F471739

General Info

Members Datasets Scaffolds Average Seq Length
640 400 615 169

Family's Representative Sequence

Representative Sequence 3300053111|Ga0500572_000250|Ga0500572_000250_3833_4387
Length 184
Sequence VFDAAGRVLQKSVIMDGKLDMKLFGSTLSGHAIRAAGLGAALILSVSAGHAQSGPFAGFNGSWSGNGTVALSDGTTERIRCKASYKVAGANLKQTLQCASDSYKFDLSSDVTSQGDRISGNWSEASRNVNGELQGTAGNGQIEVFVQAAGFAASISLRTNGNKQTVQISSKGEIRGVNITMVKS

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
5 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
6 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
7 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
8 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
9 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
10 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
11 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
12 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
13 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
14 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
15 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
185 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
186 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
187 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
188 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
191 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
212 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
213 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
222 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
223 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
232 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
233 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
234 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
235 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
236 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
247 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
250 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
251 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
252 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
253 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
258 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
259 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
263 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
270 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
273 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
274 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
277 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
282 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
283 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
284 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
292 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
305 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
306 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
307 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
308 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
314 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
315 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
316 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
317 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
318 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
319 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
320 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
321 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
322 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
323 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
324 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
325 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
326 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
329 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
330 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
331 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
332 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
333 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
339 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
340 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
341 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
342 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
343 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
344 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
345 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
346 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
347 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
348 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
349 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
350 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
351 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
352 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
353 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
354 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
355 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
359 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
360 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
361 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
362 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
363 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
364 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
365 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
366 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
367 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
368 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
369 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
370 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
371 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
372 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
373 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
374 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
375 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
376 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
377 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
378 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
379 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
380 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
381 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
382 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
383 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
384 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
385 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
386 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
387 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
388 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
389 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
390 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
391 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
392 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
395 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
396 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
397 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
398 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
399 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
400 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.19
Metatranscriptomes 2.35
Isolates 3.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.31
Nodule 2.34
Rhizoplane 4.38
Rhizosphere 76.41
Stem 0
Stem Tuber 0
Unclassified 6.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10021439 3300001989 Bacteria 2299
2 JGI24735J21928_10034819 3300002067 Bacteria 1483
3 JGI24742J22300_10005518 3300002244 Bacteria 2080
4 JGI25160J50197_1005054 3300003354 Bacteria 5573
5 JGI25404J52841_10000472 3300003659 Bacteria 5781
6 JGI25404J52841_10001192 3300003659 Bacteria 4457
7 JGI25404J52841_10091650 3300003659 Bacteria 636
8 Ga0065165_1031789 3300005262 Bacteria 1663
9 Ga0070670_100414765 3300005331 Bacteria 1190
10 Ga0068869_101153295 3300005334 Bacteria 680
11 Ga0070666_10114566 3300005335 Bacteria 1867
12 Ga0070680_100164333 3300005336 Bacteria 1866
13 Ga0068868_100025999 3300005338 Bacteria 4458
14 Ga0070661_100322318 3300005344 Bacteria 1207
15 Ga0070661_100681741 3300005344 Unclassified 836
16 Ga0070668_100126984 3300005347 Bacteria 2043
17 Ga0070668_100185255 3300005347 Bacteria 1702
18 Ga0070668_100420924 3300005347 Bacteria 1144
19 Ga0070669_100097261 3300005353 Bacteria 2216
20 Ga0070671_100133258 3300005355 Bacteria 2093
21 Ga0070671_100147120 3300005355 Bacteria 1989
22 Ga0070674_100014302 3300005356 Bacteria 4932
23 Ga0070674_100287503 3300005356 Bacteria 1306
24 Ga0070673_100925860 3300005364 Bacteria 809
25 Ga0070659_100137452 3300005366 Bacteria 1988
26 Ga0070667_100496971 3300005367 Bacteria 1118
27 Ga0070667_100690790 3300005367 Bacteria 944
28 Ga0070667_101028885 3300005367 Bacteria 769
29 Ga0070709_10003112 3300005434 Bacteria 8901
30 Ga0070709_10897152 3300005434 Bacteria 701
31 Ga0070714_100007436 3300005435 Bacteria 8525
32 Ga0070713_100033918 3300005436 Bacteria 4094
33 Ga0070710_10002974 3300005437 Bacteria 8047
34 Ga0070711_100005217 3300005439 Bacteria 7750
35 Ga0070700_100223796 3300005441 Bacteria 1335
36 Ga0070663_100021567 3300005455 Bacteria 4288
37 Ga0070663_100065758 3300005455 Bacteria 2625
38 Ga0070663_100104934 3300005455 Bacteria 2114
39 Ga0070663_100165490 3300005455 Bacteria 1705
40 Ga0070663_100450259 3300005455 Bacteria 1061
41 Ga0070678_100242493 3300005456 Bacteria 1508
42 Ga0070662_100034535 3300005457 Bacteria 3566
43 Ga0070681_10691779 3300005458 Bacteria 935
44 Ga0068867_100330967 3300005459 Bacteria 1265
45 Ga0068867_101769664 3300005459 Bacteria 580
46 Ga0070706_100606940 3300005467 Bacteria 1016
47 Ga0070707_100294403 3300005468 Bacteria 1577
48 Ga0070698_100016851 3300005471 Bacteria 7707
49 Ga0070698_100222476 3300005471 Bacteria 1821
50 Ga0070679_100206259 3300005530 Bacteria 1930
51 Ga0070679_100914565 3300005530 Bacteria 821
52 Ga0070697_100090499 3300005536 Bacteria 2529
53 Ga0068853_100413217 3300005539 Bacteria 1264
54 Ga0068853_100500849 3300005539 Bacteria 1147
55 Ga0068853_100580304 3300005539 Bacteria 1064
56 Ga0068853_100657360 3300005539 Unclassified 998
57 Ga0068853_100708305 3300005539 Bacteria 961
58 Ga0068853_100713639 3300005539 Bacteria 957
59 Ga0070686_100079904 3300005544 Bacteria 2162
60 Ga0070686_100177507 3300005544 Bacteria 1511
61 Ga0070665_100247668 3300005548 Bacteria 1782
62 Ga0070665_100318443 3300005548 Bacteria 1559
63 Ga0068855_100016472 3300005563 Bacteria 8888
64 Ga0068855_100016926 3300005563 Bacteria 8767
65 Ga0068855_100017121 3300005563 Bacteria 8719
66 Ga0068855_100031441 3300005563 Bacteria 6338
67 Ga0068855_100111709 3300005563 Bacteria 3137
68 Ga0070664_100155727 3300005564 Bacteria 2019
69 Ga0070664_101178611 3300005564 Unclassified 722
70 Ga0068857_100002567 3300005577 Bacteria 14871
71 Ga0068857_100058887 3300005577 Bacteria 3411
72 Ga0068857_100498540 3300005577 Bacteria 1143
73 Ga0068854_100005650 3300005578 Bacteria 7901
74 Ga0068854_100048779 3300005578 Bacteria 3022
75 Ga0068856_100013475 3300005614 Bacteria 7913
76 Ga0068856_100052415 3300005614 Bacteria 4023
77 Ga0068856_100090447 3300005614 Bacteria 3044
78 Ga0068856_100696942 3300005614 Bacteria 1036
79 Ga0068856_100810441 3300005614 Bacteria 956
80 Ga0070702_100543776 3300005615 Bacteria 861
81 Ga0068852_100027768 3300005616 Bacteria 4618
82 Ga0068852_100112618 3300005616 Bacteria 2476
83 Ga0068852_101137950 3300005616 Bacteria 801
84 Ga0068866_10175774 3300005718 Bacteria 1261
85 Ga0068861_100016647 3300005719 Bacteria 5206
86 Ga0068851_10067598 3300005834 Bacteria 1843
87 Ga0068851_10381156 3300005834 Bacteria 826
88 Ga0068870_10046705 3300005840 Bacteria 2272
89 Ga0068870_10073656 3300005840 Bacteria 1869
90 Ga0068863_100071362 3300005841 Bacteria 3285
91 Ga0068863_100198537 3300005841 Bacteria 1929
92 Ga0068860_100824200 3300005843 Bacteria 942
93 Ga0068862_100086289 3300005844 Bacteria 2728
94 Ga0068862_100124463 3300005844 Bacteria 2275
95 Ga0081538_10042772 3300005981 Bacteria 2853
96 Ga0081540_1002148 3300005983 Bacteria 16397
97 Ga0081540_1003328 3300005983 Bacteria 12745
98 Ga0081540_1011376 3300005983 Bacteria 5950
99 Ga0081540_1014260 3300005983 Bacteria 5104
100 Ga0081540_1016711 3300005983 Bacteria 4575
101 Ga0081540_1069264 3300005983 Bacteria 1640
102 Ga0070717_10302177 3300006028 Bacteria 1423
103 Ga0075365_10006380 3300006038 Bacteria 6485
104 Ga0075365_10206582 3300006038 Bacteria 1376
105 Ga0075368_10037733 3300006042 Bacteria 1890
106 Ga0075363_100000789 3300006048 Bacteria 10928
107 Ga0075364_10195200 3300006051 Bacteria 1371
108 Ga0075364_10215388 3300006051 Bacteria 1303
109 Ga0070715_10100380 3300006163 Bacteria 1349
110 Ga0070716_100010881 3300006173 Bacteria 4575
111 Ga0070716_100166269 3300006173 Bacteria 1435
112 Ga0070716_100174306 3300006173 Unclassified 1406
113 Ga0075362_10160698 3300006177 Bacteria 1082
114 Ga0075362_10207899 3300006177 Bacteria 954
115 Ga0075367_10008506 3300006178 Bacteria 5321
116 Ga0075369_10063102 3300006186 Bacteria 1620
117 Ga0075369_10315230 3300006186 Bacteria 731
118 Ga0075366_10142891 3300006195 Bacteria 1447
119 Ga0075370_10036971 3300006353 Bacteria 2744
120 Ga0075370_10314875 3300006353 Bacteria 932
121 Ga0068871_100227162 3300006358 Bacteria 1619
122 Ga0068871_100587638 3300006358 Bacteria 1012
123 Ga0075428_100394355 3300006844 Bacteria 1484
124 Ga0075434_100007277 3300006871 Bacteria 10239
125 Ga0075434_100365573 3300006871 Bacteria 1464
126 Ga0068865_100541314 3300006881 Bacteria 976
127 Ga0075435_100343275 3300007076 Bacteria 1279
128 Ga0099794_10009233 3300007265 Bacteria 4135
129 Ga0099794_10043047 3300007265 Bacteria 2155
130 Ga0099794_10113386 3300007265 Bacteria 1360
131 Ga0099795_10243642 3300007788 Bacteria 773
132 Ga0105240_10003917 3300009093 Bacteria 22988
133 Ga0105240_10055702 3300009093 Bacteria 4950
134 Ga0105240_10072102 3300009093 Bacteria 4270
135 Ga0111539_11152256 3300009094 Bacteria 901
136 Ga0105245_10206288 3300009098 Bacteria 1890
137 Ga0105247_10388744 3300009101 Bacteria 991
138 Ga0105247_10645119 3300009101 Bacteria 790
139 Ga0105243_10408740 3300009148 Bacteria 1263
140 Ga0105243_11039984 3300009148 Bacteria 824
141 Ga0105241_10002672 3300009174 Bacteria 13361
142 Ga0105241_10012909 3300009174 Bacteria 6129
143 Ga0105241_10540860 3300009174 Bacteria 1044
144 Ga0105248_10132082 3300009177 Bacteria 2817
145 Ga0105237_10033420 3300009545 Bacteria 5210
146 Ga0105237_10157755 3300009545 Bacteria 2266
147 Ga0105237_10270532 3300009545 Bacteria 1702
148 Ga0105237_10336991 3300009545 Bacteria 1513
149 Ga0105237_10375552 3300009545 Bacteria 1426
150 Ga0105238_10011847 3300009551 Bacteria 8783
151 Ga0105238_10043500 3300009551 Bacteria 4544
152 Ga0105238_10117620 3300009551 Bacteria 2638
153 Ga0105238_10135849 3300009551 Bacteria 2436
154 Ga0105238_10207742 3300009551 Bacteria 1934
155 Ga0105238_10953115 3300009551 Bacteria 878
156 Ga0105249_11337409 3300009553 Bacteria 788
157 Ga0099796_10050507 3300010159 Bacteria 1442
158 Ga0105239_10005731 3300010375 Bacteria 14500
159 Ga0105239_10118596 3300010375 Bacteria 2937
160 Ga0105239_10152059 3300010375 Bacteria 2583
161 Ga0105239_10202910 3300010375 Bacteria 2222
162 Ga0105239_11173993 3300010375 Bacteria 884
163 Ga0105246_10018834 3300011119 Bacteria 4402
164 Ga0105246_10120812 3300011119 Bacteria 1941
165 Ga0157341_1000853 3300012494 Bacteria 1685
166 Ga0157370_10195235 3300013104 Bacteria 1879
167 Ga0157370_10731622 3300013104 Bacteria 902
168 Ga0157369_10004254 3300013105 Bacteria 16952
169 Ga0157369_10321336 3300013105 Bacteria 1609
170 Ga0157369_10324636 3300013105 Bacteria 1600
171 Ga0157378_10178208 3300013297 Bacteria 1998
172 Ga0157378_10353806 3300013297 Bacteria 1435
173 Ga0157378_10687754 3300013297 Bacteria 1041
174 Ga0157378_11764968 3300013297 Bacteria 666
175 Ga0163162_10599638 3300013306 Bacteria 1228
176 Ga0163162_10627786 3300013306 Bacteria 1199
177 Ga0157372_10072697 3300013307 Bacteria 3876
178 Ga0157372_11133771 3300013307 Bacteria 904
179 Ga0157375_10244925 3300013308 Bacteria 1953
180 Ga0157375_11089005 3300013308 Bacteria 935
181 Ga0163163_10211478 3300014325 Bacteria 1989
182 Ga0157380_10053042 3300014326 Bacteria 3213
183 Ga0157380_10181823 3300014326 Bacteria 1848
184 Ga0182008_10482588 3300014497 Bacteria 679
185 Ga0157376_10425805 3300014969 Bacteria 1289
186 Ga0157376_10743192 3300014969 Bacteria 989
187 Ga0163161_10271495 3300017792 Bacteria 1327
188 Ga0206349_1461959 3300020075 Bacteria 731
189 Ga0206352_10796597 3300020078 Bacteria 723
190 Ga0206350_10048311 3300020080 Bacteria 602
191 Ga0206354_10396399 3300020081 Bacteria 828
192 Ga0154015_1510599 3300020610 Bacteria 1059
193 Ga0213873_10009607 3300021358 Bacteria 2014
194 Ga0213873_10096041 3300021358 Bacteria 847
195 Ga0213874_10196572 3300021377 Bacteria 724
196 Ga0213876_10002980 3300021384 Bacteria 9807
197 Ga0213875_10176625 3300021388 Bacteria 1003
198 Ga0213875_10511004 3300021388 Bacteria 578
199 Ga0213871_10025594 3300021441 Bacteria 1503
200 Ga0224712_10103731 3300022467 Bacteria 1210
201 Ga0224712_10300031 3300022467 Bacteria 751
202 Ga0209758_1000011 3300025297 Bacteria 1049685
203 Ga0209758_1004160 3300025297 Bacteria 12329
204 Ga0209051_1066476 3300025303 Bacteria 1107
205 Ga0207697_10085541 3300025315 Bacteria 1332
206 Ga0207656_10250066 3300025321 Bacteria 868
207 Ga0207692_10025911 3300025898 Bacteria 2746
208 Ga0207692_10291534 3300025898 Bacteria 990
209 Ga0207710_10009512 3300025900 Bacteria 4088
210 Ga0207710_10034072 3300025900 Bacteria 2236
211 Ga0207647_10003198 3300025904 Bacteria 12279
212 Ga0207699_10000204 3300025906 Bacteria 35531
213 Ga0207699_10946293 3300025906 Bacteria 636
214 Ga0207645_10040688 3300025907 Bacteria 2976
215 Ga0207645_10263742 3300025907 Bacteria 1141
216 Ga0207645_10377158 3300025907 Bacteria 952
217 Ga0207643_10011042 3300025908 Bacteria 4874
218 Ga0207684_10092912 3300025910 Bacteria 2572
219 Ga0207654_10024350 3300025911 Bacteria 3254
220 Ga0207654_10034013 3300025911 Bacteria 2829
221 Ga0207695_10000424 3300025913 Bacteria 93657
222 Ga0207695_10012405 3300025913 Bacteria 10234
223 Ga0207695_10149175 3300025913 Bacteria 2279
224 Ga0207695_10385302 3300025913 Bacteria 1287
225 Ga0207671_10079659 3300025914 Bacteria 2455
226 Ga0207671_10129439 3300025914 Bacteria 1936
227 Ga0207671_10170922 3300025914 Bacteria 1688
228 Ga0207693_10028299 3300025915 Bacteria 4428
229 Ga0207663_10024044 3300025916 Bacteria 3506
230 Ga0207660_10709395 3300025917 Bacteria 821
231 Ga0207649_10268370 3300025920 Bacteria 1236
232 Ga0207652_10171583 3300025921 Bacteria 1946
233 Ga0207652_10231775 3300025921 Bacteria 1664
234 Ga0207646_10175749 3300025922 Bacteria 1934
235 Ga0207681_10552068 3300025923 Bacteria 948
236 Ga0207681_10747233 3300025923 Bacteria 815
237 Ga0207694_10000119 3300025924 Bacteria 83771
238 Ga0207694_10060044 3300025924 Bacteria 2958
239 Ga0207694_10079907 3300025924 Bacteria 2566
240 Ga0207650_10249368 3300025925 Bacteria 1437
241 Ga0207700_10009772 3300025928 Bacteria 6015
242 Ga0207664_10704221 3300025929 Bacteria 908
243 Ga0207644_10088691 3300025931 Bacteria 2301
244 Ga0207690_10424637 3300025932 Bacteria 1064
245 Ga0207706_10343491 3300025933 Bacteria 1298
246 Ga0207706_10550529 3300025933 Bacteria 993
247 Ga0207686_10457169 3300025934 Bacteria 983
248 Ga0207709_10700204 3300025935 Bacteria 811
249 Ga0207669_10058015 3300025937 Bacteria 2360
250 Ga0207704_10063870 3300025938 Bacteria 2297
251 Ga0207704_10336993 3300025938 Bacteria 1169
252 Ga0207665_10002479 3300025939 Bacteria 12444
253 Ga0207665_10216788 3300025939 Unclassified 1401
254 Ga0207691_10540647 3300025940 Bacteria 988
255 Ga0207711_10254250 3300025941 Bacteria 1614
256 Ga0207689_10038611 3300025942 Bacteria 3954
257 Ga0207689_10325483 3300025942 Bacteria 1276
258 Ga0207679_10319723 3300025945 Bacteria 1343
259 Ga0207679_11081388 3300025945 Unclassified 736
260 Ga0207667_10008027 3300025949 Bacteria 12593
261 Ga0207667_10057455 3300025949 Bacteria 4084
262 Ga0207651_10053509 3300025960 Bacteria 2760
263 Ga0207651_11451177 3300025960 Bacteria 618
264 Ga0207668_10022936 3300025972 Bacteria 4002
265 Ga0207668_10585561 3300025972 Bacteria 970
266 Ga0207640_10006001 3300025981 Bacteria 6638
267 Ga0207658_10590830 3300025986 Bacteria 997
268 Ga0207703_10058819 3300026035 Bacteria 3138
269 Ga0207703_10485271 3300026035 Bacteria 1158
270 Ga0207639_10009164 3300026041 Bacteria 6822
271 Ga0207639_10090472 3300026041 Bacteria 2448
272 Ga0207639_10207692 3300026041 Bacteria 1684
273 Ga0207639_10602948 3300026041 Bacteria 1013
274 Ga0207639_11594870 3300026041 Bacteria 612
275 Ga0207678_10039602 3300026067 Bacteria 4090
276 Ga0207678_10057735 3300026067 Bacteria 3340
277 Ga0207678_10146825 3300026067 Bacteria 2013
278 Ga0207702_10000002 3300026078 Bacteria 491507
279 Ga0207702_10007362 3300026078 Bacteria 9400
280 Ga0207702_10163454 3300026078 Bacteria 2035
281 Ga0207702_10380415 3300026078 Bacteria 1357
282 Ga0207702_10813991 3300026078 Bacteria 924
283 Ga0207641_10962871 3300026088 Bacteria 849
284 Ga0207648_10150855 3300026089 Bacteria 2051
285 Ga0207676_10064094 3300026095 Bacteria 2921
286 Ga0207676_10825961 3300026095 Bacteria 905
287 Ga0207674_10001403 3300026116 Bacteria 31095
288 Ga0207674_10003336 3300026116 Bacteria 19740
289 Ga0207674_10490379 3300026116 Bacteria 1187
290 Ga0207675_100446579 3300026118 Bacteria 1281
291 Ga0207683_10088488 3300026121 Bacteria 2755
292 Ga0207683_10165671 3300026121 Bacteria 1999
293 Ga0207698_10114018 3300026142 Bacteria 2272
294 Ga0207698_10404562 3300026142 Bacteria 1305
295 Ga0207698_10430350 3300026142 Bacteria 1269
296 Ga0209179_1001160 3300027512 Bacteria 3099
297 Ga0209588_1002049 3300027671 Bacteria 5439
298 Ga0207428_10423596 3300027907 Bacteria 973
299 Ga0268266_10007641 3300028379 Bacteria 9722
300 Ga0268266_10204944 3300028379 Bacteria 1806
301 Ga0268265_10164205 3300028380 Bacteria 1890
302 Ga0268265_10346076 3300028380 Bacteria 1355
303 Ga0268264_10298325 3300028381 Bacteria 1516
304 Ga0268264_10300312 3300028381 Bacteria 1511
305 Ga0268264_10824206 3300028381 Bacteria 928
306 Ga0265337_1015924 3300028556 Bacteria 2446
307 Ga0265319_1015825 3300028563 Bacteria 2909
308 Ga0265323_10001015 3300028653 Bacteria 14625
309 Ga0265322_10031044 3300028654 Bacteria 1525
310 Ga0265336_10001855 3300028666 Bacteria 9171
311 Ga0265338_10000034 3300028800 Bacteria 244623
312 Ga0265324_10010129 3300029957 Bacteria 3651
313 Ga0265762_1070772 3300030760 Bacteria 732
314 Ga0265760_10128597 3300031090 Bacteria 818
315 Ga0307509_10100629 3300031507 Bacteria 2928
316 Ga0307408_100336685 3300031548 Bacteria 1276
317 Ga0307508_10099082 3300031616 Bacteria 2508
318 Ga0265314_10025180 3300031711 Bacteria 4495
319 Ga0265314_10042546 3300031711 Bacteria 3239
320 Ga0265342_10007437 3300031712 Bacteria 8014
321 Ga0307405_10698304 3300031731 Bacteria 840
322 Ga0307412_10163237 3300031911 Bacteria 1658
323 Ga0307416_101129291 3300032002 Bacteria 889
324 Ga0307414_10150456 3300032004 Bacteria 1836
325 Ga0307415_100643805 3300032126 Bacteria 949
326 Ga0373934_0025224 3300035086 Bacteria 2301
327 Ga0373934_0154505 3300035086 Bacteria 940
328 Ga0373923_0055492 3300035111 Bacteria 1670
329 Ga0373936_0130961 3300035113 Bacteria 1078
330 Ga0373945_0165776 3300035116 Bacteria 903
331 Ga0373954_0010657 3300035118 Bacteria 4061
332 Ga0373954_0017973 3300035118 Bacteria 3179
333 Ga0373956_0015069 3300035119 Bacteria 3232
334 Ga0373956_0099609 3300035119 Bacteria 1347
335 Ga0373957_0031050 3300035120 Bacteria 1961
336 Ga0373957_0040807 3300035120 Bacteria 1746
337 Ga0373943_0011977 3300035170 Bacteria 3904
338 Ga0373943_0024541 3300035170 Bacteria 2812
339 Ga0373943_0524697 3300035170 Bacteria 693
340 Ga0373946_0365309 3300035171 Bacteria 724
341 Ga0373955_0061075 3300035172 Bacteria 2080
342 Ga0373955_0076606 3300035172 Bacteria 1881
343 Ga0373924_0031931 3300035410 Bacteria 2119
344 Ga0373924_0243713 3300035410 Bacteria 795
345 Ga0373931_0019175 3300035691 Bacteria 3411
346 Ga0373935_0194267 3300035692 Bacteria 1399
347 Ga0373927_0006061 3300035695 Bacteria 8282
348 Ga0373927_0075982 3300035695 Bacteria 2175
349 Ga0373933_0184492 3300035724 Bacteria 1331
350 Ga0373933_0272238 3300035724 Bacteria 1093
351 Ga0373933_0311232 3300035724 Bacteria 1020
352 Ga0373947_0050666 3300035725 Bacteria 2496
353 Ga0373947_0110591 3300035725 Bacteria 1736
354 Ga0373947_0213873 3300035725 Bacteria 1265
355 Ga0310104_04734 3300036242 Bacteria 1170
356 Ga0373937_0043093 3300036401 Bacteria 4118
357 Ga0373937_0155095 3300036401 Bacteria 2146
358 Ga0373937_1555718 3300036401 Unclassified 609
359 Ga0310112_026682 3300036458 Bacteria 798
360 Ga0372808_003072 3300036459 Bacteria 2006
361 Ga0310109_024891 3300036534 Bacteria 803
362 Ga0373925_0345754 3300037068 Bacteria 1207
363 Ga0373925_0886400 3300037068 Bacteria 735
364 Ga0395899_0634775 3300037312 Bacteria 677
365 Ga0395900_0000948 3300037418 Bacteria 37848
366 Ga0395898_0206345 3300037466 Bacteria 1875
367 Ga0395905_0035185 3300037471 Bacteria 4703
368 Ga0395901_0029080 3300038443 Bacteria 5686
369 Ga0436365_0109261 3300039437 Bacteria 1781
370 Ga0436365_0740383 3300039437 Bacteria 1374
371 Ga0436365_1835761 3300039437 Bacteria 36188
372 Ga0436360_0550228 3300039438 Bacteria 1305
373 Ga0436360_0854373 3300039438 Bacteria 900
374 Ga0436361_0467457 3300039447 Bacteria 1237
375 Ga0436361_1014259 3300039447 Bacteria 17383
376 Ga0436362_0006141 3300039453 Bacteria 2231
377 Ga0436362_0643370 3300039453 Bacteria 691
378 Ga0436362_1206035 3300039453 Bacteria 2834
379 Ga0451797_1308170 3300041453 Bacteria 755
380 Ga0451802_2006855 3300041460 Bacteria 973
381 Ga0451807_1787443 3300041486 Bacteria 2661
382 Ga0466965_0505153 3300044683 Bacteria 678
383 Ga0466966_0199086 3300044684 Bacteria 1212
384 Ga0466963_0058718 3300044694 Bacteria 2566
385 Ga0466963_0204280 3300044694 Bacteria 1382
386 Ga0466968_0194455 3300044735 Bacteria 948
387 Ga0466960_0036093 3300044901 Bacteria 2314
388 Ga0466959_0115625 3300045049 Bacteria 1911
389 Ga0466967_0500724 3300045976 Bacteria 1192
390 Ga0466967_0564662 3300045976 Bacteria 1121
391 Ga0495627_026739 3300046453 Bacteria 1858
392 Ga0495592_0009399 3300046454 Bacteria 7352
393 Ga0495603_0023365 3300046455 Bacteria 3742
394 Ga0495603_0177930 3300046455 Bacteria 1231
395 Ga0495603_0795587 3300046455 Bacteria 539
396 Ga0495590_0266702 3300046457 Bacteria 639
397 Ga0495629_0083386 3300046459 Bacteria 2231
398 Ga0495638_0181682 3300046460 Bacteria 1200
399 Ga0495638_0217040 3300046460 Bacteria 1071
400 Ga0495641_0024865 3300046461 Bacteria 2948
401 Ga0495651_0043105 3300046462 Bacteria 3501
402 Ga0495651_0050423 3300046462 Bacteria 3211
403 Ga0495653_0022987 3300046463 Bacteria 5042
404 Ga0495650_0167220 3300046471 Bacteria 780
405 Ga0495580_0125990 3300046472 Bacteria 1777
406 Ga0495605_0078489 3300046474 Bacteria 1547
407 Ga0495639_0015742 3300046475 Bacteria 3280
408 Ga0495639_0097446 3300046475 Bacteria 1385
409 Ga0495664_0069929 3300046477 Bacteria 2095
410 Ga0495584_0254153 3300046491 Bacteria 893
411 Ga0495585_0119329 3300046492 Bacteria 1396
412 Ga0495594_0162800 3300046499 Bacteria 1268
413 Ga0495594_0484849 3300046499 Bacteria 702
414 Ga0495596_0150727 3300046500 Bacteria 903
415 Ga0495607_0058223 3300046501 Bacteria 2210
416 Ga0495583_0086754 3300046506 Bacteria 1353
417 Ga0495583_0257622 3300046506 Bacteria 698
418 Ga0495608_0015773 3300046511 Bacteria 5228
419 Ga0495616_0096142 3300046513 Bacteria 1395
420 Ga0495616_0310745 3300046513 Bacteria 664
421 Ga0495618_0071700 3300046514 Bacteria 2204
422 Ga0495628_0022019 3300046516 Bacteria 5238
423 Ga0495628_0345834 3300046516 Bacteria 1094
424 Ga0495630_0379938 3300046517 Bacteria 1082
425 Ga0495630_0509393 3300046517 Bacteria 923
426 Ga0495631_0015826 3300046518 Bacteria 3606
427 Ga0495631_0146989 3300046518 Bacteria 1011
428 Ga0495637_0173892 3300046520 Bacteria 802
429 Ga0495644_0049465 3300046523 Bacteria 1578
430 Ga0495644_0092261 3300046523 Bacteria 1143
431 Ga0495648_0260888 3300046524 Bacteria 831
432 Ga0495663_0033759 3300046525 Bacteria 1529
433 Ga0495642_0220839 3300046528 Bacteria 827
434 Ga0495652_0248543 3300046529 Bacteria 1319
435 Ga0495654_0226690 3300046530 Bacteria 788
436 Ga0495665_0021120 3300046531 Bacteria 3497
437 Ga0495665_0151436 3300046531 Bacteria 1211
438 Ga0495640_0095959 3300046533 Bacteria 1951
439 Ga0495586_0189702 3300046535 Bacteria 1164
440 Ga0495587_0069857 3300046536 Bacteria 2044
441 Ga0495598_0008239 3300046537 Bacteria 2419
442 Ga0495609_0149835 3300046538 Bacteria 992
443 Ga0495621_0070013 3300046539 Bacteria 1290
444 Ga0495597_0109422 3300046542 Bacteria 1160
445 Ga0495645_0034669 3300046543 Bacteria 3680
446 Ga0495645_0091984 3300046543 Bacteria 2166
447 Ga0495622_0242617 3300046557 Bacteria 794
448 Ga0495633_0111468 3300046558 Bacteria 1268
449 Ga0495667_0016017 3300046559 Bacteria 5066
450 Ga0495667_0095002 3300046559 Bacteria 1930
451 Ga0495668_0036112 3300046616 Bacteria 2770
452 Ga0495668_0171280 3300046616 Bacteria 1189
453 Ga0495634_0123627 3300046642 Bacteria 1655
454 Ga0495634_0394044 3300046642 Bacteria 823
455 Ga0495611_0174174 3300046648 Bacteria 1005
456 Ga0495625_0274623 3300046660 Bacteria 1086
457 Ga0495625_0536515 3300046660 Bacteria 710
458 Ga0495635_0090861 3300046663 Bacteria 2088
459 Ga0495635_0102556 3300046663 Bacteria 1955
460 Ga0495659_0250155 3300046664 Bacteria 738
461 Ga0495661_0012562 3300046665 Bacteria 5717
462 Ga0495661_0169867 3300046665 Bacteria 1164
463 Ga0495588_0129502 3300046674 Bacteria 1331
464 Ga0495588_0143243 3300046674 Bacteria 1262
465 Ga0495657_0011755 3300046675 Bacteria 6527
466 Ga0495657_0361038 3300046675 Bacteria 858
467 Ga0495599_0005538 3300046678 Bacteria 7569
468 Ga0495623_0015881 3300046679 Bacteria 4867
469 Ga0495623_0092090 3300046679 Bacteria 1859
470 Ga0495646_0020397 3300046680 Bacteria 4194
471 Ga0495646_0169137 3300046680 Bacteria 1205
472 Ga0495658_0587474 3300046683 Bacteria 713
473 Ga0495669_0014266 3300046684 Bacteria 3398
474 Ga0495669_0299130 3300046684 Bacteria 775
475 Ga0495613_0166784 3300046689 Bacteria 1564
476 Ga0495671_0161733 3300046692 Bacteria 1089
477 Ga0495671_0222564 3300046692 Bacteria 913
478 Ga0495649_0120774 3300046694 Bacteria 1386
479 Ga0495589_0084056 3300046794 Bacteria 1547
480 Ga0495589_0329198 3300046794 Bacteria 705
481 Ga0495600_0147270 3300046809 Bacteria 1526
482 Ga0495600_0182408 3300046809 Bacteria 1352
483 Ga0495660_0309600 3300046810 Bacteria 713
484 Ga0495581_0074575 3300047315 Bacteria 1963
485 Ga0495581_0630063 3300047315 Bacteria 620
486 Ga0495604_0032197 3300047317 Bacteria 4157
487 Ga0495604_0235671 3300047317 Bacteria 1254
488 Ga0495604_0442851 3300047317 Bacteria 850
489 Ga0495636_0114962 3300047318 Bacteria 1186
490 Ga0495674_0040165 3300047319 Bacteria 4187
491 Ga0495674_0117043 3300047319 Bacteria 2254
492 Ga0495672_0420459 3300047320 Bacteria 608
493 Ga0495680_0032674 3300047322 Bacteria 4221
494 Ga0495680_0761933 3300047322 Bacteria 635
495 Ga0495675_0028977 3300047444 Bacteria 3529
496 Ga0495677_0128955 3300047445 Bacteria 967
497 Ga0495679_086633 3300047446 Bacteria 883
498 Ga0495685_072302 3300047447 Bacteria 1154
499 Ga0495685_179726 3300047447 Bacteria 682
500 Ga0495681_0118086 3300047470 Bacteria 1141
501 Ga0495684_0028966 3300047471 Bacteria 4249
502 Ga0495684_0033165 3300047471 Bacteria 3963
503 Ga0495686_0098254 3300047472 Bacteria 1769
504 Ga0495686_0276910 3300047472 Bacteria 934
505 Ga0495686_0309689 3300047472 Bacteria 869
506 Ga0495686_0373863 3300047472 Bacteria 770
507 Ga0495593_0211211 3300047673 Bacteria 974
508 Ga0495602_0099301 3300048088 Bacteria 2393
509 Ga0495602_0258330 3300048088 Bacteria 1294
510 Ga0495602_0273765 3300048088 Bacteria 1247
511 Ga0495614_0113685 3300048089 Bacteria 1190
512 Ga0495615_0085491 3300048090 Bacteria 871
513 Ga0495626_0290351 3300048091 Bacteria 648
514 Ga0496101_0154408 3300048904 Bacteria 1757
515 Ga0496103_0806292 3300048906 Bacteria 592
516 Ga0496104_0056482 3300048907 Bacteria 3712
517 Ga0496104_0156921 3300048907 Bacteria 2184
518 Ga0496105_0034864 3300048908 Bacteria 4141
519 Ga0496105_0288088 3300048908 Bacteria 1323
520 Ga0496106_0198104 3300048909 Bacteria 1598
521 Ga0496106_0268337 3300048909 Bacteria 1366
522 Ga0496106_0571314 3300048909 Bacteria 907
523 Ga0496107_0195303 3300048910 Bacteria 1504
524 Ga0496108_0938772 3300048911 Bacteria 741
525 Ga0496110_0215074 3300048913 Bacteria 1748
526 Ga0496110_0317481 3300048913 Bacteria 1419
527 Ga0496110_0376315 3300048913 Bacteria 1294
528 Ga0496111_0529448 3300048914 Bacteria 866
529 Ga0496112_0006924 3300048915 Bacteria 10006
530 Ga0496112_0068671 3300048915 Bacteria 3500
531 Ga0496112_0090831 3300048915 Bacteria 3023
532 Ga0496112_0149815 3300048915 Bacteria 2300
533 Ga0496113_0086279 3300048916 Bacteria 2412
534 Ga0496113_0238654 3300048916 Bacteria 1450
535 Ga0496115_0105181 3300048918 Bacteria 2316
536 Ga0496115_0202088 3300048918 Bacteria 1641
537 Ga0496118_0228992 3300048921 Bacteria 1074
538 Ga0496119_0135808 3300048922 Bacteria 1334
539 Ga0496120_0017605 3300048923 Bacteria 4625
540 Ga0496121_0005056 3300048924 Bacteria 17227
541 Ga0496121_0075717 3300048924 Bacteria 2687
542 Ga0496121_0087668 3300048924 Bacteria 2442
543 Ga0496121_0158350 3300048924 Bacteria 1659
544 Ga0496123_0213462 3300048926 Bacteria 979
545 Ga0496124_0071117 3300048927 Bacteria 2885
546 Ga0496124_0191794 3300048927 Bacteria 1563
547 Ga0496124_0344719 3300048927 Bacteria 1056
548 Ga0496125_0000040 3300048928 Bacteria 314478
549 Ga0496125_0002569 3300048928 Bacteria 23386
550 Ga0496125_0050100 3300048928 Bacteria 3462
551 Ga0496126_0020406 3300048929 Bacteria 6497
552 Ga0496126_0020835 3300048929 Bacteria 6417
553 Ga0496126_0020883 3300048929 Bacteria 6410
554 Ga0496126_0054198 3300048929 Bacteria 3634
555 Ga0496126_0093989 3300048929 Bacteria 2632
556 Ga0496126_0177440 3300048929 Bacteria 1811
557 Ga0496126_0706942 3300048929 Bacteria 782
558 Ga0495682_0172079 3300049460 Bacteria 770
559 Ga0495682_0220561 3300049460 Bacteria 672
560 Ga0501067_0310648 3300049583 Bacteria 878
561 nmdc:mga03683_129021_c1 3300050489 Bacteria 1130
562 nmdc:mga03683_240165_c1 3300050489 Bacteria 839
563 nmdc:mga03n38_241069_c1 3300050490 Bacteria 951
564 nmdc:mga03n38_2988_c1 3300050490 Bacteria 5349
565 nmdc:mga00v17_71775_c1 3300050491 Bacteria 2147
566 nmdc:mga0yw44_133459_c1 3300050492 Bacteria 1609
567 nmdc:mga0yw44_139144_c1 3300050492 Bacteria 1577
568 nmdc:mga0yw44_378424_c1 3300050492 Bacteria 956
569 nmdc:mga0k408_290094_c1 3300050493 Bacteria 977
570 nmdc:mga06z11_440500_c1 3300050494 Bacteria 787
571 nmdc:mga06z11_61125_c1 3300050494 Bacteria 1964
572 nmdc:mga07m45_22659_c1 3300050496 Bacteria 3431
573 nmdc:mga07m45_531273_c1 3300050496 Bacteria 681
574 nmdc:mga08y16_369268_c1 3300050511 Bacteria 1472
575 nmdc:mga0n895_15503_c1 3300050512 Bacteria 6951
576 nmdc:mga0a205_223818_c1 3300050515 Bacteria 1766
577 nmdc:mga0sz30_29942_c1 3300050516 Bacteria 2247
578 Ga0495601_0175156 3300053077 Bacteria 1402
579 Ga0500635_0092058 3300053080 Bacteria 1104
580 Ga0495655_0249085 3300053083 Bacteria 597
581 Ga0495619_0089151 3300053085 Bacteria 2086
582 Ga0500643_021187 3300053087 Bacteria 2110
583 Ga0500581_022444 3300053089 Bacteria 3196
584 Ga0500646_0024762 3300053090 Bacteria 1617
585 Ga0500647_0283931 3300053091 Bacteria 714
586 Ga0500566_0038049 3300053094 Bacteria 2785
587 Ga0500641_0008512 3300053096 Bacteria 3664
588 Ga0500650_0034201 3300053098 Bacteria 2321
589 Ga0500554_000257 3300053102 Bacteria 11497
590 Ga0500556_0000069 3300053104 Bacteria 101263
591 Ga0500572_000250 3300053111 Bacteria 19300
592 Ga0500594_0117380 3300053118 Bacteria 833
593 Ga0500595_002263 3300053119 Bacteria 9723
594 Ga0500595_003979 3300053119 Bacteria 6751
595 Ga0500621_203310 3300053126 Bacteria 700
596 Ga0500642_0000032 3300053130 Bacteria 111097
597 Ga0500652_000738 3300053131 Bacteria 11098
598 Ga0500658_0202547 3300053134 Bacteria 907
599 Ga0500658_0231389 3300053134 Bacteria 848
600 Ga0500559_0001767 3300053136 Bacteria 11871
601 Ga0500568_0092507 3300053139 Bacteria 1139
602 Ga0500589_012741 3300053147 Bacteria 3687
603 Ga0500603_000177 3300053150 Bacteria 16272
604 Ga0500603_006316 3300053150 Bacteria 2573
605 Ga0500616_0000461 3300053153 Bacteria 53095
606 Ga0500622_0001709 3300053156 Bacteria 17023
607 Ga0500638_025050 3300053162 Bacteria 2849
608 Ga0500639_013395 3300053163 Bacteria 4313
609 Ga0500636_0002975 3300053177 Bacteria 9487
610 Ga0500637_0000927 3300053178 Bacteria 11855
611 Ga0500637_0002404 3300053178 Bacteria 8316
612 Ga0500596_000303 3300053735 Bacteria 8785
613 Ga0500661_000024 3300055283 Bacteria 23092
614 Ga0587070_092344 3300059491 Bacteria 683
615 Ga0587076_132961 3300059645 Bacteria 588

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005455 Ga0070663_100021567 Ga0070663_1000215673 132
2 3300046506 Ga0495583_0257622 Ga0495583_0257622_16_639 132
3 3300046518 Ga0495631_0015826 Ga0495631_0015826_1509_2183 132
4 3300046520 Ga0495637_0173892 Ga0495637_0173892_75_698 132
5 3300046542 Ga0495597_0109422 Ga0495597_0109422_437_1111 132
6 3300046665 Ga0495661_0012562 Ga0495661_0012562_2818_3492 132
7 3300046674 Ga0495588_0129502 Ga0495588_0129502_676_1299 132
8 3300048923 Ga0496120_0017605 Ga0496120_0017605_2386_3060 132
9 3300048924 Ga0496121_0005056 Ga0496121_0005056_5649_6272 132
10 3300048927 Ga0496124_0344719 Ga0496124_0344719_262_936 132
11 3300048928 Ga0496125_0002569 Ga0496125_0002569_18038_18661 132
12 3300048929 Ga0496126_0706942 Ga0496126_0706942_90_713 132
13 3300053087 Ga0500643_021187 Ga0500643_021187_1368_2042 132
14 3300053089 Ga0500581_022444 Ga0500581_022444_763_1386 132
15 3300053098 Ga0500650_0034201 Ga0500650_0034201_1144_1767 132
16 3300053104 Ga0500556_0000069 Ga0500556_0000069_71523_72146 132
17 3300053126 Ga0500621_203310 Ga0500621_203310_14_637 132
18 3300053130 Ga0500642_0000032 Ga0500642_0000032_88634_89257 132
19 3300053131 Ga0500652_000738 Ga0500652_000738_5272_5895 132
20 3300053134 Ga0500658_0202547 Ga0500658_0202547_243_866 132
21 3300053139 Ga0500568_0092507 Ga0500568_0092507_379_1002 132
22 3300053153 Ga0500616_0000461 Ga0500616_0000461_23292_23966 132
23 3300053156 Ga0500622_0001709 Ga0500622_0001709_1814_2488 132
24 3300047447 Ga0495685_179726 Ga0495685_179726_138_638 152
25 3300047472 Ga0495686_0276910 Ga0495686_0276910_288_827 152
26 3300053119 Ga0500595_003979 Ga0500595_003979_1073_1612 152
27 3300048929 Ga0496126_0177440 Ga0496126_0177440_13_477 153
28 3300013306 Ga0163162_10599638 Ga0163162_105996381 158
29 3300044694 Ga0466963_0204280 Ga0466963_0204280_878_1372 161
30 3300006173 Ga0070716_100166269 Ga0070716_1001662692 162
31 3300009101 Ga0105247_10388744 Ga0105247_103887442 162
32 3300013297 Ga0157378_10178208 Ga0157378_101782084 162
33 3300025898 Ga0207692_10291534 Ga0207692_102915342 162
34 3300025900 Ga0207710_10009512 Ga0207710_100095125 162
35 3300048924 Ga0496121_0075717 Ga0496121_0075717_1673_2161 162
36 3300048929 Ga0496126_0020406 Ga0496126_0020406_1699_2187 162
37 iso_pu_bacteria 2508501128 2509149339 162
38 iso_pu_bacteria 2513237098 2513677432 162
39 iso_pu_bacteria 2513237101 2513698067 162
40 iso_pu_bacteria 2513237141 2513891295 162
41 iso_pu_bacteria 2524023210 2524468433 162
42 iso_pu_bacteria 2602042107 2603860943 162
43 iso_pu_bacteria 2667528175 2671118843 162
44 iso_pu_bacteria 2791355197 2793066747 162
45 iso_pu_bacteria 2791355199 2793080634 162
46 iso_pu_bacteria 2874604998 2874607369 162
47 iso_pu_bacteria 2876808645 2876814595 162
48 iso_pu_bacteria 2879110137 2879114680 162
49 iso_pu_bacteria 2885383462 2885384011 162
50 iso_pu_bacteria 2889033259 2889038053 162
51 iso_pu_bacteria 2903768456 2903769681 162
52 iso_pu_bacteria 2906610324 2906616563 162
53 iso_pu_bacteria 2922425934 2922431417 162
54 iso_pu_bacteria 8006964411 8006971563 162
55 iso_pu_bacteria 8006984368 8006984390 162
56 iso_pu_bacteria 8006994254 8007001321 162
57 iso_pu_bacteria 8019555841 8019565381 162
58 iso_pu_bacteria 8019565922 8019575477 162
59 iso_pu_bacteria 8056673599 8056681070 162
60 iso_pu_bacteria 8056689827 8056693101 162
61 3300003354 JGI25160J50197_1005054 JGI25160J50197_10050545 164
62 3300005262 Ga0065165_1031789 Ga0065165_10317891 164
63 3300005530 Ga0070679_100914565 Ga0070679_1009145651 164
64 3300005539 Ga0068853_100713639 Ga0068853_1007136392 164
65 3300005834 Ga0068851_10381156 Ga0068851_103811562 164
66 3300006353 Ga0075370_10314875 Ga0075370_103148751 164
67 3300009545 Ga0105237_10157755 Ga0105237_101577553 164
68 3300009551 Ga0105238_10117620 Ga0105238_101176203 164
69 3300010375 Ga0105239_10118596 Ga0105239_101185962 164
70 3300025297 Ga0209758_1000011 Ga0209758_1000011266 164
71 3300025303 Ga0209051_1066476 Ga0209051_10664762 164
72 3300025924 Ga0207694_10060044 Ga0207694_100600442 164
73 3300026041 Ga0207639_10602948 Ga0207639_106029481 164
74 3300028556 Ga0265337_1015924 Ga0265337_10159242 164
75 3300028563 Ga0265319_1015825 Ga0265319_10158252 164
76 3300028653 Ga0265323_10001015 Ga0265323_100010151 164
77 3300028654 Ga0265322_10031044 Ga0265322_100310442 164
78 3300028666 Ga0265336_10001855 Ga0265336_100018555 164
79 3300028800 Ga0265338_10000034 Ga0265338_10000034150 164
80 3300029957 Ga0265324_10010129 Ga0265324_100101292 164
81 3300037312 Ga0395899_0634775 Ga0395899_0634775_121_618 164
82 3300037418 Ga0395900_0000948 Ga0395900_0000948_8588_9085 164
83 3300037466 Ga0395898_0206345 Ga0395898_0206345_696_1193 164
84 3300037471 Ga0395905_0035185 Ga0395905_0035185_614_1111 164
85 3300038443 Ga0395901_0029080 Ga0395901_0029080_297_794 164
86 3300044683 Ga0466965_0505153 Ga0466965_0505153_157_654 164
87 3300044901 Ga0466960_0036093 Ga0466960_0036093_782_1279 164
88 3300045976 Ga0466967_0564662 Ga0466967_0564662_459_1013 164
89 3300048918 Ga0496115_0202088 Ga0496115_0202088_487_984 164
90 3300048927 Ga0496124_0191794 Ga0496124_0191794_661_1155 164
91 3300048928 Ga0496125_0050100 Ga0496125_0050100_2169_2663 164
92 3300049460 Ga0495682_0220561 Ga0495682_0220561_145_642 164
93 3300053111 Ga0500572_000250 Ga0500572_000250_3833_4387 164
94 3300053136 Ga0500559_0001767 Ga0500559_0001767_9450_10004 164
95 3300053163 Ga0500639_013395 Ga0500639_013395_1115_1669 164
96 3300053735 Ga0500596_000303 Ga0500596_000303_5857_6411 164
97 3300005614 Ga0068856_100696942 Ga0068856_1006969422 165
98 3300006173 Ga0070716_100174306 Ga0070716_1001743063 165
99 3300009551 Ga0105238_10953115 Ga0105238_109531151 165
100 3300025939 Ga0207665_10216788 Ga0207665_102167882 165
101 3300030760 Ga0265762_1070772 Ga0265762_10707721 165
102 3300031090 Ga0265760_10128597 Ga0265760_101285971 165
103 3300031711 Ga0265314_10025180 Ga0265314_100251803 165
104 3300031712 Ga0265342_10007437 Ga0265342_100074374 165
105 3300035170 Ga0373943_0524697 Ga0373943_0524697_39_536 165
106 3300035695 Ga0373927_0006061 Ga0373927_0006061_5452_5949 165
107 3300035724 Ga0373933_0272238 Ga0373933_0272238_80_580 165
108 3300036401 Ga0373937_1555718 Ga0373937_1555718_44_541 165
109 3300037068 Ga0373925_0345754 Ga0373925_0345754_362_859 165
110 3300044684 Ga0466966_0199086 Ga0466966_0199086_507_1007 165
111 3300045049 Ga0466959_0115625 Ga0466959_0115625_373_873 165
112 3300046455 Ga0495603_0177930 Ga0495603_0177930_664_1161 165
113 3300046462 Ga0495651_0050423 Ga0495651_0050423_908_1408 165
114 3300046679 Ga0495623_0092090 Ga0495623_0092090_701_1201 165
115 3300047315 Ga0495581_0074575 Ga0495581_0074575_966_1463 165
116 3300048088 Ga0495602_0258330 Ga0495602_0258330_275_775 165
117 3300048088 Ga0495602_0273765 Ga0495602_0273765_426_926 165
118 3300048915 Ga0496112_0068671 Ga0496112_0068671_1329_1832 165
119 3300048918 Ga0496115_0105181 Ga0496115_0105181_1309_1809 165
120 3300048921 Ga0496118_0228992 Ga0496118_0228992_290_790 165
121 3300048929 Ga0496126_0020835 Ga0496126_0020835_1089_1589 165
122 3300048929 Ga0496126_0054198 Ga0496126_0054198_2870_3370 165
123 3300048929 Ga0496126_0093989 Ga0496126_0093989_1527_2027 165
124 3300001989 JGI24739J22299_10021439 JGI24739J22299_100214392 166
125 3300002067 JGI24735J21928_10034819 JGI24735J21928_100348192 166
126 3300002244 JGI24742J22300_10005518 JGI24742J22300_100055182 166
127 3300003659 JGI25404J52841_10000472 JGI25404J52841_100004726 166
128 3300003659 JGI25404J52841_10001192 JGI25404J52841_100011921 166
129 3300003659 JGI25404J52841_10091650 JGI25404J52841_100916501 166
130 3300005331 Ga0070670_100414765 Ga0070670_1004147652 166
131 3300005334 Ga0068869_101153295 Ga0068869_1011532951 166
132 3300005335 Ga0070666_10114566 Ga0070666_101145663 166
133 3300005336 Ga0070680_100164333 Ga0070680_1001643332 166
134 3300005338 Ga0068868_100025999 Ga0068868_1000259993 166
135 3300005344 Ga0070661_100322318 Ga0070661_1003223181 166
136 3300005344 Ga0070661_100681741 Ga0070661_1006817411 166
137 3300005347 Ga0070668_100126984 Ga0070668_1001269842 166
138 3300005347 Ga0070668_100185255 Ga0070668_1001852552 166
139 3300005347 Ga0070668_100420924 Ga0070668_1004209241 166
140 3300005353 Ga0070669_100097261 Ga0070669_1000972613 166
141 3300005355 Ga0070671_100133258 Ga0070671_1001332581 166
142 3300005355 Ga0070671_100147120 Ga0070671_1001471202 166
143 3300005356 Ga0070674_100014302 Ga0070674_1000143021 166
144 3300005356 Ga0070674_100287503 Ga0070674_1002875033 166
145 3300005364 Ga0070673_100925860 Ga0070673_1009258601 166
146 3300005366 Ga0070659_100137452 Ga0070659_1001374522 166
147 3300005367 Ga0070667_100496971 Ga0070667_1004969712 166
148 3300005367 Ga0070667_100690790 Ga0070667_1006907901 166
149 3300005367 Ga0070667_101028885 Ga0070667_1010288851 166
150 3300005434 Ga0070709_10003112 Ga0070709_100031122 166
151 3300005434 Ga0070709_10897152 Ga0070709_108971521 166
152 3300005435 Ga0070714_100007436 Ga0070714_1000074365 166
153 3300005436 Ga0070713_100033918 Ga0070713_1000339184 166
154 3300005437 Ga0070710_10002974 Ga0070710_100029743 166
155 3300005439 Ga0070711_100005217 Ga0070711_1000052176 166
156 3300005441 Ga0070700_100223796 Ga0070700_1002237962 166
157 3300005455 Ga0070663_100065758 Ga0070663_1000657584 166
158 3300005455 Ga0070663_100104934 Ga0070663_1001049341 166
159 3300005455 Ga0070663_100165490 Ga0070663_1001654902 166
160 3300005455 Ga0070663_100450259 Ga0070663_1004502591 166
161 3300005456 Ga0070678_100242493 Ga0070678_1002424931 166
162 3300005457 Ga0070662_100034535 Ga0070662_1000345351 166
163 3300005458 Ga0070681_10691779 Ga0070681_106917791 166
164 3300005459 Ga0068867_100330967 Ga0068867_1003309672 166
165 3300005459 Ga0068867_101769664 Ga0068867_1017696641 166
166 3300005467 Ga0070706_100606940 Ga0070706_1006069401 166
167 3300005468 Ga0070707_100294403 Ga0070707_1002944032 166
168 3300005471 Ga0070698_100016851 Ga0070698_1000168516 166
169 3300005471 Ga0070698_100222476 Ga0070698_1002224764 166
170 3300005530 Ga0070679_100206259 Ga0070679_1002062592 166
171 3300005536 Ga0070697_100090499 Ga0070697_1000904992 166
172 3300005539 Ga0068853_100413217 Ga0068853_1004132171 166
173 3300005539 Ga0068853_100500849 Ga0068853_1005008491 166
174 3300005539 Ga0068853_100580304 Ga0068853_1005803042 166
175 3300005539 Ga0068853_100657360 Ga0068853_1006573602 166
176 3300005539 Ga0068853_100708305 Ga0068853_1007083052 166
177 3300005544 Ga0070686_100079904 Ga0070686_1000799042 166
178 3300005544 Ga0070686_100177507 Ga0070686_1001775072 166
179 3300005548 Ga0070665_100247668 Ga0070665_1002476682 166
180 3300005548 Ga0070665_100318443 Ga0070665_1003184432 166
181 3300005563 Ga0068855_100016472 Ga0068855_1000164723 166
182 3300005563 Ga0068855_100016926 Ga0068855_1000169265 166
183 3300005563 Ga0068855_100017121 Ga0068855_1000171215 166
184 3300005563 Ga0068855_100031441 Ga0068855_1000314411 166
185 3300005563 Ga0068855_100111709 Ga0068855_1001117092 166
186 3300005564 Ga0070664_100155727 Ga0070664_1001557272 166
187 3300005564 Ga0070664_101178611 Ga0070664_1011786111 166
188 3300005577 Ga0068857_100002567 Ga0068857_1000025675 166
189 3300005577 Ga0068857_100058887 Ga0068857_1000588872 166
190 3300005577 Ga0068857_100498540 Ga0068857_1004985401 166
191 3300005578 Ga0068854_100005650 Ga0068854_1000056502 166
192 3300005578 Ga0068854_100048779 Ga0068854_1000487791 166
193 3300005614 Ga0068856_100013475 Ga0068856_1000134752 166
194 3300005614 Ga0068856_100052415 Ga0068856_1000524152 166
195 3300005614 Ga0068856_100090447 Ga0068856_1000904471 166
196 3300005614 Ga0068856_100810441 Ga0068856_1008104412 166
197 3300005615 Ga0070702_100543776 Ga0070702_1005437762 166
198 3300005616 Ga0068852_100027768 Ga0068852_1000277682 166
199 3300005616 Ga0068852_100112618 Ga0068852_1001126184 166
200 3300005616 Ga0068852_101137950 Ga0068852_1011379501 166
201 3300005718 Ga0068866_10175774 Ga0068866_101757742 166
202 3300005719 Ga0068861_100016647 Ga0068861_1000166472 166
203 3300005834 Ga0068851_10067598 Ga0068851_100675982 166
204 3300005840 Ga0068870_10046705 Ga0068870_100467051 166
205 3300005840 Ga0068870_10073656 Ga0068870_100736561 166
206 3300005841 Ga0068863_100071362 Ga0068863_1000713623 166
207 3300005841 Ga0068863_100198537 Ga0068863_1001985372 166
208 3300005843 Ga0068860_100824200 Ga0068860_1008242001 166
209 3300005844 Ga0068862_100086289 Ga0068862_1000862892 166
210 3300005844 Ga0068862_100124463 Ga0068862_1001244632 166
211 3300005981 Ga0081538_10042772 Ga0081538_100427723 166
212 3300005983 Ga0081540_1002148 Ga0081540_100214810 166
213 3300005983 Ga0081540_1003328 Ga0081540_10033284 166
214 3300005983 Ga0081540_1011376 Ga0081540_10113764 166
215 3300005983 Ga0081540_1014260 Ga0081540_10142605 166
216 3300005983 Ga0081540_1016711 Ga0081540_10167117 166
217 3300005983 Ga0081540_1069264 Ga0081540_10692643 166
218 3300006028 Ga0070717_10302177 Ga0070717_103021772 166
219 3300006038 Ga0075365_10006380 Ga0075365_100063802 166
220 3300006038 Ga0075365_10206582 Ga0075365_102065823 166
221 3300006042 Ga0075368_10037733 Ga0075368_100377331 166
222 3300006048 Ga0075363_100000789 Ga0075363_1000007897 166
223 3300006051 Ga0075364_10195200 Ga0075364_101952002 166
224 3300006051 Ga0075364_10215388 Ga0075364_102153881 166
225 3300006163 Ga0070715_10100380 Ga0070715_101003802 166
226 3300006173 Ga0070716_100010881 Ga0070716_1000108815 166
227 3300006177 Ga0075362_10160698 Ga0075362_101606982 166
228 3300006177 Ga0075362_10207899 Ga0075362_102078992 166
229 3300006178 Ga0075367_10008506 Ga0075367_100085065 166
230 3300006186 Ga0075369_10063102 Ga0075369_100631022 166
231 3300006186 Ga0075369_10315230 Ga0075369_103152301 166
232 3300006195 Ga0075366_10142891 Ga0075366_101428912 166
233 3300006353 Ga0075370_10036971 Ga0075370_100369714 166
234 3300006358 Ga0068871_100227162 Ga0068871_1002271622 166
235 3300006358 Ga0068871_100587638 Ga0068871_1005876381 166
236 3300006844 Ga0075428_100394355 Ga0075428_1003943553 166
237 3300006871 Ga0075434_100007277 Ga0075434_1000072777 166
238 3300006871 Ga0075434_100365573 Ga0075434_1003655732 166
239 3300006881 Ga0068865_100541314 Ga0068865_1005413142 166
240 3300007076 Ga0075435_100343275 Ga0075435_1003432751 166
241 3300007265 Ga0099794_10009233 Ga0099794_100092334 166
242 3300007265 Ga0099794_10043047 Ga0099794_100430473 166
243 3300007265 Ga0099794_10113386 Ga0099794_101133862 166
244 3300007788 Ga0099795_10243642 Ga0099795_102436422 166
245 3300009093 Ga0105240_10003917 Ga0105240_1000391713 166
246 3300009093 Ga0105240_10055702 Ga0105240_100557022 166
247 3300009093 Ga0105240_10072102 Ga0105240_100721023 166
248 3300009094 Ga0111539_11152256 Ga0111539_111522561 166
249 3300009098 Ga0105245_10206288 Ga0105245_102062881 166
250 3300009101 Ga0105247_10645119 Ga0105247_106451191 166
251 3300009148 Ga0105243_10408740 Ga0105243_104087401 166
252 3300009148 Ga0105243_11039984 Ga0105243_110399841 166
253 3300009174 Ga0105241_10002672 Ga0105241_100026723 166
254 3300009174 Ga0105241_10012909 Ga0105241_100129093 166
255 3300009174 Ga0105241_10540860 Ga0105241_105408602 166
256 3300009177 Ga0105248_10132082 Ga0105248_101320823 166
257 3300009545 Ga0105237_10033420 Ga0105237_100334204 166
258 3300009545 Ga0105237_10270532 Ga0105237_102705321 166
259 3300009545 Ga0105237_10336991 Ga0105237_103369912 166
260 3300009545 Ga0105237_10375552 Ga0105237_103755522 166
261 3300009551 Ga0105238_10011847 Ga0105238_100118476 166
262 3300009551 Ga0105238_10043500 Ga0105238_100435005 166
263 3300009551 Ga0105238_10135849 Ga0105238_101358493 166
264 3300009551 Ga0105238_10207742 Ga0105238_102077423 166
265 3300009553 Ga0105249_11337409 Ga0105249_113374091 166
266 3300010159 Ga0099796_10050507 Ga0099796_100505072 166
267 3300010375 Ga0105239_10005731 Ga0105239_100057318 166
268 3300010375 Ga0105239_10152059 Ga0105239_101520592 166
269 3300010375 Ga0105239_10202910 Ga0105239_102029101 166
270 3300010375 Ga0105239_11173993 Ga0105239_111739931 166
271 3300011119 Ga0105246_10018834 Ga0105246_100188342 166
272 3300011119 Ga0105246_10120812 Ga0105246_101208123 166
273 3300012494 Ga0157341_1000853 Ga0157341_10008531 166
274 3300013104 Ga0157370_10195235 Ga0157370_101952353 166
275 3300013104 Ga0157370_10731622 Ga0157370_107316222 166
276 3300013105 Ga0157369_10004254 Ga0157369_100042549 166
277 3300013105 Ga0157369_10321336 Ga0157369_103213362 166
278 3300013105 Ga0157369_10324636 Ga0157369_103246361 166
279 3300013297 Ga0157378_10353806 Ga0157378_103538062 166
280 3300013297 Ga0157378_10687754 Ga0157378_106877542 166
281 3300013297 Ga0157378_11764968 Ga0157378_117649681 166
282 3300013306 Ga0163162_10627786 Ga0163162_106277862 166
283 3300013307 Ga0157372_10072697 Ga0157372_100726973 166
284 3300013307 Ga0157372_11133771 Ga0157372_111337712 166
285 3300013308 Ga0157375_10244925 Ga0157375_102449251 166
286 3300013308 Ga0157375_11089005 Ga0157375_110890052 166
287 3300014325 Ga0163163_10211478 Ga0163163_102114783 166
288 3300014326 Ga0157380_10053042 Ga0157380_100530421 166
289 3300014326 Ga0157380_10181823 Ga0157380_101818233 166
290 3300014497 Ga0182008_10482588 Ga0182008_104825881 166
291 3300014969 Ga0157376_10425805 Ga0157376_104258051 166
292 3300014969 Ga0157376_10743192 Ga0157376_107431921 166
293 3300017792 Ga0163161_10271495 Ga0163161_102714951 166
294 3300020075 Ga0206349_1461959 Ga0206349_14619591 166
295 3300020078 Ga0206352_10796597 Ga0206352_107965971 166
296 3300020080 Ga0206350_10048311 Ga0206350_100483111 166
297 3300020081 Ga0206354_10396399 Ga0206354_103963991 166
298 3300020610 Ga0154015_1510599 Ga0154015_15105992 166
299 3300021358 Ga0213873_10009607 Ga0213873_100096072 166
300 3300021358 Ga0213873_10096041 Ga0213873_100960412 166
301 3300021377 Ga0213874_10196572 Ga0213874_101965721 166
302 3300021384 Ga0213876_10002980 Ga0213876_100029809 166
303 3300021388 Ga0213875_10176625 Ga0213875_101766251 166
304 3300021388 Ga0213875_10511004 Ga0213875_105110041 166
305 3300021441 Ga0213871_10025594 Ga0213871_100255942 166
306 3300022467 Ga0224712_10103731 Ga0224712_101037312 166
307 3300022467 Ga0224712_10300031 Ga0224712_103000311 166
308 3300025297 Ga0209758_1004160 Ga0209758_10041608 166
309 3300025315 Ga0207697_10085541 Ga0207697_100855412 166
310 3300025321 Ga0207656_10250066 Ga0207656_102500661 166
311 3300025898 Ga0207692_10025911 Ga0207692_100259112 166
312 3300025900 Ga0207710_10034072 Ga0207710_100340722 166
313 3300025904 Ga0207647_10003198 Ga0207647_100031987 166
314 3300025906 Ga0207699_10000204 Ga0207699_1000020410 166
315 3300025906 Ga0207699_10946293 Ga0207699_109462931 166
316 3300025907 Ga0207645_10040688 Ga0207645_100406882 166
317 3300025907 Ga0207645_10263742 Ga0207645_102637422 166
318 3300025907 Ga0207645_10377158 Ga0207645_103771581 166
319 3300025908 Ga0207643_10011042 Ga0207643_100110423 166
320 3300025910 Ga0207684_10092912 Ga0207684_100929122 166
321 3300025911 Ga0207654_10024350 Ga0207654_100243503 166
322 3300025911 Ga0207654_10034013 Ga0207654_100340132 166
323 3300025913 Ga0207695_10000424 Ga0207695_1000042422 166
324 3300025913 Ga0207695_10012405 Ga0207695_100124052 166
325 3300025913 Ga0207695_10149175 Ga0207695_101491753 166
326 3300025913 Ga0207695_10385302 Ga0207695_103853022 166
327 3300025914 Ga0207671_10079659 Ga0207671_100796592 166
328 3300025914 Ga0207671_10129439 Ga0207671_101294392 166
329 3300025914 Ga0207671_10170922 Ga0207671_101709222 166
330 3300025915 Ga0207693_10028299 Ga0207693_100282994 166
331 3300025916 Ga0207663_10024044 Ga0207663_100240442 166
332 3300025917 Ga0207660_10709395 Ga0207660_107093952 166
333 3300025920 Ga0207649_10268370 Ga0207649_102683702 166
334 3300025921 Ga0207652_10171583 Ga0207652_101715833 166
335 3300025921 Ga0207652_10231775 Ga0207652_102317753 166
336 3300025922 Ga0207646_10175749 Ga0207646_101757492 166
337 3300025923 Ga0207681_10552068 Ga0207681_105520682 166
338 3300025923 Ga0207681_10747233 Ga0207681_107472332 166
339 3300025924 Ga0207694_10000119 Ga0207694_1000011956 166
340 3300025924 Ga0207694_10079907 Ga0207694_100799073 166
341 3300025925 Ga0207650_10249368 Ga0207650_102493681 166
342 3300025928 Ga0207700_10009772 Ga0207700_100097724 166
343 3300025929 Ga0207664_10704221 Ga0207664_107042211 166
344 3300025931 Ga0207644_10088691 Ga0207644_100886912 166
345 3300025932 Ga0207690_10424637 Ga0207690_104246371 166
346 3300025933 Ga0207706_10343491 Ga0207706_103434911 166
347 3300025933 Ga0207706_10550529 Ga0207706_105505291 166
348 3300025934 Ga0207686_10457169 Ga0207686_104571691 166
349 3300025935 Ga0207709_10700204 Ga0207709_107002041 166
350 3300025937 Ga0207669_10058015 Ga0207669_100580152 166
351 3300025938 Ga0207704_10063870 Ga0207704_100638702 166
352 3300025938 Ga0207704_10336993 Ga0207704_103369932 166
353 3300025939 Ga0207665_10002479 Ga0207665_100024798 166
354 3300025940 Ga0207691_10540647 Ga0207691_105406472 166
355 3300025941 Ga0207711_10254250 Ga0207711_102542501 166
356 3300025942 Ga0207689_10038611 Ga0207689_100386113 166
357 3300025942 Ga0207689_10325483 Ga0207689_103254832 166
358 3300025945 Ga0207679_10319723 Ga0207679_103197232 166
359 3300025945 Ga0207679_11081388 Ga0207679_110813881 166
360 3300025949 Ga0207667_10008027 Ga0207667_100080275 166
361 3300025949 Ga0207667_10057455 Ga0207667_100574553 166
362 3300025960 Ga0207651_10053509 Ga0207651_100535092 166
363 3300025960 Ga0207651_11451177 Ga0207651_114511771 166
364 3300025972 Ga0207668_10022936 Ga0207668_100229363 166
365 3300025972 Ga0207668_10585561 Ga0207668_105855611 166
366 3300025981 Ga0207640_10006001 Ga0207640_100060011 166
367 3300025986 Ga0207658_10590830 Ga0207658_105908302 166
368 3300026035 Ga0207703_10058819 Ga0207703_100588192 166
369 3300026035 Ga0207703_10485271 Ga0207703_104852711 166
370 3300026041 Ga0207639_10009164 Ga0207639_100091645 166
371 3300026041 Ga0207639_10090472 Ga0207639_100904723 166
372 3300026041 Ga0207639_10207692 Ga0207639_102076921 166
373 3300026041 Ga0207639_11594870 Ga0207639_115948701 166
374 3300026067 Ga0207678_10039602 Ga0207678_100396023 166
375 3300026067 Ga0207678_10057735 Ga0207678_100577352 166
376 3300026067 Ga0207678_10146825 Ga0207678_101468253 166
377 3300026078 Ga0207702_10000002 Ga0207702_1000000256 166
378 3300026078 Ga0207702_10007362 Ga0207702_100073626 166
379 3300026078 Ga0207702_10163454 Ga0207702_101634543 166
380 3300026078 Ga0207702_10380415 Ga0207702_103804152 166
381 3300026078 Ga0207702_10813991 Ga0207702_108139911 166
382 3300026088 Ga0207641_10962871 Ga0207641_109628711 166
383 3300026089 Ga0207648_10150855 Ga0207648_101508551 166
384 3300026095 Ga0207676_10064094 Ga0207676_100640942 166
385 3300026095 Ga0207676_10825961 Ga0207676_108259611 166
386 3300026116 Ga0207674_10001403 Ga0207674_1000140317 166
387 3300026116 Ga0207674_10003336 Ga0207674_100033368 166
388 3300026116 Ga0207674_10490379 Ga0207674_104903792 166
389 3300026118 Ga0207675_100446579 Ga0207675_1004465791 166
390 3300026121 Ga0207683_10088488 Ga0207683_100884882 166
391 3300026121 Ga0207683_10165671 Ga0207683_101656711 166
392 3300026142 Ga0207698_10114018 Ga0207698_101140181 166
393 3300026142 Ga0207698_10404562 Ga0207698_104045621 166
394 3300026142 Ga0207698_10430350 Ga0207698_104303502 166
395 3300027512 Ga0209179_1001160 Ga0209179_10011602 166
396 3300027671 Ga0209588_1002049 Ga0209588_10020492 166
397 3300027907 Ga0207428_10423596 Ga0207428_104235962 166
398 3300028379 Ga0268266_10007641 Ga0268266_100076414 166
399 3300028379 Ga0268266_10204944 Ga0268266_102049441 166
400 3300028380 Ga0268265_10164205 Ga0268265_101642052 166
401 3300028380 Ga0268265_10346076 Ga0268265_103460761 166
402 3300028381 Ga0268264_10298325 Ga0268264_102983252 166
403 3300028381 Ga0268264_10300312 Ga0268264_103003122 166
404 3300028381 Ga0268264_10824206 Ga0268264_108242061 166
405 3300031507 Ga0307509_10100629 Ga0307509_101006291 166
406 3300031548 Ga0307408_100336685 Ga0307408_1003366851 166
407 3300031616 Ga0307508_10099082 Ga0307508_100990823 166
408 3300031711 Ga0265314_10042546 Ga0265314_100425462 166
409 3300031731 Ga0307405_10698304 Ga0307405_106983041 166
410 3300031911 Ga0307412_10163237 Ga0307412_101632372 166
411 3300032002 Ga0307416_101129291 Ga0307416_1011292911 166
412 3300032004 Ga0307414_10150456 Ga0307414_101504562 166
413 3300032126 Ga0307415_100643805 Ga0307415_1006438051 166
414 3300035086 Ga0373934_0025224 Ga0373934_0025224_441_941 166
415 3300035086 Ga0373934_0154505 Ga0373934_0154505_405_923 166
416 3300035111 Ga0373923_0055492 Ga0373923_0055492_204_722 166
417 3300035113 Ga0373936_0130961 Ga0373936_0130961_236_754 166
418 3300035116 Ga0373945_0165776 Ga0373945_0165776_219_737 166
419 3300035118 Ga0373954_0010657 Ga0373954_0010657_227_727 166
420 3300035118 Ga0373954_0017973 Ga0373954_0017973_1260_1778 166
421 3300035119 Ga0373956_0015069 Ga0373956_0015069_368_868 166
422 3300035119 Ga0373956_0099609 Ga0373956_0099609_178_696 166
423 3300035120 Ga0373957_0031050 Ga0373957_0031050_557_1057 166
424 3300035120 Ga0373957_0040807 Ga0373957_0040807_341_859 166
425 3300035170 Ga0373943_0011977 Ga0373943_0011977_2879_3397 166
426 3300035170 Ga0373943_0024541 Ga0373943_0024541_827_1330 166
427 3300035171 Ga0373946_0365309 Ga0373946_0365309_34_552 166
428 3300035172 Ga0373955_0061075 Ga0373955_0061075_959_1459 166
429 3300035172 Ga0373955_0076606 Ga0373955_0076606_1198_1716 166
430 3300035410 Ga0373924_0031931 Ga0373924_0031931_376_894 166
431 3300035410 Ga0373924_0243713 Ga0373924_0243713_266_766 166
432 3300035691 Ga0373931_0019175 Ga0373931_0019175_573_1091 166
433 3300035692 Ga0373935_0194267 Ga0373935_0194267_231_749 166
434 3300035695 Ga0373927_0075982 Ga0373927_0075982_531_1049 166
435 3300035724 Ga0373933_0184492 Ga0373933_0184492_198_698 166
436 3300035724 Ga0373933_0311232 Ga0373933_0311232_159_677 166
437 3300035725 Ga0373947_0050666 Ga0373947_0050666_355_873 166
438 3300035725 Ga0373947_0110591 Ga0373947_0110591_1064_1567 166
439 3300035725 Ga0373947_0213873 Ga0373947_0213873_62_565 166
440 3300036242 Ga0310104_04734 Ga0310104_04734_267_773 166
441 3300036401 Ga0373937_0043093 Ga0373937_0043093_2966_3466 166
442 3300036401 Ga0373937_0155095 Ga0373937_0155095_818_1336 166
443 3300036458 Ga0310112_026682 Ga0310112_026682_245_745 166
444 3300036459 Ga0372808_003072 Ga0372808_003072_907_1413 166
445 3300036534 Ga0310109_024891 Ga0310109_024891_99_605 166
446 3300037068 Ga0373925_0886400 Ga0373925_0886400_111_629 166
447 3300039437 Ga0436365_0109261 Ga0436365_0109261_277_780 166
448 3300039437 Ga0436365_0740383 Ga0436365_0740383_460_963 166
449 3300039437 Ga0436365_1835761 Ga0436365_1835761_26701_27201 166
450 3300039438 Ga0436360_0550228 Ga0436360_0550228_51_554 166
451 3300039438 Ga0436360_0854373 Ga0436360_0854373_116_619 166
452 3300039447 Ga0436361_0467457 Ga0436361_0467457_409_912 166
453 3300039447 Ga0436361_1014259 Ga0436361_1014259_15816_16319 166
454 3300039453 Ga0436362_0006141 Ga0436362_0006141_966_1574 166
455 3300039453 Ga0436362_0643370 Ga0436362_0643370_162_665 166
456 3300039453 Ga0436362_1206035 Ga0436362_1206035_734_1237 166
457 3300041453 Ga0451797_1308170 Ga0451797_1308170_180_683 166
458 3300041460 Ga0451802_2006855 Ga0451802_2006855_204_707 166
459 3300041486 Ga0451807_1787443 Ga0451807_1787443_1849_2352 166
460 3300044694 Ga0466963_0058718 Ga0466963_0058718_1953_2453 166
461 3300044735 Ga0466968_0194455 Ga0466968_0194455_321_824 166
462 3300045976 Ga0466967_0500724 Ga0466967_0500724_448_999 166
463 3300046453 Ga0495627_026739 Ga0495627_026739_1329_1847 166
464 3300046454 Ga0495592_0009399 Ga0495592_0009399_2748_3248 166
465 3300046455 Ga0495603_0023365 Ga0495603_0023365_2590_3108 166
466 3300046455 Ga0495603_0795587 Ga0495603_0795587_22_525 166
467 3300046457 Ga0495590_0266702 Ga0495590_0266702_78_596 166
468 3300046459 Ga0495629_0083386 Ga0495629_0083386_278_778 166
469 3300046460 Ga0495638_0181682 Ga0495638_0181682_91_594 166
470 3300046460 Ga0495638_0217040 Ga0495638_0217040_440_958 166
471 3300046461 Ga0495641_0024865 Ga0495641_0024865_2332_2850 166
472 3300046462 Ga0495651_0043105 Ga0495651_0043105_962_1462 166
473 3300046463 Ga0495653_0022987 Ga0495653_0022987_1010_1510 166
474 3300046471 Ga0495650_0167220 Ga0495650_0167220_78_596 166
475 3300046472 Ga0495580_0125990 Ga0495580_0125990_316_834 166
476 3300046474 Ga0495605_0078489 Ga0495605_0078489_117_635 166
477 3300046475 Ga0495639_0015742 Ga0495639_0015742_1350_1868 166
478 3300046475 Ga0495639_0097446 Ga0495639_0097446_142_660 166
479 3300046477 Ga0495664_0069929 Ga0495664_0069929_1236_1754 166
480 3300046491 Ga0495584_0254153 Ga0495584_0254153_133_651 166
481 3300046492 Ga0495585_0119329 Ga0495585_0119329_679_1197 166
482 3300046499 Ga0495594_0162800 Ga0495594_0162800_461_979 166
483 3300046499 Ga0495594_0484849 Ga0495594_0484849_83_601 166
484 3300046500 Ga0495596_0150727 Ga0495596_0150727_116_634 166
485 3300046501 Ga0495607_0058223 Ga0495607_0058223_37_555 166
486 3300046506 Ga0495583_0086754 Ga0495583_0086754_22_540 166
487 3300046511 Ga0495608_0015773 Ga0495608_0015773_336_836 166
488 3300046513 Ga0495616_0096142 Ga0495616_0096142_519_1037 166
489 3300046513 Ga0495616_0310745 Ga0495616_0310745_55_558 166
490 3300046514 Ga0495618_0071700 Ga0495618_0071700_980_1498 166
491 3300046516 Ga0495628_0022019 Ga0495628_0022019_557_1057 166
492 3300046516 Ga0495628_0345834 Ga0495628_0345834_296_814 166
493 3300046517 Ga0495630_0379938 Ga0495630_0379938_110_610 166
494 3300046517 Ga0495630_0509393 Ga0495630_0509393_392_895 166
495 3300046518 Ga0495631_0146989 Ga0495631_0146989_249_767 166
496 3300046523 Ga0495644_0049465 Ga0495644_0049465_217_735 166
497 3300046523 Ga0495644_0092261 Ga0495644_0092261_364_882 166
498 3300046524 Ga0495648_0260888 Ga0495648_0260888_94_612 166
499 3300046525 Ga0495663_0033759 Ga0495663_0033759_446_964 166
500 3300046528 Ga0495642_0220839 Ga0495642_0220839_261_779 166
501 3300046529 Ga0495652_0248543 Ga0495652_0248543_365_883 166
502 3300046530 Ga0495654_0226690 Ga0495654_0226690_53_571 166
503 3300046531 Ga0495665_0021120 Ga0495665_0021120_2788_3306 166
504 3300046531 Ga0495665_0151436 Ga0495665_0151436_47_565 166
505 3300046533 Ga0495640_0095959 Ga0495640_0095959_153_671 166
506 3300046535 Ga0495586_0189702 Ga0495586_0189702_194_712 166
507 3300046536 Ga0495587_0069857 Ga0495587_0069857_461_961 166
508 3300046537 Ga0495598_0008239 Ga0495598_0008239_380_898 166
509 3300046538 Ga0495609_0149835 Ga0495609_0149835_225_743 166
510 3300046539 Ga0495621_0070013 Ga0495621_0070013_485_1003 166
511 3300046543 Ga0495645_0034669 Ga0495645_0034669_2901_3401 166
512 3300046543 Ga0495645_0091984 Ga0495645_0091984_1194_1712 166
513 3300046557 Ga0495622_0242617 Ga0495622_0242617_19_522 166
514 3300046558 Ga0495633_0111468 Ga0495633_0111468_152_670 166
515 3300046559 Ga0495667_0016017 Ga0495667_0016017_2261_2761 166
516 3300046559 Ga0495667_0095002 Ga0495667_0095002_916_1434 166
517 3300046616 Ga0495668_0036112 Ga0495668_0036112_1529_2032 166
518 3300046616 Ga0495668_0171280 Ga0495668_0171280_470_988 166
519 3300046642 Ga0495634_0123627 Ga0495634_0123627_832_1332 166
520 3300046642 Ga0495634_0394044 Ga0495634_0394044_294_812 166
521 3300046648 Ga0495611_0174174 Ga0495611_0174174_13_531 166
522 3300046660 Ga0495625_0274623 Ga0495625_0274623_280_798 166
523 3300046660 Ga0495625_0536515 Ga0495625_0536515_53_556 166
524 3300046663 Ga0495635_0090861 Ga0495635_0090861_1309_1809 166
525 3300046663 Ga0495635_0102556 Ga0495635_0102556_1279_1797 166
526 3300046664 Ga0495659_0250155 Ga0495659_0250155_93_611 166
527 3300046665 Ga0495661_0169867 Ga0495661_0169867_631_1149 166
528 3300046674 Ga0495588_0143243 Ga0495588_0143243_388_906 166
529 3300046675 Ga0495657_0011755 Ga0495657_0011755_1252_1752 166
530 3300046675 Ga0495657_0361038 Ga0495657_0361038_280_780 166
531 3300046678 Ga0495599_0005538 Ga0495599_0005538_5017_5517 166
532 3300046679 Ga0495623_0015881 Ga0495623_0015881_833_1333 166
533 3300046680 Ga0495646_0020397 Ga0495646_0020397_198_698 166
534 3300046680 Ga0495646_0169137 Ga0495646_0169137_44_562 166
535 3300046683 Ga0495658_0587474 Ga0495658_0587474_91_609 166
536 3300046684 Ga0495669_0014266 Ga0495669_0014266_268_786 166
537 3300046684 Ga0495669_0299130 Ga0495669_0299130_245_763 166
538 3300046689 Ga0495613_0166784 Ga0495613_0166784_125_643 166
539 3300046692 Ga0495671_0161733 Ga0495671_0161733_263_766 166
540 3300046692 Ga0495671_0222564 Ga0495671_0222564_244_762 166
541 3300046694 Ga0495649_0120774 Ga0495649_0120774_95_613 166
542 3300046794 Ga0495589_0084056 Ga0495589_0084056_499_1017 166
543 3300046794 Ga0495589_0329198 Ga0495589_0329198_143_646 166
544 3300046809 Ga0495600_0147270 Ga0495600_0147270_774_1292 166
545 3300046809 Ga0495600_0182408 Ga0495600_0182408_198_698 166
546 3300046810 Ga0495660_0309600 Ga0495660_0309600_115_633 166
547 3300047315 Ga0495581_0630063 Ga0495581_0630063_101_604 166
548 3300047317 Ga0495604_0032197 Ga0495604_0032197_1033_1533 166
549 3300047317 Ga0495604_0235671 Ga0495604_0235671_326_844 166
550 3300047317 Ga0495604_0442851 Ga0495604_0442851_203_706 166
551 3300047318 Ga0495636_0114962 Ga0495636_0114962_191_709 166
552 3300047319 Ga0495674_0040165 Ga0495674_0040165_1936_2436 166
553 3300047319 Ga0495674_0117043 Ga0495674_0117043_949_1467 166
554 3300047320 Ga0495672_0420459 Ga0495672_0420459_37_555 166
555 3300047322 Ga0495680_0032674 Ga0495680_0032674_1102_1602 166
556 3300047322 Ga0495680_0761933 Ga0495680_0761933_13_531 166
557 3300047444 Ga0495675_0028977 Ga0495675_0028977_71_571 166
558 3300047445 Ga0495677_0128955 Ga0495677_0128955_242_760 166
559 3300047446 Ga0495679_086633 Ga0495679_086633_249_764 166
560 3300047447 Ga0495685_072302 Ga0495685_072302_247_765 166
561 3300047470 Ga0495681_0118086 Ga0495681_0118086_365_883 166
562 3300047471 Ga0495684_0028966 Ga0495684_0028966_1863_2381 166
563 3300047471 Ga0495684_0033165 Ga0495684_0033165_761_1261 166
564 3300047472 Ga0495686_0098254 Ga0495686_0098254_901_1401 166
565 3300047472 Ga0495686_0309689 Ga0495686_0309689_137_640 166
566 3300047472 Ga0495686_0373863 Ga0495686_0373863_241_759 166
567 3300047673 Ga0495593_0211211 Ga0495593_0211211_288_806 166
568 3300048088 Ga0495602_0099301 Ga0495602_0099301_557_1057 166
569 3300048089 Ga0495614_0113685 Ga0495614_0113685_327_845 166
570 3300048090 Ga0495615_0085491 Ga0495615_0085491_102_620 166
571 3300048091 Ga0495626_0290351 Ga0495626_0290351_51_569 166
572 3300048904 Ga0496101_0154408 Ga0496101_0154408_1204_1722 166
573 3300048906 Ga0496103_0806292 Ga0496103_0806292_62_580 166
574 3300048907 Ga0496104_0056482 Ga0496104_0056482_2582_3100 166
575 3300048907 Ga0496104_0156921 Ga0496104_0156921_606_1124 166
576 3300048908 Ga0496105_0034864 Ga0496105_0034864_3011_3529 166
577 3300048908 Ga0496105_0288088 Ga0496105_0288088_230_733 166
578 3300048909 Ga0496106_0198104 Ga0496106_0198104_11_529 166
579 3300048909 Ga0496106_0268337 Ga0496106_0268337_758_1261 166
580 3300048909 Ga0496106_0571314 Ga0496106_0571314_199_717 166
581 3300048910 Ga0496107_0195303 Ga0496107_0195303_677_1195 166
582 3300048911 Ga0496108_0938772 Ga0496108_0938772_164_667 166
583 3300048913 Ga0496110_0215074 Ga0496110_0215074_445_963 166
584 3300048913 Ga0496110_0317481 Ga0496110_0317481_215_718 166
585 3300048913 Ga0496110_0376315 Ga0496110_0376315_455_973 166
586 3300048914 Ga0496111_0529448 Ga0496111_0529448_204_722 166
587 3300048915 Ga0496112_0006924 Ga0496112_0006924_3008_3526 166
588 3300048915 Ga0496112_0090831 Ga0496112_0090831_322_840 166
589 3300048915 Ga0496112_0149815 Ga0496112_0149815_1494_1997 166
590 3300048916 Ga0496113_0086279 Ga0496113_0086279_280_780 166
591 3300048916 Ga0496113_0238654 Ga0496113_0238654_151_654 166
592 3300048922 Ga0496119_0135808 Ga0496119_0135808_147_650 166
593 3300048924 Ga0496121_0087668 Ga0496121_0087668_226_729 166
594 3300048924 Ga0496121_0158350 Ga0496121_0158350_873_1376 166
595 3300048926 Ga0496123_0213462 Ga0496123_0213462_67_570 166
596 3300048927 Ga0496124_0071117 Ga0496124_0071117_2166_2669 166
597 3300048928 Ga0496125_0000040 Ga0496125_0000040_53691_54191 166
598 3300048929 Ga0496126_0020883 Ga0496126_0020883_5225_5728 166
599 3300049460 Ga0495682_0172079 Ga0495682_0172079_31_549 166
600 3300049583 Ga0501067_0310648 Ga0501067_0310648_103_606 166
601 3300050489 nmdc:mga03683_129021_c1 nmdc:mga03683_129021_c1_420_938 166
602 3300050489 nmdc:mga03683_240165_c1 nmdc:mga03683_240165_c1_13_531 166
603 3300050490 nmdc:mga03n38_241069_c1 nmdc:mga03n38_241069_c1_289_789 166
604 3300050490 nmdc:mga03n38_2988_c1 nmdc:mga03n38_2988_c1_1965_2483 166
605 3300050491 nmdc:mga00v17_71775_c1 nmdc:mga00v17_71775_c1_490_993 166
606 3300050492 nmdc:mga0yw44_133459_c1 nmdc:mga0yw44_133459_c1_26_529 166
607 3300050492 nmdc:mga0yw44_139144_c1 nmdc:mga0yw44_139144_c1_189_692 166
608 3300050492 nmdc:mga0yw44_378424_c1 nmdc:mga0yw44_378424_c1_219_737 166
609 3300050493 nmdc:mga0k408_290094_c1 nmdc:mga0k408_290094_c1_329_832 166
610 3300050494 nmdc:mga06z11_440500_c1 nmdc:mga06z11_440500_c1_95_598 166
611 3300050494 nmdc:mga06z11_61125_c1 nmdc:mga06z11_61125_c1_413_931 166
612 3300050496 nmdc:mga07m45_22659_c1 nmdc:mga07m45_22659_c1_1784_2302 166
613 3300050496 nmdc:mga07m45_531273_c1 nmdc:mga07m45_531273_c1_33_536 166
614 3300050511 nmdc:mga08y16_369268_c1 nmdc:mga08y16_369268_c1_624_1142 166
615 3300050512 nmdc:mga0n895_15503_c1 nmdc:mga0n895_15503_c1_2790_3335 166
616 3300050515 nmdc:mga0a205_223818_c1 nmdc:mga0a205_223818_c1_846_1349 166
617 3300050516 nmdc:mga0sz30_29942_c1 nmdc:mga0sz30_29942_c1_846_1349 166
618 3300053077 Ga0495601_0175156 Ga0495601_0175156_159_677 166
619 3300053080 Ga0500635_0092058 Ga0500635_0092058_465_983 166
620 3300053083 Ga0495655_0249085 Ga0495655_0249085_29_547 166
621 3300053085 Ga0495619_0089151 Ga0495619_0089151_1388_1888 166
622 3300053090 Ga0500646_0024762 Ga0500646_0024762_30_533 166
623 3300053091 Ga0500647_0283931 Ga0500647_0283931_134_652 166
624 3300053094 Ga0500566_0038049 Ga0500566_0038049_735_1253 166
625 3300053096 Ga0500641_0008512 Ga0500641_0008512_719_1222 166
626 3300053102 Ga0500554_000257 Ga0500554_000257_804_1322 166
627 3300053118 Ga0500594_0117380 Ga0500594_0117380_279_782 166
628 3300053119 Ga0500595_002263 Ga0500595_002263_5315_5833 166
629 3300053134 Ga0500658_0231389 Ga0500658_0231389_116_634 166
630 3300053147 Ga0500589_012741 Ga0500589_012741_2984_3487 166
631 3300053150 Ga0500603_000177 Ga0500603_000177_10201_10719 166
632 3300053150 Ga0500603_006316 Ga0500603_006316_1003_1521 166
633 3300053162 Ga0500638_025050 Ga0500638_025050_81_599 166
634 3300053177 Ga0500636_0002975 Ga0500636_0002975_4018_4518 166
635 3300053178 Ga0500637_0000927 Ga0500637_0000927_8463_8981 166
636 3300053178 Ga0500637_0002404 Ga0500637_0002404_5315_5833 166
637 3300055283 Ga0500661_000024 Ga0500661_000024_8691_9209 166
638 3300059491 Ga0587070_092344 Ga0587070_092344_147_650 166
639 3300059645 Ga0587076_132961 Ga0587076_132961_46_549 166
640 iso_pu_bacteria 2721755755 2723843721 166

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wjc-assembly1.cif.gz_B crystal structure of mutant nitrobindin m75l/h76l/q96c/m148l/h158l covalently linked with [rh(cp-mal)(cod)] (nb4-rh) from arabidopsis thaliana 0.8294 35 166
4ymy-assembly1.cif.gz_A-2 crystal structure of mutant nitrobindin m75a/h76l/q96c/m148l/h158a (nb11) from arabidopsis thaliana 0.8103 35 166
3wjg-assembly1.cif.gz_A-2 crystal structure of mutant nitrobindin m75l/h76l/q96c/m148w/h158l (nb10) from arabidopsis thaliana 0.8087 35 166
7bbm-assembly1.cif.gz_A-2 mutant nitrobindin m75l/h76l/q96c/m148l (nb4h) from arabidopsis thaliana with cofactor mnppix 0.8086 35 166
3wje-assembly1.cif.gz_A crystal structure of mutant nitrobindin m75w/h76l/q96c/m148l/h158l (nb6) from arabidopsis thaliana 0.8012 35 166
ID Description Score Start End Superfamily
2vt8A00 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; 0.819 120 162 3.40.1000.30
af_A0A1D6NFT9_14_110_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8134 39 119 2.40.128.20
af_Q22857_66_227_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8128 40 166 2.40.128.20
3wjeB00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7896 35 166 2.40.128.20
2fr2A00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7854 40 166 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A6L3T2C0-F1-model_v4 Uncharacterized protein 0.9804 35 166
AF-A0A2A2VDC0-F1-model_v4 Uncharacterized protein 0.9789 40 165
AF-A0A2A2VDC0-F1-model_v4 Uncharacterized protein 0.9636 40 165
AF-A0A2S5MTQ3-F1-model_v4 Lipocalin-like domain-containing protein 0.9622 39 166
AF-A0A537UGA3-F1-model_v4 Uncharacterized protein 0.9407 24 166

Feature Viewer

pLDDT pTM Quality
80.38 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map