032126 Bacteria 1874
492 Ga0307510_10332739 3300033180 Bacteria 973
493 Ga0373932_0069240 3300035112 Bacteria 1090
494 Ga0373936_0017415 3300035113 Bacteria 2766
495 Ga0373961_0088259 3300035241 Bacteria 986
496 Ga0395899_0057311 3300037312 Bacteria 2877
497 Ga0395899_0173079 3300037312 Bacteria 1519
498 Ga0395900_0007459 3300037418 Bacteria 11304
499 Ga0395900_0054423 3300037418 Bacteria 4120
500 Ga0395900_0186999 3300037418 Bacteria 2102
501 Ga0395898_0127280 3300037466 Bacteria 2440
502 Ga0395898_0187434 3300037466 Bacteria 1977
503 Ga0395898_0251046 3300037466 Bacteria 1687
504 Ga0395901_0084218 3300038443 Bacteria 3323
505 Ga0395901_0126030 3300038443 Bacteria 2691
506 Ga0436361_0692684 3300039447 Bacteria 133303
507 Ga0436363_0893184 3300039450 Bacteria 6655
508 Ga0451791_1106300 3300041451 Bacteria 2002
509 Ga0451800_1013481 3300041459 Bacteria 1941
510 Ga0451807_0244387 3300041486 Bacteria 2308
511 Ga0451807_0403266 3300041486 Bacteria 3815
512 Ga0451807_0798744 3300041486 Bacteria 3044
513 Ga0439435_0009580 3300042436 Bacteria 2276
514 Ga0439440_0028437 3300042993 Bacteria 1305
515 Ga0451576_0015852 3300045051 Bacteria 8335
516 Ga0451576_0071279 3300045051 Bacteria 3616
517 Ga0451576_0132767 3300045051 Bacteria 2595
518 Ga0495638_0006815 3300046460 Bacteria 8247
519 Ga0495580_0018717 3300046472 Bacteria 5154
520 Ga0495616_0001437 3300046513 Bacteria 16573
521 Ga0495620_0039062 3300046515 Bacteria 2101
522 Ga0495643_0015479 3300046522 Bacteria 4506
523 Ga0495597_0030542 3300046542 Bacteria 2456
524 Ga0495658_0041733 3300046683 Bacteria 2558
525 Ga0495670_0143492 3300046691 Bacteria 1250
526 Ga0495649_0001764 3300046694 Bacteria 15947
527 Ga0495687_000421 3300047443 Bacteria 52470
528 Ga0496104_0131934 3300048907 Bacteria 2400
529 Ga0496106_0541298 3300048909 Bacteria 934
530 Ga0496108_0296184 3300048911 Bacteria 1409
531 Ga0496109_0357124 3300048912 Bacteria 1381
532 Ga0496112_0137412 3300048915 Bacteria 2414
533 Ga0501031_0131639 3300049568 Bacteria 1634
534 Ga0501032_0017357 3300049569 Bacteria 5053
535 Ga0501032_0079853 3300049569 Bacteria 2177
536 Ga0501033_0042690 3300049570 Bacteria 3380
537 Ga0501034_0023539 3300049571 Bacteria 6275
538 Ga0501034_0026673 3300049571 Bacteria 5879
539 Ga0501036_0007228 3300049572 Bacteria 9041
540 Ga0501036_0028770 3300049572 Bacteria 4696
541 Ga0501036_0158996 3300049572 Bacteria 1905
542 Ga0501036_0183820 3300049572 Bacteria 1759
543 Ga0501037_0021870 3300049573 Bacteria 4734
544 Ga0501038_0008443 3300049574 Bacteria 9473
545 Ga0501038_0035688 3300049574 Bacteria 4365
546 Ga0501039_0006220 3300049575 Bacteria 9068
547 Ga0501039_0035256 3300049575 Bacteria 3861
548 Ga0501039_0122338 3300049575 Bacteria 2040
549 Ga0501040_0011885 3300049576 Bacteria 5696
550 Ga0501040_0024671 3300049576 Bacteria 4037
551 Ga0501042_0005950 3300049578 Bacteria 7895
552 Ga0501042_0040246 3300049578 Bacteria 3323
553 Ga0501043_0002789 3300049579 Bacteria 14596
554 Ga0501043_0017566 3300049579 Bacteria 5608
555 Ga0501043_0067945 3300049579 Bacteria 2798
556 Ga0501046_0005391 3300049580 Bacteria 11429
557 Ga0501046_0006584 3300049580 Bacteria 10261
558 Ga0501046_0023515 3300049580 Bacteria 5068
559 Ga0501047_0003093 3300049581 Bacteria 15792
560 Ga0501047_0051024 3300049581 Bacteria 3995
561 Ga0501047_0158107 3300049581 Bacteria 2139
562 Ga0501048_0063593 3300049582 Bacteria 2609
563 Ga0501068_0207167 3300049584 Bacteria 1245
564 Ga0501069_0006017 3300049585 Bacteria 6330
565 Ga0501069_0020030 3300049585 Bacteria 3622
566 Ga0501069_0071996 3300049585 Bacteria 1938
567 Ga0501070_0001603 3300049586 Bacteria 20075
568 Ga0501070_0005247 3300049586 Bacteria 11043
569 Ga0501070_0006663 3300049586 Bacteria 9835
570 Ga0501070_0129325 3300049586 Bacteria 2086
571 Ga0501070_0137287 3300049586 Bacteria 2019
572 Ga0501070_0401613 3300049586 Bacteria 1108
573 Ga0501071_0144018 3300049587 Bacteria 1776
574 Ga0501072_0013411 3300049588 Bacteria 6273
575 Ga0501072_0083428 3300049588 Bacteria 2533
576 Ga0501072_0488162 3300049588 Bacteria 974
577 Ga0501073_0008236 3300049589 Bacteria 7731
578 Ga0501073_0016020 3300049589 Bacteria 5434
579 Ga0501073_0052764 3300049589 Bacteria 2847
580 Ga0501073_0055307 3300049589 Bacteria 2777
581 Ga0501073_0114528 3300049589 Bacteria 1869
582 Ga0501074_0022034 3300049590 Bacteria 4628
583 Ga0501074_0099855 3300049590 Bacteria 2077
584 Ga0501074_0108801 3300049590 Bacteria 1983
585 Ga0501074_0250742 3300049590 Bacteria 1259
586 Ga0501076_0013370 3300049592 Bacteria 6155
587 Ga0501076_0043995 3300049592 Bacteria 3521
588 Ga0501076_0130062 3300049592 Bacteria 2042
589 Ga0501077_0030810 3300049593 Bacteria 3414
590 Ga0501249_023083 3300049679 Bacteria 1364
591 Ga0501080_0014160 3300049742 Bacteria 7340
592 Ga0501080_0025669 3300049742 Bacteria 5472
593 Ga0501080_0035584 3300049742 Bacteria 4647
594 Ga0501080_0234015 3300049742 Bacteria 1679
595 Ga0501081_0001991 3300049743 Bacteria 12740
596 Ga0501083_0004990 3300049744 Bacteria 9407
597 Ga0501083_0162801 3300049744 Bacteria 1459
598 Ga0501035_0017608 3300049822 Bacteria 6592
599 Ga0501035_0019552 3300049822 Bacteria 6223
600 Ga0501035_0147912 3300049822 Bacteria 2039
601 Ga0501035_0335256 3300049822 Bacteria 1268
602 Ga0501044_0019518 3300049823 Bacteria 7248
603 Ga0501044_0089119 3300049823 Bacteria 3114
604 Ga0501044_0125260 3300049823 Bacteria 2567
605 Ga0501044_0180175 3300049823 Bacteria 2080
606 nmdc:mga00v17_284082_c1 3300050491 Bacteria 1074
607 nmdc:mga0k408_731_c1 3300050493 Bacteria 18021
608 nmdc:mga07m45_216302_c1 3300050496 Bacteria 1115
609 nmdc:mga07m45_6216_c1 3300050496 Bacteria 6028
610 nmdc:mga05p37_102275_c1 3300050507 Bacteria 3529
611 nmdc:mga09592_120458_c1 3300050508 Bacteria 2254
612 nmdc:mga09592_162799_c1 3300050508 Bacteria 1927
613 nmdc:mga09592_247056_c1 3300050508 Bacteria 1546
614 nmdc:mga09592_27105_c1 3300050508 Bacteria 4753
615 nmdc:mga09592_34258_c1 3300050508 Bacteria 4245
616 nmdc:mga09592_43057_c1 3300050508 Bacteria 3799
617 nmdc:mga0qj67_23492_c1 3300050509 Bacteria 4745
618 nmdc:mga0qj67_64020_c1 3300050509 Bacteria 2924
619 nmdc:mga06r32_157120_c1 3300050510 Bacteria 2255
620 nmdc:mga06r32_207930_c1 3300050510 Bacteria 1945
621 nmdc:mga06r32_483120_c1 3300050510 Bacteria 1217
622 nmdc:mga08y16_109461_c1 3300050511 Bacteria 2877
623 nmdc:mga08y16_384_c1 3300050511 Bacteria 40430
624 nmdc:mga08y16_57898_c1 3300050511 Bacteria 4049
625 nmdc:mga08y16_60010_c1 3300050511 Bacteria 3973
626 nmdc:mga08y16_7865_c1 3300050511 Bacteria 11162
627 nmdc:mga0n895_2382_c1 3300050512 Bacteria 14655
628 nmdc:mga0rr50_154767_c1 3300050513 Bacteria 1856
629 nmdc:mga0rr50_84185_c1 3300050513 Bacteria 2461
630 nmdc:mga0a205_278679_c1 3300050515 Bacteria 1548
631 nmdc:mga0a205_3569_c1 3300050515 Bacteria 13928
632 nmdc:mga0a205_76_c1 3300050515 Bacteria 54611
633 Ga0500556_0000411 3300053104 Bacteria 31277
634 Ga0500616_0000032 3300053153 Bacteria 403673
635 Ga0500637_0000552 3300053178 Bacteria 14665
636 Ga0501084_0027725 3300054114 Bacteria 4732
637 Ga0501084_0129385 3300054114 Bacteria 2125
638 Ga0501084_0257481 3300054114 Bacteria 1473
639 Ga0501082_0239332 3300060353 Bacteria 1579
640 Ga0501082_0265652 3300060353 Bacteria 1493
641 Ga0530510_0003529 3300061734 Bacteria 10765
642 Ga0075428_100000895
643 JGI24736J21556_1015963
644 JGI24741J21665_1000979
645 JGI24740J21852_10000295
646 Ga0055525_1000021
647 Ga0065712_10018366
648 Ga0065712_10041820
649 Ga0065712_10115241
650 Ga0065712_10139172
651 Ga0065715_10018591
652 Ga0065715_10103794
653 Ga0065715_10239153
654 Ga0065707_10082284
655 Ga0065707_10175209
656 Ga0065707_10232757
657 Ga0070658_10319967
658 Ga0070676_10008163
659 Ga0070690_100016479
660 Ga0070670_100001799
661 Ga0070670_100026658
662 Ga0070670_100043965
663 Ga0070670_100112450
664 Ga0070677_10017195
665 Ga0070677_10053136
666 Ga0068869_100021055
667 Ga0068869_100034022
668 Ga0068869_100042136
669 Ga0068869_100119398
670 Ga0070666_10016507
671 Ga0070666_10044262
672 Ga0070680_100000287
673 Ga0070680_100001212
674 Ga0070680_100146616
675 Ga0070682_100035848
676 Ga0070682_100242956
677 Ga0070682_100344449
678 Ga0068868_100034995
679 Ga0068868_100385706
680 Ga0070660_100025577
681 Ga0070689_100056458
682 Ga0070689_100119306
683 Ga0070689_100145996
684 Ga0070689_100225210
685 Ga0070689_100358952
686 Ga0070691_10016393
687 Ga0070691_10019182
688 Ga0070691_10079837
689 Ga0070687_100149290
690 Ga0070661_100010099
691 Ga0070661_100033211
692 Ga0070661_100071165
693 Ga0070661_100342910
694 Ga0070692_10017922
695 Ga0070668_100041915
696 Ga0070668_100162673
697 Ga0070669_100013101
698 Ga0070669_100023443
699 Ga0070669_100141290
700 Ga0070669_100151250
701 Ga0070675_100003052
702 Ga0070675_100004801
703 Ga0070675_100014269
704 Ga0070675_100042047
705 Ga0070675_100067002
706 Ga0070675_100069358
707 Ga0070675_100084769
708 Ga0070675_100092663
709 Ga0070675_100162215
710 Ga0070675_100265398
711 Ga0070671_100031248
712 Ga0070674_100000138
713 Ga0070674_100018121
714 Ga0070674_100114647
715 Ga0070673_100011738
716 Ga0070673_100442272
717 Ga0070688_100013620
718 Ga0070688_100019414
719 Ga0070688_100027487
720 Ga0070688_100086386
721 Ga0070659_100046635
722 Ga0070659_100157392
723 Ga0070667_100020893
724 Ga0070667_100044827
725 Ga0070667_100164721
726 Ga0070667_100225866
727 Ga0070714_100002249
728 Ga0070711_100242531
729 Ga0070700_100028324
730 Ga0070700_100125760
731 Ga0070700_100134619
732 Ga0070694_100379294
733 Ga0070663_100010996
734 Ga0070663_100299793
735 Ga0070678_100029491
736 Ga0070678_100036523
737 Ga0070678_100076440
738 Ga0070678_100144739
739 Ga0070678_100193271
740 Ga0070678_100342802
741 Ga0070662_100011093
742 Ga0070662_100014497
743 Ga0070662_100038119
744 Ga0070681_10000864
745 Ga0070681_10005214
746 Ga0070681_10012481
747 Ga0070681_10549694
748 Ga0068867_100168740
749 Ga0068867_100240308
750 Ga0070685_10122931
751 Ga0070685_10246908
752 Ga0070685_10279939
753 Ga0070698_100034123
754 Ga0070679_100000184
755 Ga0070679_100011219
756 Ga0070679_100098923
757 Ga0070679_100212489
758 Ga0070679_100233378
759 Ga0070684_100033473
760 Ga0068853_100007466
761 Ga0070672_100062028
762 Ga0070686_100115289
763 Ga0070695_100084181
764 Ga0070696_100018051
765 Ga0070696_100024758
766 Ga0070693_100010076
767 Ga0070665_100083120
768 Ga0070665_100272314
769 Ga0068855_100005793
770 Ga0068855_100058338
771 Ga0068855_100207540
772 Ga0070664_100015600
773 Ga0070664_100019591
774 Ga0070664_100036653
775 Ga0070664_100048140
776 Ga0070664_100048221
777 Ga0070664_100294036
778 Ga0068857_100043783
779 Ga0068857_100095636
780 Ga0068857_100103263
781 Ga0068857_100241339
782 Ga0068854_100007978
783 Ga0068854_100014513
784 Ga0068854_100370309
785 Ga0068856_100061038
786 Ga0068856_100616923
787 Ga0070702_100414471
788 Ga0068852_100028097
789 Ga0068852_100045393
790 Ga0068852_100102068
791 Ga0068852_100422050
792 Ga0068859_100043950
793 Ga0068859_100060289
794 Ga0068859_100069914
795 Ga0068859_100830384
796 Ga0068864_100088631
797 Ga0068864_100146001
798 Ga0068861_100122437
799 Ga0068861_100389663
800 Ga0068851_10027550
801 Ga0068870_10004434
802 Ga0068870_10072080
803 Ga0068870_10114130
804 Ga0068863_100004611
805 Ga0068863_100014503
806 Ga0068858_100021791
807 Ga0068858_100084325
808 Ga0068860_100123580
809 Ga0068860_100294159
810 Ga0068862_100017985
811 Ga0068862_100047701
812 Ga0068862_100106929
813 Ga0068862_100518693
814 Ga0068862_100541952
815 Ga0075368_10051188
816 Ga0075364_10197025
817 Ga0070712_100088848
818 Ga0075362_10010047
819 Ga0075366_10000621
820 Ga0097621_100047113
821 Ga0097621_100102646
822 Ga0097621_100369004
823 Ga0075370_10019238
824 Ga0068871_100031844
825 Ga0068871_100111915
826 Ga0068871_100181064
827 Ga0068871_100339855
828 Ga0075428_100016006
829 Ga0075428_100026953
830 Ga0075428_100035008
831 Ga0075430_100008366
832 Ga0075430_100013779
833 Ga0075430_100058431
834 Ga0075431_100006365
835 Ga0075431_100017931
836 Ga0075431_100068071
837 Ga0075431_100223532
838 Ga0075431_100417751
839 Ga0075433_10000666
840 Ga0075433_10001678
841 Ga0075433_10011126
842 Ga0075434_100000526
843 Ga0075434_100069248
844 Ga0075429_100010914
845 Ga0075429_100015181
846 Ga0075429_100130296
847 Ga0068865_100035380
848 Ga0068865_100041840
849 Ga0068865_100053794
850 Ga0068865_100181281
851 Ga0068865_100189961
852 Ga0075436_100039863
853 Ga0097620_100043953
854 Ga0097620_100060284
855 Ga0097620_100069915
856 Ga0097620_100830349
857 Ga0105240_10067672
858 Ga0105240_10074569
859 Ga0105240_10092165
860 Ga0105240_10246089
861 Ga0105240_10320288
862 Ga0111539_10000235
863 Ga0111539_10020945
864 Ga0111539_10032317
865 Ga0111539_10079218
866 Ga0111539_10083404
867 Ga0111539_10566888
868 Ga0111539_10705732
869 Ga0105245_10726898
870 Ga0105247_10006110
871 Ga0114129_10012207
872 Ga0114129_10053222
873 Ga0105243_10128464
874 Ga0105242_10039811
875 Ga0105248_10027451
876 Ga0105248_10267023
877 Ga0105237_10033245
878 Ga0105237_10133064
879 Ga0105249_10138074
880 Ga0105249_10453358
881 Ga0105249_10927615
882 Ga0105239_10157333
883 Ga0105246_10173713
884 Ga0157371_10014254
885 Ga0157371_10108313
886 Ga0157370_10016115
887 Ga0157370_10056649
888 Ga0157370_10085541
889 Ga0157370_10142723
890 Ga0157370_10156143
891 Ga0157369_10009102
892 Ga0157369_10040972
893 Ga0157369_10057704
894 Ga0157369_10467011
895 Ga0157374_10097989
896 Ga0157374_10124943
897 Ga0157374_10268129
898 Ga0157374_10754541
899 Ga0157378_10042411
900 Ga0163162_10054549
901 Ga0163162_10123635
902 Ga0157372_10011344
903 Ga0157372_10021724
904 Ga0157375_10055644
905 Ga0157375_10107756
906 Ga0157375_10223831
907 Ga0157375_10244335
908 Ga0163163_10153480
909 Ga0163163_10312138
910 Ga0157380_10003522
911 Ga0157380_10015998
912 Ga0157380_10039346
913 Ga0157380_10205254
914 Ga0157377_10003990
915 Ga0157379_10044391
916 Ga0157379_10083926
917 Ga0157379_10335931
918 Ga0157376_10008635
919 Ga0157376_10227946
920 Ga0157376_10497475
921 Ga0163161_10006908
922 Ga0163161_10251216
923 Ga0206356_11586751
924 Ga0206354_11397654
925 Ga0206353_10296797
926 Ga0213872_10000090
927 Ga0209563_100005
928 Ga0207697_10001775
929 Ga0207656_10018203
930 Ga0207656_10062158
931 Ga0207682_10008028
932 Ga0207682_10010169
933 Ga0207682_10011886
934 Ga0207682_10013704
935 Ga0207682_10024220
936 Ga0207710_10012554
937 Ga0207688_10001390
938 Ga0207680_10034167
939 Ga0207680_10078295
940 Ga0207680_10103984
941 Ga0207647_10001422
942 Ga0207699_10432575
943 Ga0207645_10003224
944 Ga0207645_10054630
945 Ga0207645_10213351
946 Ga0207643_10005757
947 Ga0207643_10018149
948 Ga0207643_10057528
949 Ga0207643_10116218
950 Ga0207705_10001662
951 Ga0207705_10001681
952 Ga0207705_10002398
953 Ga0207705_10040809
954 Ga0207707_10000070
955 Ga0207707_10000167
956 Ga0207707_10000572
957 Ga0207707_10001575
958 Ga0207707_10003912
959 Ga0207707_10274874
960 Ga0207707_10410289
961 Ga0207695_10003211
962 Ga0207695_10014436
963 Ga0207695_10175661
964 Ga0207671_10030564
965 Ga0207671_10636800
966 Ga0207660_10000278
967 Ga0207660_10001469
968 Ga0207660_10002443
969 Ga0207660_10003345
970 Ga0207660_10005257
971 Ga0207660_10083001
972 Ga0207660_10186977
973 Ga0207662_10096850
974 Ga0207657_10000798
975 Ga0207657_10003730
976 Ga0207649_10005500
977 Ga0207649_10010206
978 Ga0207649_10015290
979 Ga0207649_10249891
980 Ga0207649_10324850
981 Ga0207652_10000078
982 Ga0207652_10000209
983 Ga0207652_10000552
984 Ga0207652_10036135
985 Ga0207652_10119381
986 Ga0207652_10213905
987 Ga0207652_10323997
988 Ga0207681_10045968
989 Ga0207681_10050469
990 Ga0207681_10352983
991 Ga0207694_10080586
992 Ga0207694_10293858
993 Ga0207650_10015839
994 Ga0207650_10042530
995 Ga0207650_10069059
996 Ga0207650_10111135
997 Ga0207650_10270378
998 Ga0207650_10328213
999 Ga0207659_10002803
1000 Ga0207659_10021309
1001 Ga0207659_10050769
1002 Ga0207659_10081493
1003 Ga0207659_10105943
1004 Ga0207659_10116563
1005 Ga0207659_10270734
1006 Ga0207659_10295679
1007 Ga0207659_10319927
1008 Ga0207659_10431905
1009 Ga0207664_10005762
1010 Ga0207644_10005986
1011 Ga0207644_10021577
1012 Ga0207644_10138268
1013 Ga0207644_10255296
1014 Ga0207690_10007758
1015 Ga0207690_10267351
1016 Ga0207706_10021131
1017 Ga0207706_10037404
1018 Ga0207706_10123431
1019 Ga0207706_10225870
1020 Ga0207670_10206811
1021 Ga0207669_10000385
1022 Ga0207669_10014039
1023 Ga0207669_10100319
1024 Ga0207669_10147928
1025 Ga0207704_10013192
1026 Ga0207704_10054093
1027 Ga0207704_10090858
1028 Ga0207704_10391762
1029 Ga0207691_10008749
1030 Ga0207691_10021589
1031 Ga0207691_10024350
1032 Ga0207691_10027112
1033 Ga0207711_10058470
1034 Ga0207711_10065669
1035 Ga0207711_10370300
1036 Ga0207689_10004478
1037 Ga0207689_10007581
1038 Ga0207689_10094144
1039 Ga0207661_10001380
1040 Ga0207679_10017015
1041 Ga0207679_10022511
1042 Ga0207679_10044229
1043 Ga0207679_10156059
1044 Ga0207667_10000740
1045 Ga0207667_10002142
1046 Ga0207667_10005909
1047 Ga0207667_10015600
1048 Ga0207667_10380919
1049 Ga0207651_10008331
1050 Ga0207651_10031951
1051 Ga0207651_10144483
1052 Ga0207651_10224867
1053 Ga0207668_10093448
1054 Ga0207668_10198924
1055 Ga0207640_10017753
1056 Ga0207640_10112806
1057 Ga0207658_10027495
1058 Ga0207658_10249003
1059 Ga0207677_10261043
1060 Ga0207677_10572344
1061 Ga0207703_10016453
1062 Ga0207703_10128199
1063 Ga0207639_10000538
1064 Ga0207639_10001582
1065 Ga0207639_10010304
1066 Ga0207639_10190434
1067 Ga0207678_10001285
1068 Ga0207678_10002669
1069 Ga0207678_10048216
1070 Ga0207678_10096935
1071 Ga0207678_10312607
1072 Ga0207708_10008516
1073 Ga0207708_10130917
1074 Ga0207702_10010276
1075 Ga0207702_10068640
1076 Ga0207702_10087768
1077 Ga0207641_10015782
1078 Ga0207641_10144886
1079 Ga0207648_10012789
1080 Ga0207648_10101767
1081 Ga0207648_10291863
1082 Ga0207676_10033927
1083 Ga0207676_10036309
1084 Ga0207676_10048033
1085 Ga0207674_10000973
1086 Ga0207674_10019256
1087 Ga0207674_10030160
1088 Ga0207674_10052053
1089 Ga0207674_10059017
1090 Ga0207674_10157621
1091 Ga0207674_10400711
1092 Ga0207675_100004450
1093 Ga0207675_100016979
1094 Ga0207675_100084309
1095 Ga0207675_100093803
1096 Ga0207675_100291576
1097 Ga0207683_10005525
1098 Ga0207683_10040974
1099 Ga0207683_10043887
1100 Ga0207683_10108850
1101 Ga0207683_10113222
1102 Ga0207683_10483636
1103 Ga0207683_10599829
1104 Ga0207698_10004709
1105 Ga0207698_10011383
1106 Ga0207698_10037073
1107 Ga0209983_1008003
1108 Ga0209974_10018118
1109 Ga0207428_10003486
1110 Ga0207428_10007575
1111 Ga0268266_10527589
1112 Ga0268265_10088622
1113 Ga0268265_10098696
1114 Ga0268265_10300776
1115 Ga0268264_10117734
1116 Ga0265334_10000092
1117 Ga0265336_10000258
1118 Ga0265324_10000102
1119 Ga0265332_10007325
1120 Ga0265328_10003970
1121 Ga0307513_10011247
1122 Ga0307513_10019319
1123 Ga0307513_10038751
1124 Ga0307513_10051417
1125 Ga0307513_10068232
1126 Ga0307513_10191725
1127 Ga0307408_100156150
1128 Ga0265313_10000109
1129 Ga0316576_10199435
1130 Ga0307410_10173463
1131 Ga0307412_10189118
1132 Ga0307415_100135216
1133 Ga0307510_10332739
1134 Ga0373932_0069240
1135 Ga0373936_0017415
1136 Ga0373961_0088259
1137 Ga0395899_0057311
1138 Ga0395899_0173079
1139 Ga0395900_0007459
1140 Ga0395900_0054423
1141 Ga0395900_0186999
1142 Ga0395898_0127280
1143 Ga0395898_0187434
1144 Ga0395898_0251046
1145 Ga0395901_0084218
1146 Ga0395901_0126030
1147 Ga0436361_0692684
1148 Ga0436363_0893184
1149 Ga0451791_1106300
1150 Ga0451800_1013481
1151 Ga0451807_0244387
1152 Ga0451807_0403266
1153 Ga0451807_0798744
1154 Ga0439435_0009580
1155 Ga0439440_0028437
1156 Ga0451576_0015852
1157 Ga0451576_0071279
1158 Ga0451576_0132767
1159 Ga0495638_0006815
1160 Ga0495580_0018717
1161 Ga0495616_0001437
1162 Ga0495620_0039062
1163 Ga0495643_0015479
1164 Ga0495597_0030542
1165 Ga0495658_0041733
1166 Ga0495670_0143492
1167 Ga0495649_0001764
1168 Ga0495687_000421
1169 Ga0496104_0131934
1170 Ga0496106_0541298
1171 Ga0496108_0296184
1172 Ga0496109_0357124
1173 Ga0496112_0137412
1174 Ga0501031_0131639
1175 Ga0501032_0017357
1176 Ga0501032_0079853
1177 Ga0501033_0042690
1178 Ga0501034_0023539
1179 Ga0501034_0026673
1180 Ga0501036_0007228
1181 Ga0501036_0028770
1182 Ga0501036_0158996
1183 Ga0501036_0183820
1184 Ga0501037_0021870
1185 Ga0501038_0008443
1186 Ga0501038_0035688
1187 Ga0501039_0006220
1188 Ga0501039_0035256
1189 Ga0501039_0122338
1190 Ga0501040_0011885
1191 Ga0501040_0024671
1192 Ga0501042_0005950
1193 Ga0501042_0040246
1194 Ga0501043_0002789
1195 Ga0501043_0017566
1196 Ga0501043_0067945
1197 Ga0501046_0005391
1198 Ga0501046_0006584
1199 Ga0501046_0023515
1200 Ga0501047_0003093
1201 Ga0501047_0051024
1202 Ga0501047_0158107
1203 Ga0501048_0063593
1204 Ga0501068_0207167
1205 Ga0501069_0006017
1206 Ga0501069_0020030
1207 Ga0501069_0071996
1208 Ga0501070_0001603
1209 Ga0501070_0005247
1210 Ga0501070_0006663
1211 Ga0501070_0129325
1212 Ga0501070_0137287
1213 Ga0501070_0401613
1214 Ga0501071_0144018
1215 Ga0501072_0013411
1216 Ga0501072_0083428
1217 Ga0501072_0488162
1218 Ga0501073_0008236
1219 Ga0501073_0016020
1220 Ga0501073_0052764
1221 Ga0501073_0055307
1222 Ga0501073_0114528
1223 Ga0501074_0022034
1224 Ga0501074_0099855
1225 Ga0501074_0108801
1226 Ga0501074_0250742
1227 Ga0501076_0013370
1228 Ga0501076_0043995
1229 Ga0501076_0130062
1230 Ga0501077_0030810
1231 Ga0501249_023083
1232 Ga0501080_0014160
1233 Ga0501080_0025669
1234 Ga0501080_0035584
1235 Ga0501080_0234015
1236 Ga0501081_0001991
1237 Ga0501083_0004990
1238 Ga0501083_0162801
1239 Ga0501035_0017608
1240 Ga0501035_0019552
1241 Ga0501035_0147912
1242 Ga0501035_0335256
1243 Ga0501044_0019518
1244 Ga0501044_0089119
1245 Ga0501044_0125260
1246 Ga0501044_0180175
1247 nmdc:mga00v17_284082_c1
1248 nmdc:mga0k408_731_c1
1249 nmdc:mga07m45_216302_c1
1250 nmdc:mga07m45_6216_c1
1251 nmdc:mga05p37_102275_c1
1252 nmdc:mga09592_120458_c1
1253 nmdc:mga09592_162799_c1
1254 nmdc:mga09592_247056_c1
1255 nmdc:mga09592_27105_c1
1256 nmdc:mga09592_34258_c1
1257 nmdc:mga09592_43057_c1
1258 nmdc:mga0qj67_23492_c1
1259 nmdc:mga0qj67_64020_c1
1260 nmdc:mga06r32_157120_c1
1261 nmdc:mga06r32_207930_c1
1262 nmdc:mga06r32_483120_c1
1263 nmdc:mga08y16_109461_c1
1264 nmdc:mga08y16_384_c1
1265 nmdc:mga08y16_57898_c1
1266 nmdc:mga08y16_60010_c1
1267 nmdc:mga08y16_7865_c1
1268 nmdc:mga0n895_2382_c1
1269 nmdc:mga0rr50_154767_c1
1270 nmdc:mga0rr50_84185_c1
1271 nmdc:mga0a205_278679_c1
1272 nmdc:mga0a205_3569_c1
1273 nmdc:mga0a205_76_c1
1274 Ga0500556_0000411
1275 Ga0500616_0000032
1276 Ga0500637_0000552
1277 Ga0501084_0027725
1278 Ga0501084_0129385
1279 Ga0501084_0257481
1280 Ga0501082_0239332
1281 Ga0501082_0265652
1282 Ga0530510_0003529

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14805

THDPS_N_2

Tetrahydrodipicolinate N-succinyltransferase N-terminal

14

80

0.98

PF00132

Hexapep

Bacterial transferase hexapeptide (six repeats)

161

196

0.96

PF14602

Hexapep_2

Hexapeptide repeat of succinyl-transferase

161

196

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bw9-assembly1.cif.gz_B crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica 0.9469 117 147
3p47-assembly1.cif.gz_A-2 crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine 0.9375 117 147
7s3u-assembly1.cif.gz_A crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-amino-3,6-dideoxy-d-glucose 0.9224 115 148
4e6u-assembly1.cif.gz_A structure of lpxa from acinetobacter baumannii at 1.4a resolution (p63 form) 0.9203 117 177
6x3c-assembly2.cif.gz_B crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) 0.9146 117 174
ID Description Score Start End Superfamily
1tdtA02 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9072 108 197 2.160.10.10
3fttA00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9014 114 199 2.160.10.10
af_Q86A05_5_191_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8975 115 195 2.160.10.10
1hm8A02 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8931 115 173 2.160.10.10
af_Q58464_37_214_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8891 115 198 2.160.10.10
ID Description Score Start End GO Terms
AF-A0A3D5STC6-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117) 0.9787 123 194 GO:0008666
AF-A0A379SZ96-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase (EC 2.3.1.117) 0.9657 137 202 GO:0008666
AF-K2A529-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase (EC 2.3.1.117) 0.9646 145 213 GO:0008666
AF-A0A2M7X000-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117) 0.963 149 213 GO:0008666
AF-A0A6P1B7Y8-F1-model_v4 deleted 0.9613 113 194

Map