F471739
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 640 | 400 | 615 | 169 |
Family's Representative Sequence
| Representative Sequence | 3300053111|Ga0500572_000250|Ga0500572_000250_3833_4387 |
| Length | 184 |
| Sequence | VFDAAGRVLQKSVIMDGKLDMKLFGSTLSGHAIRAAGLGAALILSVSAGHAQSGPFAGFNGSWSGNGTVALSDGTTERIRCKASYKVAGANLKQTLQCASDSYKFDLSSDVTSQGDRISGNWSEASRNVNGELQGTAGNGQIEVFVQAAGFAASISLRTNGNKQTVQISSKGEIRGVNITMVKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 5 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 6 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 7 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 8 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 9 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 10 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 11 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 12 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 13 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 14 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 15 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 120 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 123 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 124 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 187 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 222 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 223 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 224 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 226 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 232 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 233 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 234 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 237 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 238 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 239 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 240 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 241 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 329 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 330 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 331 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 332 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 333 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 335 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 336 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 337 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 338 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 339 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 340 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 341 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 342 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 343 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 344 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 345 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 346 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 347 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 350 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 351 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 352 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 353 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 354 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 355 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 356 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 362 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 365 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 366 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 367 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 368 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 369 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 370 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 371 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 372 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 373 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 374 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 375 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 376 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 377 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 378 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 379 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 381 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 382 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 383 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 384 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 385 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 386 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 388 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 390 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 391 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 392 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 395 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 396 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 397 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 398 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 399 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 400 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.19 |
| Metatranscriptomes | 2.35 |
| Isolates | 3.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.31 |
| Nodule | 2.34 |
| Rhizoplane | 4.38 |
| Rhizosphere | 76.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10021439 | 3300001989 | Bacteria | 2299 |
| 2 | JGI24735J21928_10034819 | 3300002067 | Bacteria | 1483 |
| 3 | JGI24742J22300_10005518 | 3300002244 | Bacteria | 2080 |
| 4 | JGI25160J50197_1005054 | 3300003354 | Bacteria | 5573 |
| 5 | JGI25404J52841_10000472 | 3300003659 | Bacteria | 5781 |
| 6 | JGI25404J52841_10001192 | 3300003659 | Bacteria | 4457 |
| 7 | JGI25404J52841_10091650 | 3300003659 | Bacteria | 636 |
| 8 | Ga0065165_1031789 | 3300005262 | Bacteria | 1663 |
| 9 | Ga0070670_100414765 | 3300005331 | Bacteria | 1190 |
| 10 | Ga0068869_101153295 | 3300005334 | Bacteria | 680 |
| 11 | Ga0070666_10114566 | 3300005335 | Bacteria | 1867 |
| 12 | Ga0070680_100164333 | 3300005336 | Bacteria | 1866 |
| 13 | Ga0068868_100025999 | 3300005338 | Bacteria | 4458 |
| 14 | Ga0070661_100322318 | 3300005344 | Bacteria | 1207 |
| 15 | Ga0070661_100681741 | 3300005344 | Unclassified | 836 |
| 16 | Ga0070668_100126984 | 3300005347 | Bacteria | 2043 |
| 17 | Ga0070668_100185255 | 3300005347 | Bacteria | 1702 |
| 18 | Ga0070668_100420924 | 3300005347 | Bacteria | 1144 |
| 19 | Ga0070669_100097261 | 3300005353 | Bacteria | 2216 |
| 20 | Ga0070671_100133258 | 3300005355 | Bacteria | 2093 |
| 21 | Ga0070671_100147120 | 3300005355 | Bacteria | 1989 |
| 22 | Ga0070674_100014302 | 3300005356 | Bacteria | 4932 |
| 23 | Ga0070674_100287503 | 3300005356 | Bacteria | 1306 |
| 24 | Ga0070673_100925860 | 3300005364 | Bacteria | 809 |
| 25 | Ga0070659_100137452 | 3300005366 | Bacteria | 1988 |
| 26 | Ga0070667_100496971 | 3300005367 | Bacteria | 1118 |
| 27 | Ga0070667_100690790 | 3300005367 | Bacteria | 944 |
| 28 | Ga0070667_101028885 | 3300005367 | Bacteria | 769 |
| 29 | Ga0070709_10003112 | 3300005434 | Bacteria | 8901 |
| 30 | Ga0070709_10897152 | 3300005434 | Bacteria | 701 |
| 31 | Ga0070714_100007436 | 3300005435 | Bacteria | 8525 |
| 32 | Ga0070713_100033918 | 3300005436 | Bacteria | 4094 |
| 33 | Ga0070710_10002974 | 3300005437 | Bacteria | 8047 |
| 34 | Ga0070711_100005217 | 3300005439 | Bacteria | 7750 |
| 35 | Ga0070700_100223796 | 3300005441 | Bacteria | 1335 |
| 36 | Ga0070663_100021567 | 3300005455 | Bacteria | 4288 |
| 37 | Ga0070663_100065758 | 3300005455 | Bacteria | 2625 |
| 38 | Ga0070663_100104934 | 3300005455 | Bacteria | 2114 |
| 39 | Ga0070663_100165490 | 3300005455 | Bacteria | 1705 |
| 40 | Ga0070663_100450259 | 3300005455 | Bacteria | 1061 |
| 41 | Ga0070678_100242493 | 3300005456 | Bacteria | 1508 |
| 42 | Ga0070662_100034535 | 3300005457 | Bacteria | 3566 |
| 43 | Ga0070681_10691779 | 3300005458 | Bacteria | 935 |
| 44 | Ga0068867_100330967 | 3300005459 | Bacteria | 1265 |
| 45 | Ga0068867_101769664 | 3300005459 | Bacteria | 580 |
| 46 | Ga0070706_100606940 | 3300005467 | Bacteria | 1016 |
| 47 | Ga0070707_100294403 | 3300005468 | Bacteria | 1577 |
| 48 | Ga0070698_100016851 | 3300005471 | Bacteria | 7707 |
| 49 | Ga0070698_100222476 | 3300005471 | Bacteria | 1821 |
| 50 | Ga0070679_100206259 | 3300005530 | Bacteria | 1930 |
| 51 | Ga0070679_100914565 | 3300005530 | Bacteria | 821 |
| 52 | Ga0070697_100090499 | 3300005536 | Bacteria | 2529 |
| 53 | Ga0068853_100413217 | 3300005539 | Bacteria | 1264 |
| 54 | Ga0068853_100500849 | 3300005539 | Bacteria | 1147 |
| 55 | Ga0068853_100580304 | 3300005539 | Bacteria | 1064 |
| 56 | Ga0068853_100657360 | 3300005539 | Unclassified | 998 |
| 57 | Ga0068853_100708305 | 3300005539 | Bacteria | 961 |
| 58 | Ga0068853_100713639 | 3300005539 | Bacteria | 957 |
| 59 | Ga0070686_100079904 | 3300005544 | Bacteria | 2162 |
| 60 | Ga0070686_100177507 | 3300005544 | Bacteria | 1511 |
| 61 | Ga0070665_100247668 | 3300005548 | Bacteria | 1782 |
| 62 | Ga0070665_100318443 | 3300005548 | Bacteria | 1559 |
| 63 | Ga0068855_100016472 | 3300005563 | Bacteria | 8888 |
| 64 | Ga0068855_100016926 | 3300005563 | Bacteria | 8767 |
| 65 | Ga0068855_100017121 | 3300005563 | Bacteria | 8719 |
| 66 | Ga0068855_100031441 | 3300005563 | Bacteria | 6338 |
| 67 | Ga0068855_100111709 | 3300005563 | Bacteria | 3137 |
| 68 | Ga0070664_100155727 | 3300005564 | Bacteria | 2019 |
| 69 | Ga0070664_101178611 | 3300005564 | Unclassified | 722 |
| 70 | Ga0068857_100002567 | 3300005577 | Bacteria | 14871 |
| 71 | Ga0068857_100058887 | 3300005577 | Bacteria | 3411 |
| 72 | Ga0068857_100498540 | 3300005577 | Bacteria | 1143 |
| 73 | Ga0068854_100005650 | 3300005578 | Bacteria | 7901 |
| 74 | Ga0068854_100048779 | 3300005578 | Bacteria | 3022 |
| 75 | Ga0068856_100013475 | 3300005614 | Bacteria | 7913 |
| 76 | Ga0068856_100052415 | 3300005614 | Bacteria | 4023 |
| 77 | Ga0068856_100090447 | 3300005614 | Bacteria | 3044 |
| 78 | Ga0068856_100696942 | 3300005614 | Bacteria | 1036 |
| 79 | Ga0068856_100810441 | 3300005614 | Bacteria | 956 |
| 80 | Ga0070702_100543776 | 3300005615 | Bacteria | 861 |
| 81 | Ga0068852_100027768 | 3300005616 | Bacteria | 4618 |
| 82 | Ga0068852_100112618 | 3300005616 | Bacteria | 2476 |
| 83 | Ga0068852_101137950 | 3300005616 | Bacteria | 801 |
| 84 | Ga0068866_10175774 | 3300005718 | Bacteria | 1261 |
| 85 | Ga0068861_100016647 | 3300005719 | Bacteria | 5206 |
| 86 | Ga0068851_10067598 | 3300005834 | Bacteria | 1843 |
| 87 | Ga0068851_10381156 | 3300005834 | Bacteria | 826 |
| 88 | Ga0068870_10046705 | 3300005840 | Bacteria | 2272 |
| 89 | Ga0068870_10073656 | 3300005840 | Bacteria | 1869 |
| 90 | Ga0068863_100071362 | 3300005841 | Bacteria | 3285 |
| 91 | Ga0068863_100198537 | 3300005841 | Bacteria | 1929 |
| 92 | Ga0068860_100824200 | 3300005843 | Bacteria | 942 |
| 93 | Ga0068862_100086289 | 3300005844 | Bacteria | 2728 |
| 94 | Ga0068862_100124463 | 3300005844 | Bacteria | 2275 |
| 95 | Ga0081538_10042772 | 3300005981 | Bacteria | 2853 |
| 96 | Ga0081540_1002148 | 3300005983 | Bacteria | 16397 |
| 97 | Ga0081540_1003328 | 3300005983 | Bacteria | 12745 |
| 98 | Ga0081540_1011376 | 3300005983 | Bacteria | 5950 |
| 99 | Ga0081540_1014260 | 3300005983 | Bacteria | 5104 |
| 100 | Ga0081540_1016711 | 3300005983 | Bacteria | 4575 |
| 101 | Ga0081540_1069264 | 3300005983 | Bacteria | 1640 |
| 102 | Ga0070717_10302177 | 3300006028 | Bacteria | 1423 |
| 103 | Ga0075365_10006380 | 3300006038 | Bacteria | 6485 |
| 104 | Ga0075365_10206582 | 3300006038 | Bacteria | 1376 |
| 105 | Ga0075368_10037733 | 3300006042 | Bacteria | 1890 |
| 106 | Ga0075363_100000789 | 3300006048 | Bacteria | 10928 |
| 107 | Ga0075364_10195200 | 3300006051 | Bacteria | 1371 |
| 108 | Ga0075364_10215388 | 3300006051 | Bacteria | 1303 |
| 109 | Ga0070715_10100380 | 3300006163 | Bacteria | 1349 |
| 110 | Ga0070716_100010881 | 3300006173 | Bacteria | 4575 |
| 111 | Ga0070716_100166269 | 3300006173 | Bacteria | 1435 |
| 112 | Ga0070716_100174306 | 3300006173 | Unclassified | 1406 |
| 113 | Ga0075362_10160698 | 3300006177 | Bacteria | 1082 |
| 114 | Ga0075362_10207899 | 3300006177 | Bacteria | 954 |
| 115 | Ga0075367_10008506 | 3300006178 | Bacteria | 5321 |
| 116 | Ga0075369_10063102 | 3300006186 | Bacteria | 1620 |
| 117 | Ga0075369_10315230 | 3300006186 | Bacteria | 731 |
| 118 | Ga0075366_10142891 | 3300006195 | Bacteria | 1447 |
| 119 | Ga0075370_10036971 | 3300006353 | Bacteria | 2744 |
| 120 | Ga0075370_10314875 | 3300006353 | Bacteria | 932 |
| 121 | Ga0068871_100227162 | 3300006358 | Bacteria | 1619 |
| 122 | Ga0068871_100587638 | 3300006358 | Bacteria | 1012 |
| 123 | Ga0075428_100394355 | 3300006844 | Bacteria | 1484 |
| 124 | Ga0075434_100007277 | 3300006871 | Bacteria | 10239 |
| 125 | Ga0075434_100365573 | 3300006871 | Bacteria | 1464 |
| 126 | Ga0068865_100541314 | 3300006881 | Bacteria | 976 |
| 127 | Ga0075435_100343275 | 3300007076 | Bacteria | 1279 |
| 128 | Ga0099794_10009233 | 3300007265 | Bacteria | 4135 |
| 129 | Ga0099794_10043047 | 3300007265 | Bacteria | 2155 |
| 130 | Ga0099794_10113386 | 3300007265 | Bacteria | 1360 |
| 131 | Ga0099795_10243642 | 3300007788 | Bacteria | 773 |
| 132 | Ga0105240_10003917 | 3300009093 | Bacteria | 22988 |
| 133 | Ga0105240_10055702 | 3300009093 | Bacteria | 4950 |
| 134 | Ga0105240_10072102 | 3300009093 | Bacteria | 4270 |
| 135 | Ga0111539_11152256 | 3300009094 | Bacteria | 901 |
| 136 | Ga0105245_10206288 | 3300009098 | Bacteria | 1890 |
| 137 | Ga0105247_10388744 | 3300009101 | Bacteria | 991 |
| 138 | Ga0105247_10645119 | 3300009101 | Bacteria | 790 |
| 139 | Ga0105243_10408740 | 3300009148 | Bacteria | 1263 |
| 140 | Ga0105243_11039984 | 3300009148 | Bacteria | 824 |
| 141 | Ga0105241_10002672 | 3300009174 | Bacteria | 13361 |
| 142 | Ga0105241_10012909 | 3300009174 | Bacteria | 6129 |
| 143 | Ga0105241_10540860 | 3300009174 | Bacteria | 1044 |
| 144 | Ga0105248_10132082 | 3300009177 | Bacteria | 2817 |
| 145 | Ga0105237_10033420 | 3300009545 | Bacteria | 5210 |
| 146 | Ga0105237_10157755 | 3300009545 | Bacteria | 2266 |
| 147 | Ga0105237_10270532 | 3300009545 | Bacteria | 1702 |
| 148 | Ga0105237_10336991 | 3300009545 | Bacteria | 1513 |
| 149 | Ga0105237_10375552 | 3300009545 | Bacteria | 1426 |
| 150 | Ga0105238_10011847 | 3300009551 | Bacteria | 8783 |
| 151 | Ga0105238_10043500 | 3300009551 | Bacteria | 4544 |
| 152 | Ga0105238_10117620 | 3300009551 | Bacteria | 2638 |
| 153 | Ga0105238_10135849 | 3300009551 | Bacteria | 2436 |
| 154 | Ga0105238_10207742 | 3300009551 | Bacteria | 1934 |
| 155 | Ga0105238_10953115 | 3300009551 | Bacteria | 878 |
| 156 | Ga0105249_11337409 | 3300009553 | Bacteria | 788 |
| 157 | Ga0099796_10050507 | 3300010159 | Bacteria | 1442 |
| 158 | Ga0105239_10005731 | 3300010375 | Bacteria | 14500 |
| 159 | Ga0105239_10118596 | 3300010375 | Bacteria | 2937 |
| 160 | Ga0105239_10152059 | 3300010375 | Bacteria | 2583 |
| 161 | Ga0105239_10202910 | 3300010375 | Bacteria | 2222 |
| 162 | Ga0105239_11173993 | 3300010375 | Bacteria | 884 |
| 163 | Ga0105246_10018834 | 3300011119 | Bacteria | 4402 |
| 164 | Ga0105246_10120812 | 3300011119 | Bacteria | 1941 |
| 165 | Ga0157341_1000853 | 3300012494 | Bacteria | 1685 |
| 166 | Ga0157370_10195235 | 3300013104 | Bacteria | 1879 |
| 167 | Ga0157370_10731622 | 3300013104 | Bacteria | 902 |
| 168 | Ga0157369_10004254 | 3300013105 | Bacteria | 16952 |
| 169 | Ga0157369_10321336 | 3300013105 | Bacteria | 1609 |
| 170 | Ga0157369_10324636 | 3300013105 | Bacteria | 1600 |
| 171 | Ga0157378_10178208 | 3300013297 | Bacteria | 1998 |
| 172 | Ga0157378_10353806 | 3300013297 | Bacteria | 1435 |
| 173 | Ga0157378_10687754 | 3300013297 | Bacteria | 1041 |
| 174 | Ga0157378_11764968 | 3300013297 | Bacteria | 666 |
| 175 | Ga0163162_10599638 | 3300013306 | Bacteria | 1228 |
| 176 | Ga0163162_10627786 | 3300013306 | Bacteria | 1199 |
| 177 | Ga0157372_10072697 | 3300013307 | Bacteria | 3876 |
| 178 | Ga0157372_11133771 | 3300013307 | Bacteria | 904 |
| 179 | Ga0157375_10244925 | 3300013308 | Bacteria | 1953 |
| 180 | Ga0157375_11089005 | 3300013308 | Bacteria | 935 |
| 181 | Ga0163163_10211478 | 3300014325 | Bacteria | 1989 |
| 182 | Ga0157380_10053042 | 3300014326 | Bacteria | 3213 |
| 183 | Ga0157380_10181823 | 3300014326 | Bacteria | 1848 |
| 184 | Ga0182008_10482588 | 3300014497 | Bacteria | 679 |
| 185 | Ga0157376_10425805 | 3300014969 | Bacteria | 1289 |
| 186 | Ga0157376_10743192 | 3300014969 | Bacteria | 989 |
| 187 | Ga0163161_10271495 | 3300017792 | Bacteria | 1327 |
| 188 | Ga0206349_1461959 | 3300020075 | Bacteria | 731 |
| 189 | Ga0206352_10796597 | 3300020078 | Bacteria | 723 |
| 190 | Ga0206350_10048311 | 3300020080 | Bacteria | 602 |
| 191 | Ga0206354_10396399 | 3300020081 | Bacteria | 828 |
| 192 | Ga0154015_1510599 | 3300020610 | Bacteria | 1059 |
| 193 | Ga0213873_10009607 | 3300021358 | Bacteria | 2014 |
| 194 | Ga0213873_10096041 | 3300021358 | Bacteria | 847 |
| 195 | Ga0213874_10196572 | 3300021377 | Bacteria | 724 |
| 196 | Ga0213876_10002980 | 3300021384 | Bacteria | 9807 |
| 197 | Ga0213875_10176625 | 3300021388 | Bacteria | 1003 |
| 198 | Ga0213875_10511004 | 3300021388 | Bacteria | 578 |
| 199 | Ga0213871_10025594 | 3300021441 | Bacteria | 1503 |
| 200 | Ga0224712_10103731 | 3300022467 | Bacteria | 1210 |
| 201 | Ga0224712_10300031 | 3300022467 | Bacteria | 751 |
| 202 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 203 | Ga0209758_1004160 | 3300025297 | Bacteria | 12329 |
| 204 | Ga0209051_1066476 | 3300025303 | Bacteria | 1107 |
| 205 | Ga0207697_10085541 | 3300025315 | Bacteria | 1332 |
| 206 | Ga0207656_10250066 | 3300025321 | Bacteria | 868 |
| 207 | Ga0207692_10025911 | 3300025898 | Bacteria | 2746 |
| 208 | Ga0207692_10291534 | 3300025898 | Bacteria | 990 |
| 209 | Ga0207710_10009512 | 3300025900 | Bacteria | 4088 |
| 210 | Ga0207710_10034072 | 3300025900 | Bacteria | 2236 |
| 211 | Ga0207647_10003198 | 3300025904 | Bacteria | 12279 |
| 212 | Ga0207699_10000204 | 3300025906 | Bacteria | 35531 |
| 213 | Ga0207699_10946293 | 3300025906 | Bacteria | 636 |
| 214 | Ga0207645_10040688 | 3300025907 | Bacteria | 2976 |
| 215 | Ga0207645_10263742 | 3300025907 | Bacteria | 1141 |
| 216 | Ga0207645_10377158 | 3300025907 | Bacteria | 952 |
| 217 | Ga0207643_10011042 | 3300025908 | Bacteria | 4874 |
| 218 | Ga0207684_10092912 | 3300025910 | Bacteria | 2572 |
| 219 | Ga0207654_10024350 | 3300025911 | Bacteria | 3254 |
| 220 | Ga0207654_10034013 | 3300025911 | Bacteria | 2829 |
| 221 | Ga0207695_10000424 | 3300025913 | Bacteria | 93657 |
| 222 | Ga0207695_10012405 | 3300025913 | Bacteria | 10234 |
| 223 | Ga0207695_10149175 | 3300025913 | Bacteria | 2279 |
| 224 | Ga0207695_10385302 | 3300025913 | Bacteria | 1287 |
| 225 | Ga0207671_10079659 | 3300025914 | Bacteria | 2455 |
| 226 | Ga0207671_10129439 | 3300025914 | Bacteria | 1936 |
| 227 | Ga0207671_10170922 | 3300025914 | Bacteria | 1688 |
| 228 | Ga0207693_10028299 | 3300025915 | Bacteria | 4428 |
| 229 | Ga0207663_10024044 | 3300025916 | Bacteria | 3506 |
| 230 | Ga0207660_10709395 | 3300025917 | Bacteria | 821 |
| 231 | Ga0207649_10268370 | 3300025920 | Bacteria | 1236 |
| 232 | Ga0207652_10171583 | 3300025921 | Bacteria | 1946 |
| 233 | Ga0207652_10231775 | 3300025921 | Bacteria | 1664 |
| 234 | Ga0207646_10175749 | 3300025922 | Bacteria | 1934 |
| 235 | Ga0207681_10552068 | 3300025923 | Bacteria | 948 |
| 236 | Ga0207681_10747233 | 3300025923 | Bacteria | 815 |
| 237 | Ga0207694_10000119 | 3300025924 | Bacteria | 83771 |
| 238 | Ga0207694_10060044 | 3300025924 | Bacteria | 2958 |
| 239 | Ga0207694_10079907 | 3300025924 | Bacteria | 2566 |
| 240 | Ga0207650_10249368 | 3300025925 | Bacteria | 1437 |
| 241 | Ga0207700_10009772 | 3300025928 | Bacteria | 6015 |
| 242 | Ga0207664_10704221 | 3300025929 | Bacteria | 908 |
| 243 | Ga0207644_10088691 | 3300025931 | Bacteria | 2301 |
| 244 | Ga0207690_10424637 | 3300025932 | Bacteria | 1064 |
| 245 | Ga0207706_10343491 | 3300025933 | Bacteria | 1298 |
| 246 | Ga0207706_10550529 | 3300025933 | Bacteria | 993 |
| 247 | Ga0207686_10457169 | 3300025934 | Bacteria | 983 |
| 248 | Ga0207709_10700204 | 3300025935 | Bacteria | 811 |
| 249 | Ga0207669_10058015 | 3300025937 | Bacteria | 2360 |
| 250 | Ga0207704_10063870 | 3300025938 | Bacteria | 2297 |
| 251 | Ga0207704_10336993 | 3300025938 | Bacteria | 1169 |
| 252 | Ga0207665_10002479 | 3300025939 | Bacteria | 12444 |
| 253 | Ga0207665_10216788 | 3300025939 | Unclassified | 1401 |
| 254 | Ga0207691_10540647 | 3300025940 | Bacteria | 988 |
| 255 | Ga0207711_10254250 | 3300025941 | Bacteria | 1614 |
| 256 | Ga0207689_10038611 | 3300025942 | Bacteria | 3954 |
| 257 | Ga0207689_10325483 | 3300025942 | Bacteria | 1276 |
| 258 | Ga0207679_10319723 | 3300025945 | Bacteria | 1343 |
| 259 | Ga0207679_11081388 | 3300025945 | Unclassified | 736 |
| 260 | Ga0207667_10008027 | 3300025949 | Bacteria | 12593 |
| 261 | Ga0207667_10057455 | 3300025949 | Bacteria | 4084 |
| 262 | Ga0207651_10053509 | 3300025960 | Bacteria | 2760 |
| 263 | Ga0207651_11451177 | 3300025960 | Bacteria | 618 |
| 264 | Ga0207668_10022936 | 3300025972 | Bacteria | 4002 |
| 265 | Ga0207668_10585561 | 3300025972 | Bacteria | 970 |
| 266 | Ga0207640_10006001 | 3300025981 | Bacteria | 6638 |
| 267 | Ga0207658_10590830 | 3300025986 | Bacteria | 997 |
| 268 | Ga0207703_10058819 | 3300026035 | Bacteria | 3138 |
| 269 | Ga0207703_10485271 | 3300026035 | Bacteria | 1158 |
| 270 | Ga0207639_10009164 | 3300026041 | Bacteria | 6822 |
| 271 | Ga0207639_10090472 | 3300026041 | Bacteria | 2448 |
| 272 | Ga0207639_10207692 | 3300026041 | Bacteria | 1684 |
| 273 | Ga0207639_10602948 | 3300026041 | Bacteria | 1013 |
| 274 | Ga0207639_11594870 | 3300026041 | Bacteria | 612 |
| 275 | Ga0207678_10039602 | 3300026067 | Bacteria | 4090 |
| 276 | Ga0207678_10057735 | 3300026067 | Bacteria | 3340 |
| 277 | Ga0207678_10146825 | 3300026067 | Bacteria | 2013 |
| 278 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 279 | Ga0207702_10007362 | 3300026078 | Bacteria | 9400 |
| 280 | Ga0207702_10163454 | 3300026078 | Bacteria | 2035 |
| 281 | Ga0207702_10380415 | 3300026078 | Bacteria | 1357 |
| 282 | Ga0207702_10813991 | 3300026078 | Bacteria | 924 |
| 283 | Ga0207641_10962871 | 3300026088 | Bacteria | 849 |
| 284 | Ga0207648_10150855 | 3300026089 | Bacteria | 2051 |
| 285 | Ga0207676_10064094 | 3300026095 | Bacteria | 2921 |
| 286 | Ga0207676_10825961 | 3300026095 | Bacteria | 905 |
| 287 | Ga0207674_10001403 | 3300026116 | Bacteria | 31095 |
| 288 | Ga0207674_10003336 | 3300026116 | Bacteria | 19740 |
| 289 | Ga0207674_10490379 | 3300026116 | Bacteria | 1187 |
| 290 | Ga0207675_100446579 | 3300026118 | Bacteria | 1281 |
| 291 | Ga0207683_10088488 | 3300026121 | Bacteria | 2755 |
| 292 | Ga0207683_10165671 | 3300026121 | Bacteria | 1999 |
| 293 | Ga0207698_10114018 | 3300026142 | Bacteria | 2272 |
| 294 | Ga0207698_10404562 | 3300026142 | Bacteria | 1305 |
| 295 | Ga0207698_10430350 | 3300026142 | Bacteria | 1269 |
| 296 | Ga0209179_1001160 | 3300027512 | Bacteria | 3099 |
| 297 | Ga0209588_1002049 | 3300027671 | Bacteria | 5439 |
| 298 | Ga0207428_10423596 | 3300027907 | Bacteria | 973 |
| 299 | Ga0268266_10007641 | 3300028379 | Bacteria | 9722 |
| 300 | Ga0268266_10204944 | 3300028379 | Bacteria | 1806 |
| 301 | Ga0268265_10164205 | 3300028380 | Bacteria | 1890 |
| 302 | Ga0268265_10346076 | 3300028380 | Bacteria | 1355 |
| 303 | Ga0268264_10298325 | 3300028381 | Bacteria | 1516 |
| 304 | Ga0268264_10300312 | 3300028381 | Bacteria | 1511 |
| 305 | Ga0268264_10824206 | 3300028381 | Bacteria | 928 |
| 306 | Ga0265337_1015924 | 3300028556 | Bacteria | 2446 |
| 307 | Ga0265319_1015825 | 3300028563 | Bacteria | 2909 |
| 308 | Ga0265323_10001015 | 3300028653 | Bacteria | 14625 |
| 309 | Ga0265322_10031044 | 3300028654 | Bacteria | 1525 |
| 310 | Ga0265336_10001855 | 3300028666 | Bacteria | 9171 |
| 311 | Ga0265338_10000034 | 3300028800 | Bacteria | 244623 |
| 312 | Ga0265324_10010129 | 3300029957 | Bacteria | 3651 |
| 313 | Ga0265762_1070772 | 3300030760 | Bacteria | 732 |
| 314 | Ga0265760_10128597 | 3300031090 | Bacteria | 818 |
| 315 | Ga0307509_10100629 | 3300031507 | Bacteria | 2928 |
| 316 | Ga0307408_100336685 | 3300031548 | Bacteria | 1276 |
| 317 | Ga0307508_10099082 | 3300031616 | Bacteria | 2508 |
| 318 | Ga0265314_10025180 | 3300031711 | Bacteria | 4495 |
| 319 | Ga0265314_10042546 | 3300031711 | Bacteria | 3239 |
| 320 | Ga0265342_10007437 | 3300031712 | Bacteria | 8014 |
| 321 | Ga0307405_10698304 | 3300031731 | Bacteria | 840 |
| 322 | Ga0307412_10163237 | 3300031911 | Bacteria | 1658 |
| 323 | Ga0307416_101129291 | 3300032002 | Bacteria | 889 |
| 324 | Ga0307414_10150456 | 3300032004 | Bacteria | 1836 |
| 325 | Ga0307415_100643805 | 3300032126 | Bacteria | 949 |
| 326 | Ga0373934_0025224 | 3300035086 | Bacteria | 2301 |
| 327 | Ga0373934_0154505 | 3300035086 | Bacteria | 940 |
| 328 | Ga0373923_0055492 | 3300035111 | Bacteria | 1670 |
| 329 | Ga0373936_0130961 | 3300035113 | Bacteria | 1078 |
| 330 | Ga0373945_0165776 | 3300035116 | Bacteria | 903 |
| 331 | Ga0373954_0010657 | 3300035118 | Bacteria | 4061 |
| 332 | Ga0373954_0017973 | 3300035118 | Bacteria | 3179 |
| 333 | Ga0373956_0015069 | 3300035119 | Bacteria | 3232 |
| 334 | Ga0373956_0099609 | 3300035119 | Bacteria | 1347 |
| 335 | Ga0373957_0031050 | 3300035120 | Bacteria | 1961 |
| 336 | Ga0373957_0040807 | 3300035120 | Bacteria | 1746 |
| 337 | Ga0373943_0011977 | 3300035170 | Bacteria | 3904 |
| 338 | Ga0373943_0024541 | 3300035170 | Bacteria | 2812 |
| 339 | Ga0373943_0524697 | 3300035170 | Bacteria | 693 |
| 340 | Ga0373946_0365309 | 3300035171 | Bacteria | 724 |
| 341 | Ga0373955_0061075 | 3300035172 | Bacteria | 2080 |
| 342 | Ga0373955_0076606 | 3300035172 | Bacteria | 1881 |
| 343 | Ga0373924_0031931 | 3300035410 | Bacteria | 2119 |
| 344 | Ga0373924_0243713 | 3300035410 | Bacteria | 795 |
| 345 | Ga0373931_0019175 | 3300035691 | Bacteria | 3411 |
| 346 | Ga0373935_0194267 | 3300035692 | Bacteria | 1399 |
| 347 | Ga0373927_0006061 | 3300035695 | Bacteria | 8282 |
| 348 | Ga0373927_0075982 | 3300035695 | Bacteria | 2175 |
| 349 | Ga0373933_0184492 | 3300035724 | Bacteria | 1331 |
| 350 | Ga0373933_0272238 | 3300035724 | Bacteria | 1093 |
| 351 | Ga0373933_0311232 | 3300035724 | Bacteria | 1020 |
| 352 | Ga0373947_0050666 | 3300035725 | Bacteria | 2496 |
| 353 | Ga0373947_0110591 | 3300035725 | Bacteria | 1736 |
| 354 | Ga0373947_0213873 | 3300035725 | Bacteria | 1265 |
| 355 | Ga0310104_04734 | 3300036242 | Bacteria | 1170 |
| 356 | Ga0373937_0043093 | 3300036401 | Bacteria | 4118 |
| 357 | Ga0373937_0155095 | 3300036401 | Bacteria | 2146 |
| 358 | Ga0373937_1555718 | 3300036401 | Unclassified | 609 |
| 359 | Ga0310112_026682 | 3300036458 | Bacteria | 798 |
| 360 | Ga0372808_003072 | 3300036459 | Bacteria | 2006 |
| 361 | Ga0310109_024891 | 3300036534 | Bacteria | 803 |
| 362 | Ga0373925_0345754 | 3300037068 | Bacteria | 1207 |
| 363 | Ga0373925_0886400 | 3300037068 | Bacteria | 735 |
| 364 | Ga0395899_0634775 | 3300037312 | Bacteria | 677 |
| 365 | Ga0395900_0000948 | 3300037418 | Bacteria | 37848 |
| 366 | Ga0395898_0206345 | 3300037466 | Bacteria | 1875 |
| 367 | Ga0395905_0035185 | 3300037471 | Bacteria | 4703 |
| 368 | Ga0395901_0029080 | 3300038443 | Bacteria | 5686 |
| 369 | Ga0436365_0109261 | 3300039437 | Bacteria | 1781 |
| 370 | Ga0436365_0740383 | 3300039437 | Bacteria | 1374 |
| 371 | Ga0436365_1835761 | 3300039437 | Bacteria | 36188 |
| 372 | Ga0436360_0550228 | 3300039438 | Bacteria | 1305 |
| 373 | Ga0436360_0854373 | 3300039438 | Bacteria | 900 |
| 374 | Ga0436361_0467457 | 3300039447 | Bacteria | 1237 |
| 375 | Ga0436361_1014259 | 3300039447 | Bacteria | 17383 |
| 376 | Ga0436362_0006141 | 3300039453 | Bacteria | 2231 |
| 377 | Ga0436362_0643370 | 3300039453 | Bacteria | 691 |
| 378 | Ga0436362_1206035 | 3300039453 | Bacteria | 2834 |
| 379 | Ga0451797_1308170 | 3300041453 | Bacteria | 755 |
| 380 | Ga0451802_2006855 | 3300041460 | Bacteria | 973 |
| 381 | Ga0451807_1787443 | 3300041486 | Bacteria | 2661 |
| 382 | Ga0466965_0505153 | 3300044683 | Bacteria | 678 |
| 383 | Ga0466966_0199086 | 3300044684 | Bacteria | 1212 |
| 384 | Ga0466963_0058718 | 3300044694 | Bacteria | 2566 |
| 385 | Ga0466963_0204280 | 3300044694 | Bacteria | 1382 |
| 386 | Ga0466968_0194455 | 3300044735 | Bacteria | 948 |
| 387 | Ga0466960_0036093 | 3300044901 | Bacteria | 2314 |
| 388 | Ga0466959_0115625 | 3300045049 | Bacteria | 1911 |
| 389 | Ga0466967_0500724 | 3300045976 | Bacteria | 1192 |
| 390 | Ga0466967_0564662 | 3300045976 | Bacteria | 1121 |
| 391 | Ga0495627_026739 | 3300046453 | Bacteria | 1858 |
| 392 | Ga0495592_0009399 | 3300046454 | Bacteria | 7352 |
| 393 | Ga0495603_0023365 | 3300046455 | Bacteria | 3742 |
| 394 | Ga0495603_0177930 | 3300046455 | Bacteria | 1231 |
| 395 | Ga0495603_0795587 | 3300046455 | Bacteria | 539 |
| 396 | Ga0495590_0266702 | 3300046457 | Bacteria | 639 |
| 397 | Ga0495629_0083386 | 3300046459 | Bacteria | 2231 |
| 398 | Ga0495638_0181682 | 3300046460 | Bacteria | 1200 |
| 399 | Ga0495638_0217040 | 3300046460 | Bacteria | 1071 |
| 400 | Ga0495641_0024865 | 3300046461 | Bacteria | 2948 |
| 401 | Ga0495651_0043105 | 3300046462 | Bacteria | 3501 |
| 402 | Ga0495651_0050423 | 3300046462 | Bacteria | 3211 |
| 403 | Ga0495653_0022987 | 3300046463 | Bacteria | 5042 |
| 404 | Ga0495650_0167220 | 3300046471 | Bacteria | 780 |
| 405 | Ga0495580_0125990 | 3300046472 | Bacteria | 1777 |
| 406 | Ga0495605_0078489 | 3300046474 | Bacteria | 1547 |
| 407 | Ga0495639_0015742 | 3300046475 | Bacteria | 3280 |
| 408 | Ga0495639_0097446 | 3300046475 | Bacteria | 1385 |
| 409 | Ga0495664_0069929 | 3300046477 | Bacteria | 2095 |
| 410 | Ga0495584_0254153 | 3300046491 | Bacteria | 893 |
| 411 | Ga0495585_0119329 | 3300046492 | Bacteria | 1396 |
| 412 | Ga0495594_0162800 | 3300046499 | Bacteria | 1268 |
| 413 | Ga0495594_0484849 | 3300046499 | Bacteria | 702 |
| 414 | Ga0495596_0150727 | 3300046500 | Bacteria | 903 |
| 415 | Ga0495607_0058223 | 3300046501 | Bacteria | 2210 |
| 416 | Ga0495583_0086754 | 3300046506 | Bacteria | 1353 |
| 417 | Ga0495583_0257622 | 3300046506 | Bacteria | 698 |
| 418 | Ga0495608_0015773 | 3300046511 | Bacteria | 5228 |
| 419 | Ga0495616_0096142 | 3300046513 | Bacteria | 1395 |
| 420 | Ga0495616_0310745 | 3300046513 | Bacteria | 664 |
| 421 | Ga0495618_0071700 | 3300046514 | Bacteria | 2204 |
| 422 | Ga0495628_0022019 | 3300046516 | Bacteria | 5238 |
| 423 | Ga0495628_0345834 | 3300046516 | Bacteria | 1094 |
| 424 | Ga0495630_0379938 | 3300046517 | Bacteria | 1082 |
| 425 | Ga0495630_0509393 | 3300046517 | Bacteria | 923 |
| 426 | Ga0495631_0015826 | 3300046518 | Bacteria | 3606 |
| 427 | Ga0495631_0146989 | 3300046518 | Bacteria | 1011 |
| 428 | Ga0495637_0173892 | 3300046520 | Bacteria | 802 |
| 429 | Ga0495644_0049465 | 3300046523 | Bacteria | 1578 |
| 430 | Ga0495644_0092261 | 3300046523 | Bacteria | 1143 |
| 431 | Ga0495648_0260888 | 3300046524 | Bacteria | 831 |
| 432 | Ga0495663_0033759 | 3300046525 | Bacteria | 1529 |
| 433 | Ga0495642_0220839 | 3300046528 | Bacteria | 827 |
| 434 | Ga0495652_0248543 | 3300046529 | Bacteria | 1319 |
| 435 | Ga0495654_0226690 | 3300046530 | Bacteria | 788 |
| 436 | Ga0495665_0021120 | 3300046531 | Bacteria | 3497 |
| 437 | Ga0495665_0151436 | 3300046531 | Bacteria | 1211 |
| 438 | Ga0495640_0095959 | 3300046533 | Bacteria | 1951 |
| 439 | Ga0495586_0189702 | 3300046535 | Bacteria | 1164 |
| 440 | Ga0495587_0069857 | 3300046536 | Bacteria | 2044 |
| 441 | Ga0495598_0008239 | 3300046537 | Bacteria | 2419 |
| 442 | Ga0495609_0149835 | 3300046538 | Bacteria | 992 |
| 443 | Ga0495621_0070013 | 3300046539 | Bacteria | 1290 |
| 444 | Ga0495597_0109422 | 3300046542 | Bacteria | 1160 |
| 445 | Ga0495645_0034669 | 3300046543 | Bacteria | 3680 |
| 446 | Ga0495645_0091984 | 3300046543 | Bacteria | 2166 |
| 447 | Ga0495622_0242617 | 3300046557 | Bacteria | 794 |
| 448 | Ga0495633_0111468 | 3300046558 | Bacteria | 1268 |
| 449 | Ga0495667_0016017 | 3300046559 | Bacteria | 5066 |
| 450 | Ga0495667_0095002 | 3300046559 | Bacteria | 1930 |
| 451 | Ga0495668_0036112 | 3300046616 | Bacteria | 2770 |
| 452 | Ga0495668_0171280 | 3300046616 | Bacteria | 1189 |
| 453 | Ga0495634_0123627 | 3300046642 | Bacteria | 1655 |
| 454 | Ga0495634_0394044 | 3300046642 | Bacteria | 823 |
| 455 | Ga0495611_0174174 | 3300046648 | Bacteria | 1005 |
| 456 | Ga0495625_0274623 | 3300046660 | Bacteria | 1086 |
| 457 | Ga0495625_0536515 | 3300046660 | Bacteria | 710 |
| 458 | Ga0495635_0090861 | 3300046663 | Bacteria | 2088 |
| 459 | Ga0495635_0102556 | 3300046663 | Bacteria | 1955 |
| 460 | Ga0495659_0250155 | 3300046664 | Bacteria | 738 |
| 461 | Ga0495661_0012562 | 3300046665 | Bacteria | 5717 |
| 462 | Ga0495661_0169867 | 3300046665 | Bacteria | 1164 |
| 463 | Ga0495588_0129502 | 3300046674 | Bacteria | 1331 |
| 464 | Ga0495588_0143243 | 3300046674 | Bacteria | 1262 |
| 465 | Ga0495657_0011755 | 3300046675 | Bacteria | 6527 |
| 466 | Ga0495657_0361038 | 3300046675 | Bacteria | 858 |
| 467 | Ga0495599_0005538 | 3300046678 | Bacteria | 7569 |
| 468 | Ga0495623_0015881 | 3300046679 | Bacteria | 4867 |
| 469 | Ga0495623_0092090 | 3300046679 | Bacteria | 1859 |
| 470 | Ga0495646_0020397 | 3300046680 | Bacteria | 4194 |
| 471 | Ga0495646_0169137 | 3300046680 | Bacteria | 1205 |
| 472 | Ga0495658_0587474 | 3300046683 | Bacteria | 713 |
| 473 | Ga0495669_0014266 | 3300046684 | Bacteria | 3398 |
| 474 | Ga0495669_0299130 | 3300046684 | Bacteria | 775 |
| 475 | Ga0495613_0166784 | 3300046689 | Bacteria | 1564 |
| 476 | Ga0495671_0161733 | 3300046692 | Bacteria | 1089 |
| 477 | Ga0495671_0222564 | 3300046692 | Bacteria | 913 |
| 478 | Ga0495649_0120774 | 3300046694 | Bacteria | 1386 |
| 479 | Ga0495589_0084056 | 3300046794 | Bacteria | 1547 |
| 480 | Ga0495589_0329198 | 3300046794 | Bacteria | 705 |
| 481 | Ga0495600_0147270 | 3300046809 | Bacteria | 1526 |
| 482 | Ga0495600_0182408 | 3300046809 | Bacteria | 1352 |
| 483 | Ga0495660_0309600 | 3300046810 | Bacteria | 713 |
| 484 | Ga0495581_0074575 | 3300047315 | Bacteria | 1963 |
| 485 | Ga0495581_0630063 | 3300047315 | Bacteria | 620 |
| 486 | Ga0495604_0032197 | 3300047317 | Bacteria | 4157 |
| 487 | Ga0495604_0235671 | 3300047317 | Bacteria | 1254 |
| 488 | Ga0495604_0442851 | 3300047317 | Bacteria | 850 |
| 489 | Ga0495636_0114962 | 3300047318 | Bacteria | 1186 |
| 490 | Ga0495674_0040165 | 3300047319 | Bacteria | 4187 |
| 491 | Ga0495674_0117043 | 3300047319 | Bacteria | 2254 |
| 492 | Ga0495672_0420459 | 3300047320 | Bacteria | 608 |
| 493 | Ga0495680_0032674 | 3300047322 | Bacteria | 4221 |
| 494 | Ga0495680_0761933 | 3300047322 | Bacteria | 635 |
| 495 | Ga0495675_0028977 | 3300047444 | Bacteria | 3529 |
| 496 | Ga0495677_0128955 | 3300047445 | Bacteria | 967 |
| 497 | Ga0495679_086633 | 3300047446 | Bacteria | 883 |
| 498 | Ga0495685_072302 | 3300047447 | Bacteria | 1154 |
| 499 | Ga0495685_179726 | 3300047447 | Bacteria | 682 |
| 500 | Ga0495681_0118086 | 3300047470 | Bacteria | 1141 |
| 501 | Ga0495684_0028966 | 3300047471 | Bacteria | 4249 |
| 502 | Ga0495684_0033165 | 3300047471 | Bacteria | 3963 |
| 503 | Ga0495686_0098254 | 3300047472 | Bacteria | 1769 |
| 504 | Ga0495686_0276910 | 3300047472 | Bacteria | 934 |
| 505 | Ga0495686_0309689 | 3300047472 | Bacteria | 869 |
| 506 | Ga0495686_0373863 | 3300047472 | Bacteria | 770 |
| 507 | Ga0495593_0211211 | 3300047673 | Bacteria | 974 |
| 508 | Ga0495602_0099301 | 3300048088 | Bacteria | 2393 |
| 509 | Ga0495602_0258330 | 3300048088 | Bacteria | 1294 |
| 510 | Ga0495602_0273765 | 3300048088 | Bacteria | 1247 |
| 511 | Ga0495614_0113685 | 3300048089 | Bacteria | 1190 |
| 512 | Ga0495615_0085491 | 3300048090 | Bacteria | 871 |
| 513 | Ga0495626_0290351 | 3300048091 | Bacteria | 648 |
| 514 | Ga0496101_0154408 | 3300048904 | Bacteria | 1757 |
| 515 | Ga0496103_0806292 | 3300048906 | Bacteria | 592 |
| 516 | Ga0496104_0056482 | 3300048907 | Bacteria | 3712 |
| 517 | Ga0496104_0156921 | 3300048907 | Bacteria | 2184 |
| 518 | Ga0496105_0034864 | 3300048908 | Bacteria | 4141 |
| 519 | Ga0496105_0288088 | 3300048908 | Bacteria | 1323 |
| 520 | Ga0496106_0198104 | 3300048909 | Bacteria | 1598 |
| 521 | Ga0496106_0268337 | 3300048909 | Bacteria | 1366 |
| 522 | Ga0496106_0571314 | 3300048909 | Bacteria | 907 |
| 523 | Ga0496107_0195303 | 3300048910 | Bacteria | 1504 |
| 524 | Ga0496108_0938772 | 3300048911 | Bacteria | 741 |
| 525 | Ga0496110_0215074 | 3300048913 | Bacteria | 1748 |
| 526 | Ga0496110_0317481 | 3300048913 | Bacteria | 1419 |
| 527 | Ga0496110_0376315 | 3300048913 | Bacteria | 1294 |
| 528 | Ga0496111_0529448 | 3300048914 | Bacteria | 866 |
| 529 | Ga0496112_0006924 | 3300048915 | Bacteria | 10006 |
| 530 | Ga0496112_0068671 | 3300048915 | Bacteria | 3500 |
| 531 | Ga0496112_0090831 | 3300048915 | Bacteria | 3023 |
| 532 | Ga0496112_0149815 | 3300048915 | Bacteria | 2300 |
| 533 | Ga0496113_0086279 | 3300048916 | Bacteria | 2412 |
| 534 | Ga0496113_0238654 | 3300048916 | Bacteria | 1450 |
| 535 | Ga0496115_0105181 | 3300048918 | Bacteria | 2316 |
| 536 | Ga0496115_0202088 | 3300048918 | Bacteria | 1641 |
| 537 | Ga0496118_0228992 | 3300048921 | Bacteria | 1074 |
| 538 | Ga0496119_0135808 | 3300048922 | Bacteria | 1334 |
| 539 | Ga0496120_0017605 | 3300048923 | Bacteria | 4625 |
| 540 | Ga0496121_0005056 | 3300048924 | Bacteria | 17227 |
| 541 | Ga0496121_0075717 | 3300048924 | Bacteria | 2687 |
| 542 | Ga0496121_0087668 | 3300048924 | Bacteria | 2442 |
| 543 | Ga0496121_0158350 | 3300048924 | Bacteria | 1659 |
| 544 | Ga0496123_0213462 | 3300048926 | Bacteria | 979 |
| 545 | Ga0496124_0071117 | 3300048927 | Bacteria | 2885 |
| 546 | Ga0496124_0191794 | 3300048927 | Bacteria | 1563 |
| 547 | Ga0496124_0344719 | 3300048927 | Bacteria | 1056 |
| 548 | Ga0496125_0000040 | 3300048928 | Bacteria | 314478 |
| 549 | Ga0496125_0002569 | 3300048928 | Bacteria | 23386 |
| 550 | Ga0496125_0050100 | 3300048928 | Bacteria | 3462 |
| 551 | Ga0496126_0020406 | 3300048929 | Bacteria | 6497 |
| 552 | Ga0496126_0020835 | 3300048929 | Bacteria | 6417 |
| 553 | Ga0496126_0020883 | 3300048929 | Bacteria | 6410 |
| 554 | Ga0496126_0054198 | 3300048929 | Bacteria | 3634 |
| 555 | Ga0496126_0093989 | 3300048929 | Bacteria | 2632 |
| 556 | Ga0496126_0177440 | 3300048929 | Bacteria | 1811 |
| 557 | Ga0496126_0706942 | 3300048929 | Bacteria | 782 |
| 558 | Ga0495682_0172079 | 3300049460 | Bacteria | 770 |
| 559 | Ga0495682_0220561 | 3300049460 | Bacteria | 672 |
| 560 | Ga0501067_0310648 | 3300049583 | Bacteria | 878 |
| 561 | nmdc:mga03683_129021_c1 | 3300050489 | Bacteria | 1130 |
| 562 | nmdc:mga03683_240165_c1 | 3300050489 | Bacteria | 839 |
| 563 | nmdc:mga03n38_241069_c1 | 3300050490 | Bacteria | 951 |
| 564 | nmdc:mga03n38_2988_c1 | 3300050490 | Bacteria | 5349 |
| 565 | nmdc:mga00v17_71775_c1 | 3300050491 | Bacteria | 2147 |
| 566 | nmdc:mga0yw44_133459_c1 | 3300050492 | Bacteria | 1609 |
| 567 | nmdc:mga0yw44_139144_c1 | 3300050492 | Bacteria | 1577 |
| 568 | nmdc:mga0yw44_378424_c1 | 3300050492 | Bacteria | 956 |
| 569 | nmdc:mga0k408_290094_c1 | 3300050493 | Bacteria | 977 |
| 570 | nmdc:mga06z11_440500_c1 | 3300050494 | Bacteria | 787 |
| 571 | nmdc:mga06z11_61125_c1 | 3300050494 | Bacteria | 1964 |
| 572 | nmdc:mga07m45_22659_c1 | 3300050496 | Bacteria | 3431 |
| 573 | nmdc:mga07m45_531273_c1 | 3300050496 | Bacteria | 681 |
| 574 | nmdc:mga08y16_369268_c1 | 3300050511 | Bacteria | 1472 |
| 575 | nmdc:mga0n895_15503_c1 | 3300050512 | Bacteria | 6951 |
| 576 | nmdc:mga0a205_223818_c1 | 3300050515 | Bacteria | 1766 |
| 577 | nmdc:mga0sz30_29942_c1 | 3300050516 | Bacteria | 2247 |
| 578 | Ga0495601_0175156 | 3300053077 | Bacteria | 1402 |
| 579 | Ga0500635_0092058 | 3300053080 | Bacteria | 1104 |
| 580 | Ga0495655_0249085 | 3300053083 | Bacteria | 597 |
| 581 | Ga0495619_0089151 | 3300053085 | Bacteria | 2086 |
| 582 | Ga0500643_021187 | 3300053087 | Bacteria | 2110 |
| 583 | Ga0500581_022444 | 3300053089 | Bacteria | 3196 |
| 584 | Ga0500646_0024762 | 3300053090 | Bacteria | 1617 |
| 585 | Ga0500647_0283931 | 3300053091 | Bacteria | 714 |
| 586 | Ga0500566_0038049 | 3300053094 | Bacteria | 2785 |
| 587 | Ga0500641_0008512 | 3300053096 | Bacteria | 3664 |
| 588 | Ga0500650_0034201 | 3300053098 | Bacteria | 2321 |
| 589 | Ga0500554_000257 | 3300053102 | Bacteria | 11497 |
| 590 | Ga0500556_0000069 | 3300053104 | Bacteria | 101263 |
| 591 | Ga0500572_000250 | 3300053111 | Bacteria | 19300 |
| 592 | Ga0500594_0117380 | 3300053118 | Bacteria | 833 |
| 593 | Ga0500595_002263 | 3300053119 | Bacteria | 9723 |
| 594 | Ga0500595_003979 | 3300053119 | Bacteria | 6751 |
| 595 | Ga0500621_203310 | 3300053126 | Bacteria | 700 |
| 596 | Ga0500642_0000032 | 3300053130 | Bacteria | 111097 |
| 597 | Ga0500652_000738 | 3300053131 | Bacteria | 11098 |
| 598 | Ga0500658_0202547 | 3300053134 | Bacteria | 907 |
| 599 | Ga0500658_0231389 | 3300053134 | Bacteria | 848 |
| 600 | Ga0500559_0001767 | 3300053136 | Bacteria | 11871 |
| 601 | Ga0500568_0092507 | 3300053139 | Bacteria | 1139 |
| 602 | Ga0500589_012741 | 3300053147 | Bacteria | 3687 |
| 603 | Ga0500603_000177 | 3300053150 | Bacteria | 16272 |
| 604 | Ga0500603_006316 | 3300053150 | Bacteria | 2573 |
| 605 | Ga0500616_0000461 | 3300053153 | Bacteria | 53095 |
| 606 | Ga0500622_0001709 | 3300053156 | Bacteria | 17023 |
| 607 | Ga0500638_025050 | 3300053162 | Bacteria | 2849 |
| 608 | Ga0500639_013395 | 3300053163 | Bacteria | 4313 |
| 609 | Ga0500636_0002975 | 3300053177 | Bacteria | 9487 |
| 610 | Ga0500637_0000927 | 3300053178 | Bacteria | 11855 |
| 611 | Ga0500637_0002404 | 3300053178 | Bacteria | 8316 |
| 612 | Ga0500596_000303 | 3300053735 | Bacteria | 8785 |
| 613 | Ga0500661_000024 | 3300055283 | Bacteria | 23092 |
| 614 | Ga0587070_092344 | 3300059491 | Bacteria | 683 |
| 615 | Ga0587076_132961 | 3300059645 | Bacteria | 588 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005455 | Ga0070663_100021567 | Ga0070663_1000215673 | 132 |
| 2 | 3300046506 | Ga0495583_0257622 | Ga0495583_0257622_16_639 | 132 |
| 3 | 3300046518 | Ga0495631_0015826 | Ga0495631_0015826_1509_2183 | 132 |
| 4 | 3300046520 | Ga0495637_0173892 | Ga0495637_0173892_75_698 | 132 |
| 5 | 3300046542 | Ga0495597_0109422 | Ga0495597_0109422_437_1111 | 132 |
| 6 | 3300046665 | Ga0495661_0012562 | Ga0495661_0012562_2818_3492 | 132 |
| 7 | 3300046674 | Ga0495588_0129502 | Ga0495588_0129502_676_1299 | 132 |
| 8 | 3300048923 | Ga0496120_0017605 | Ga0496120_0017605_2386_3060 | 132 |
| 9 | 3300048924 | Ga0496121_0005056 | Ga0496121_0005056_5649_6272 | 132 |
| 10 | 3300048927 | Ga0496124_0344719 | Ga0496124_0344719_262_936 | 132 |
| 11 | 3300048928 | Ga0496125_0002569 | Ga0496125_0002569_18038_18661 | 132 |
| 12 | 3300048929 | Ga0496126_0706942 | Ga0496126_0706942_90_713 | 132 |
| 13 | 3300053087 | Ga0500643_021187 | Ga0500643_021187_1368_2042 | 132 |
| 14 | 3300053089 | Ga0500581_022444 | Ga0500581_022444_763_1386 | 132 |
| 15 | 3300053098 | Ga0500650_0034201 | Ga0500650_0034201_1144_1767 | 132 |
| 16 | 3300053104 | Ga0500556_0000069 | Ga0500556_0000069_71523_72146 | 132 |
| 17 | 3300053126 | Ga0500621_203310 | Ga0500621_203310_14_637 | 132 |
| 18 | 3300053130 | Ga0500642_0000032 | Ga0500642_0000032_88634_89257 | 132 |
| 19 | 3300053131 | Ga0500652_000738 | Ga0500652_000738_5272_5895 | 132 |
| 20 | 3300053134 | Ga0500658_0202547 | Ga0500658_0202547_243_866 | 132 |
| 21 | 3300053139 | Ga0500568_0092507 | Ga0500568_0092507_379_1002 | 132 |
| 22 | 3300053153 | Ga0500616_0000461 | Ga0500616_0000461_23292_23966 | 132 |
| 23 | 3300053156 | Ga0500622_0001709 | Ga0500622_0001709_1814_2488 | 132 |
| 24 | 3300047447 | Ga0495685_179726 | Ga0495685_179726_138_638 | 152 |
| 25 | 3300047472 | Ga0495686_0276910 | Ga0495686_0276910_288_827 | 152 |
| 26 | 3300053119 | Ga0500595_003979 | Ga0500595_003979_1073_1612 | 152 |
| 27 | 3300048929 | Ga0496126_0177440 | Ga0496126_0177440_13_477 | 153 |
| 28 | 3300013306 | Ga0163162_10599638 | Ga0163162_105996381 | 158 |
| 29 | 3300044694 | Ga0466963_0204280 | Ga0466963_0204280_878_1372 | 161 |
| 30 | 3300006173 | Ga0070716_100166269 | Ga0070716_1001662692 | 162 |
| 31 | 3300009101 | Ga0105247_10388744 | Ga0105247_103887442 | 162 |
| 32 | 3300013297 | Ga0157378_10178208 | Ga0157378_101782084 | 162 |
| 33 | 3300025898 | Ga0207692_10291534 | Ga0207692_102915342 | 162 |
| 34 | 3300025900 | Ga0207710_10009512 | Ga0207710_100095125 | 162 |
| 35 | 3300048924 | Ga0496121_0075717 | Ga0496121_0075717_1673_2161 | 162 |
| 36 | 3300048929 | Ga0496126_0020406 | Ga0496126_0020406_1699_2187 | 162 |
| 37 | iso_pu_bacteria | 2508501128 | 2509149339 | 162 |
| 38 | iso_pu_bacteria | 2513237098 | 2513677432 | 162 |
| 39 | iso_pu_bacteria | 2513237101 | 2513698067 | 162 |
| 40 | iso_pu_bacteria | 2513237141 | 2513891295 | 162 |
| 41 | iso_pu_bacteria | 2524023210 | 2524468433 | 162 |
| 42 | iso_pu_bacteria | 2602042107 | 2603860943 | 162 |
| 43 | iso_pu_bacteria | 2667528175 | 2671118843 | 162 |
| 44 | iso_pu_bacteria | 2791355197 | 2793066747 | 162 |
| 45 | iso_pu_bacteria | 2791355199 | 2793080634 | 162 |
| 46 | iso_pu_bacteria | 2874604998 | 2874607369 | 162 |
| 47 | iso_pu_bacteria | 2876808645 | 2876814595 | 162 |
| 48 | iso_pu_bacteria | 2879110137 | 2879114680 | 162 |
| 49 | iso_pu_bacteria | 2885383462 | 2885384011 | 162 |
| 50 | iso_pu_bacteria | 2889033259 | 2889038053 | 162 |
| 51 | iso_pu_bacteria | 2903768456 | 2903769681 | 162 |
| 52 | iso_pu_bacteria | 2906610324 | 2906616563 | 162 |
| 53 | iso_pu_bacteria | 2922425934 | 2922431417 | 162 |
| 54 | iso_pu_bacteria | 8006964411 | 8006971563 | 162 |
| 55 | iso_pu_bacteria | 8006984368 | 8006984390 | 162 |
| 56 | iso_pu_bacteria | 8006994254 | 8007001321 | 162 |
| 57 | iso_pu_bacteria | 8019555841 | 8019565381 | 162 |
| 58 | iso_pu_bacteria | 8019565922 | 8019575477 | 162 |
| 59 | iso_pu_bacteria | 8056673599 | 8056681070 | 162 |
| 60 | iso_pu_bacteria | 8056689827 | 8056693101 | 162 |
| 61 | 3300003354 | JGI25160J50197_1005054 | JGI25160J50197_10050545 | 164 |
| 62 | 3300005262 | Ga0065165_1031789 | Ga0065165_10317891 | 164 |
| 63 | 3300005530 | Ga0070679_100914565 | Ga0070679_1009145651 | 164 |
| 64 | 3300005539 | Ga0068853_100713639 | Ga0068853_1007136392 | 164 |
| 65 | 3300005834 | Ga0068851_10381156 | Ga0068851_103811562 | 164 |
| 66 | 3300006353 | Ga0075370_10314875 | Ga0075370_103148751 | 164 |
| 67 | 3300009545 | Ga0105237_10157755 | Ga0105237_101577553 | 164 |
| 68 | 3300009551 | Ga0105238_10117620 | Ga0105238_101176203 | 164 |
| 69 | 3300010375 | Ga0105239_10118596 | Ga0105239_101185962 | 164 |
| 70 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011266 | 164 |
| 71 | 3300025303 | Ga0209051_1066476 | Ga0209051_10664762 | 164 |
| 72 | 3300025924 | Ga0207694_10060044 | Ga0207694_100600442 | 164 |
| 73 | 3300026041 | Ga0207639_10602948 | Ga0207639_106029481 | 164 |
| 74 | 3300028556 | Ga0265337_1015924 | Ga0265337_10159242 | 164 |
| 75 | 3300028563 | Ga0265319_1015825 | Ga0265319_10158252 | 164 |
| 76 | 3300028653 | Ga0265323_10001015 | Ga0265323_100010151 | 164 |
| 77 | 3300028654 | Ga0265322_10031044 | Ga0265322_100310442 | 164 |
| 78 | 3300028666 | Ga0265336_10001855 | Ga0265336_100018555 | 164 |
| 79 | 3300028800 | Ga0265338_10000034 | Ga0265338_10000034150 | 164 |
| 80 | 3300029957 | Ga0265324_10010129 | Ga0265324_100101292 | 164 |
| 81 | 3300037312 | Ga0395899_0634775 | Ga0395899_0634775_121_618 | 164 |
| 82 | 3300037418 | Ga0395900_0000948 | Ga0395900_0000948_8588_9085 | 164 |
| 83 | 3300037466 | Ga0395898_0206345 | Ga0395898_0206345_696_1193 | 164 |
| 84 | 3300037471 | Ga0395905_0035185 | Ga0395905_0035185_614_1111 | 164 |
| 85 | 3300038443 | Ga0395901_0029080 | Ga0395901_0029080_297_794 | 164 |
| 86 | 3300044683 | Ga0466965_0505153 | Ga0466965_0505153_157_654 | 164 |
| 87 | 3300044901 | Ga0466960_0036093 | Ga0466960_0036093_782_1279 | 164 |
| 88 | 3300045976 | Ga0466967_0564662 | Ga0466967_0564662_459_1013 | 164 |
| 89 | 3300048918 | Ga0496115_0202088 | Ga0496115_0202088_487_984 | 164 |
| 90 | 3300048927 | Ga0496124_0191794 | Ga0496124_0191794_661_1155 | 164 |
| 91 | 3300048928 | Ga0496125_0050100 | Ga0496125_0050100_2169_2663 | 164 |
| 92 | 3300049460 | Ga0495682_0220561 | Ga0495682_0220561_145_642 | 164 |
| 93 | 3300053111 | Ga0500572_000250 | Ga0500572_000250_3833_4387 | 164 |
| 94 | 3300053136 | Ga0500559_0001767 | Ga0500559_0001767_9450_10004 | 164 |
| 95 | 3300053163 | Ga0500639_013395 | Ga0500639_013395_1115_1669 | 164 |
| 96 | 3300053735 | Ga0500596_000303 | Ga0500596_000303_5857_6411 | 164 |
| 97 | 3300005614 | Ga0068856_100696942 | Ga0068856_1006969422 | 165 |
| 98 | 3300006173 | Ga0070716_100174306 | Ga0070716_1001743063 | 165 |
| 99 | 3300009551 | Ga0105238_10953115 | Ga0105238_109531151 | 165 |
| 100 | 3300025939 | Ga0207665_10216788 | Ga0207665_102167882 | 165 |
| 101 | 3300030760 | Ga0265762_1070772 | Ga0265762_10707721 | 165 |
| 102 | 3300031090 | Ga0265760_10128597 | Ga0265760_101285971 | 165 |
| 103 | 3300031711 | Ga0265314_10025180 | Ga0265314_100251803 | 165 |
| 104 | 3300031712 | Ga0265342_10007437 | Ga0265342_100074374 | 165 |
| 105 | 3300035170 | Ga0373943_0524697 | Ga0373943_0524697_39_536 | 165 |
| 106 | 3300035695 | Ga0373927_0006061 | Ga0373927_0006061_5452_5949 | 165 |
| 107 | 3300035724 | Ga0373933_0272238 | Ga0373933_0272238_80_580 | 165 |
| 108 | 3300036401 | Ga0373937_1555718 | Ga0373937_1555718_44_541 | 165 |
| 109 | 3300037068 | Ga0373925_0345754 | Ga0373925_0345754_362_859 | 165 |
| 110 | 3300044684 | Ga0466966_0199086 | Ga0466966_0199086_507_1007 | 165 |
| 111 | 3300045049 | Ga0466959_0115625 | Ga0466959_0115625_373_873 | 165 |
| 112 | 3300046455 | Ga0495603_0177930 | Ga0495603_0177930_664_1161 | 165 |
| 113 | 3300046462 | Ga0495651_0050423 | Ga0495651_0050423_908_1408 | 165 |
| 114 | 3300046679 | Ga0495623_0092090 | Ga0495623_0092090_701_1201 | 165 |
| 115 | 3300047315 | Ga0495581_0074575 | Ga0495581_0074575_966_1463 | 165 |
| 116 | 3300048088 | Ga0495602_0258330 | Ga0495602_0258330_275_775 | 165 |
| 117 | 3300048088 | Ga0495602_0273765 | Ga0495602_0273765_426_926 | 165 |
| 118 | 3300048915 | Ga0496112_0068671 | Ga0496112_0068671_1329_1832 | 165 |
| 119 | 3300048918 | Ga0496115_0105181 | Ga0496115_0105181_1309_1809 | 165 |
| 120 | 3300048921 | Ga0496118_0228992 | Ga0496118_0228992_290_790 | 165 |
| 121 | 3300048929 | Ga0496126_0020835 | Ga0496126_0020835_1089_1589 | 165 |
| 122 | 3300048929 | Ga0496126_0054198 | Ga0496126_0054198_2870_3370 | 165 |
| 123 | 3300048929 | Ga0496126_0093989 | Ga0496126_0093989_1527_2027 | 165 |
| 124 | 3300001989 | JGI24739J22299_10021439 | JGI24739J22299_100214392 | 166 |
| 125 | 3300002067 | JGI24735J21928_10034819 | JGI24735J21928_100348192 | 166 |
| 126 | 3300002244 | JGI24742J22300_10005518 | JGI24742J22300_100055182 | 166 |
| 127 | 3300003659 | JGI25404J52841_10000472 | JGI25404J52841_100004726 | 166 |
| 128 | 3300003659 | JGI25404J52841_10001192 | JGI25404J52841_100011921 | 166 |
| 129 | 3300003659 | JGI25404J52841_10091650 | JGI25404J52841_100916501 | 166 |
| 130 | 3300005331 | Ga0070670_100414765 | Ga0070670_1004147652 | 166 |
| 131 | 3300005334 | Ga0068869_101153295 | Ga0068869_1011532951 | 166 |
| 132 | 3300005335 | Ga0070666_10114566 | Ga0070666_101145663 | 166 |
| 133 | 3300005336 | Ga0070680_100164333 | Ga0070680_1001643332 | 166 |
| 134 | 3300005338 | Ga0068868_100025999 | Ga0068868_1000259993 | 166 |
| 135 | 3300005344 | Ga0070661_100322318 | Ga0070661_1003223181 | 166 |
| 136 | 3300005344 | Ga0070661_100681741 | Ga0070661_1006817411 | 166 |
| 137 | 3300005347 | Ga0070668_100126984 | Ga0070668_1001269842 | 166 |
| 138 | 3300005347 | Ga0070668_100185255 | Ga0070668_1001852552 | 166 |
| 139 | 3300005347 | Ga0070668_100420924 | Ga0070668_1004209241 | 166 |
| 140 | 3300005353 | Ga0070669_100097261 | Ga0070669_1000972613 | 166 |
| 141 | 3300005355 | Ga0070671_100133258 | Ga0070671_1001332581 | 166 |
| 142 | 3300005355 | Ga0070671_100147120 | Ga0070671_1001471202 | 166 |
| 143 | 3300005356 | Ga0070674_100014302 | Ga0070674_1000143021 | 166 |
| 144 | 3300005356 | Ga0070674_100287503 | Ga0070674_1002875033 | 166 |
| 145 | 3300005364 | Ga0070673_100925860 | Ga0070673_1009258601 | 166 |
| 146 | 3300005366 | Ga0070659_100137452 | Ga0070659_1001374522 | 166 |
| 147 | 3300005367 | Ga0070667_100496971 | Ga0070667_1004969712 | 166 |
| 148 | 3300005367 | Ga0070667_100690790 | Ga0070667_1006907901 | 166 |
| 149 | 3300005367 | Ga0070667_101028885 | Ga0070667_1010288851 | 166 |
| 150 | 3300005434 | Ga0070709_10003112 | Ga0070709_100031122 | 166 |
| 151 | 3300005434 | Ga0070709_10897152 | Ga0070709_108971521 | 166 |
| 152 | 3300005435 | Ga0070714_100007436 | Ga0070714_1000074365 | 166 |
| 153 | 3300005436 | Ga0070713_100033918 | Ga0070713_1000339184 | 166 |
| 154 | 3300005437 | Ga0070710_10002974 | Ga0070710_100029743 | 166 |
| 155 | 3300005439 | Ga0070711_100005217 | Ga0070711_1000052176 | 166 |
| 156 | 3300005441 | Ga0070700_100223796 | Ga0070700_1002237962 | 166 |
| 157 | 3300005455 | Ga0070663_100065758 | Ga0070663_1000657584 | 166 |
| 158 | 3300005455 | Ga0070663_100104934 | Ga0070663_1001049341 | 166 |
| 159 | 3300005455 | Ga0070663_100165490 | Ga0070663_1001654902 | 166 |
| 160 | 3300005455 | Ga0070663_100450259 | Ga0070663_1004502591 | 166 |
| 161 | 3300005456 | Ga0070678_100242493 | Ga0070678_1002424931 | 166 |
| 162 | 3300005457 | Ga0070662_100034535 | Ga0070662_1000345351 | 166 |
| 163 | 3300005458 | Ga0070681_10691779 | Ga0070681_106917791 | 166 |
| 164 | 3300005459 | Ga0068867_100330967 | Ga0068867_1003309672 | 166 |
| 165 | 3300005459 | Ga0068867_101769664 | Ga0068867_1017696641 | 166 |
| 166 | 3300005467 | Ga0070706_100606940 | Ga0070706_1006069401 | 166 |
| 167 | 3300005468 | Ga0070707_100294403 | Ga0070707_1002944032 | 166 |
| 168 | 3300005471 | Ga0070698_100016851 | Ga0070698_1000168516 | 166 |
| 169 | 3300005471 | Ga0070698_100222476 | Ga0070698_1002224764 | 166 |
| 170 | 3300005530 | Ga0070679_100206259 | Ga0070679_1002062592 | 166 |
| 171 | 3300005536 | Ga0070697_100090499 | Ga0070697_1000904992 | 166 |
| 172 | 3300005539 | Ga0068853_100413217 | Ga0068853_1004132171 | 166 |
| 173 | 3300005539 | Ga0068853_100500849 | Ga0068853_1005008491 | 166 |
| 174 | 3300005539 | Ga0068853_100580304 | Ga0068853_1005803042 | 166 |
| 175 | 3300005539 | Ga0068853_100657360 | Ga0068853_1006573602 | 166 |
| 176 | 3300005539 | Ga0068853_100708305 | Ga0068853_1007083052 | 166 |
| 177 | 3300005544 | Ga0070686_100079904 | Ga0070686_1000799042 | 166 |
| 178 | 3300005544 | Ga0070686_100177507 | Ga0070686_1001775072 | 166 |
| 179 | 3300005548 | Ga0070665_100247668 | Ga0070665_1002476682 | 166 |
| 180 | 3300005548 | Ga0070665_100318443 | Ga0070665_1003184432 | 166 |
| 181 | 3300005563 | Ga0068855_100016472 | Ga0068855_1000164723 | 166 |
| 182 | 3300005563 | Ga0068855_100016926 | Ga0068855_1000169265 | 166 |
| 183 | 3300005563 | Ga0068855_100017121 | Ga0068855_1000171215 | 166 |
| 184 | 3300005563 | Ga0068855_100031441 | Ga0068855_1000314411 | 166 |
| 185 | 3300005563 | Ga0068855_100111709 | Ga0068855_1001117092 | 166 |
| 186 | 3300005564 | Ga0070664_100155727 | Ga0070664_1001557272 | 166 |
| 187 | 3300005564 | Ga0070664_101178611 | Ga0070664_1011786111 | 166 |
| 188 | 3300005577 | Ga0068857_100002567 | Ga0068857_1000025675 | 166 |
| 189 | 3300005577 | Ga0068857_100058887 | Ga0068857_1000588872 | 166 |
| 190 | 3300005577 | Ga0068857_100498540 | Ga0068857_1004985401 | 166 |
| 191 | 3300005578 | Ga0068854_100005650 | Ga0068854_1000056502 | 166 |
| 192 | 3300005578 | Ga0068854_100048779 | Ga0068854_1000487791 | 166 |
| 193 | 3300005614 | Ga0068856_100013475 | Ga0068856_1000134752 | 166 |
| 194 | 3300005614 | Ga0068856_100052415 | Ga0068856_1000524152 | 166 |
| 195 | 3300005614 | Ga0068856_100090447 | Ga0068856_1000904471 | 166 |
| 196 | 3300005614 | Ga0068856_100810441 | Ga0068856_1008104412 | 166 |
| 197 | 3300005615 | Ga0070702_100543776 | Ga0070702_1005437762 | 166 |
| 198 | 3300005616 | Ga0068852_100027768 | Ga0068852_1000277682 | 166 |
| 199 | 3300005616 | Ga0068852_100112618 | Ga0068852_1001126184 | 166 |
| 200 | 3300005616 | Ga0068852_101137950 | Ga0068852_1011379501 | 166 |
| 201 | 3300005718 | Ga0068866_10175774 | Ga0068866_101757742 | 166 |
| 202 | 3300005719 | Ga0068861_100016647 | Ga0068861_1000166472 | 166 |
| 203 | 3300005834 | Ga0068851_10067598 | Ga0068851_100675982 | 166 |
| 204 | 3300005840 | Ga0068870_10046705 | Ga0068870_100467051 | 166 |
| 205 | 3300005840 | Ga0068870_10073656 | Ga0068870_100736561 | 166 |
| 206 | 3300005841 | Ga0068863_100071362 | Ga0068863_1000713623 | 166 |
| 207 | 3300005841 | Ga0068863_100198537 | Ga0068863_1001985372 | 166 |
| 208 | 3300005843 | Ga0068860_100824200 | Ga0068860_1008242001 | 166 |
| 209 | 3300005844 | Ga0068862_100086289 | Ga0068862_1000862892 | 166 |
| 210 | 3300005844 | Ga0068862_100124463 | Ga0068862_1001244632 | 166 |
| 211 | 3300005981 | Ga0081538_10042772 | Ga0081538_100427723 | 166 |
| 212 | 3300005983 | Ga0081540_1002148 | Ga0081540_100214810 | 166 |
| 213 | 3300005983 | Ga0081540_1003328 | Ga0081540_10033284 | 166 |
| 214 | 3300005983 | Ga0081540_1011376 | Ga0081540_10113764 | 166 |
| 215 | 3300005983 | Ga0081540_1014260 | Ga0081540_10142605 | 166 |
| 216 | 3300005983 | Ga0081540_1016711 | Ga0081540_10167117 | 166 |
| 217 | 3300005983 | Ga0081540_1069264 | Ga0081540_10692643 | 166 |
| 218 | 3300006028 | Ga0070717_10302177 | Ga0070717_103021772 | 166 |
| 219 | 3300006038 | Ga0075365_10006380 | Ga0075365_100063802 | 166 |
| 220 | 3300006038 | Ga0075365_10206582 | Ga0075365_102065823 | 166 |
| 221 | 3300006042 | Ga0075368_10037733 | Ga0075368_100377331 | 166 |
| 222 | 3300006048 | Ga0075363_100000789 | Ga0075363_1000007897 | 166 |
| 223 | 3300006051 | Ga0075364_10195200 | Ga0075364_101952002 | 166 |
| 224 | 3300006051 | Ga0075364_10215388 | Ga0075364_102153881 | 166 |
| 225 | 3300006163 | Ga0070715_10100380 | Ga0070715_101003802 | 166 |
| 226 | 3300006173 | Ga0070716_100010881 | Ga0070716_1000108815 | 166 |
| 227 | 3300006177 | Ga0075362_10160698 | Ga0075362_101606982 | 166 |
| 228 | 3300006177 | Ga0075362_10207899 | Ga0075362_102078992 | 166 |
| 229 | 3300006178 | Ga0075367_10008506 | Ga0075367_100085065 | 166 |
| 230 | 3300006186 | Ga0075369_10063102 | Ga0075369_100631022 | 166 |
| 231 | 3300006186 | Ga0075369_10315230 | Ga0075369_103152301 | 166 |
| 232 | 3300006195 | Ga0075366_10142891 | Ga0075366_101428912 | 166 |
| 233 | 3300006353 | Ga0075370_10036971 | Ga0075370_100369714 | 166 |
| 234 | 3300006358 | Ga0068871_100227162 | Ga0068871_1002271622 | 166 |
| 235 | 3300006358 | Ga0068871_100587638 | Ga0068871_1005876381 | 166 |
| 236 | 3300006844 | Ga0075428_100394355 | Ga0075428_1003943553 | 166 |
| 237 | 3300006871 | Ga0075434_100007277 | Ga0075434_1000072777 | 166 |
| 238 | 3300006871 | Ga0075434_100365573 | Ga0075434_1003655732 | 166 |
| 239 | 3300006881 | Ga0068865_100541314 | Ga0068865_1005413142 | 166 |
| 240 | 3300007076 | Ga0075435_100343275 | Ga0075435_1003432751 | 166 |
| 241 | 3300007265 | Ga0099794_10009233 | Ga0099794_100092334 | 166 |
| 242 | 3300007265 | Ga0099794_10043047 | Ga0099794_100430473 | 166 |
| 243 | 3300007265 | Ga0099794_10113386 | Ga0099794_101133862 | 166 |
| 244 | 3300007788 | Ga0099795_10243642 | Ga0099795_102436422 | 166 |
| 245 | 3300009093 | Ga0105240_10003917 | Ga0105240_1000391713 | 166 |
| 246 | 3300009093 | Ga0105240_10055702 | Ga0105240_100557022 | 166 |
| 247 | 3300009093 | Ga0105240_10072102 | Ga0105240_100721023 | 166 |
| 248 | 3300009094 | Ga0111539_11152256 | Ga0111539_111522561 | 166 |
| 249 | 3300009098 | Ga0105245_10206288 | Ga0105245_102062881 | 166 |
| 250 | 3300009101 | Ga0105247_10645119 | Ga0105247_106451191 | 166 |
| 251 | 3300009148 | Ga0105243_10408740 | Ga0105243_104087401 | 166 |
| 252 | 3300009148 | Ga0105243_11039984 | Ga0105243_110399841 | 166 |
| 253 | 3300009174 | Ga0105241_10002672 | Ga0105241_100026723 | 166 |
| 254 | 3300009174 | Ga0105241_10012909 | Ga0105241_100129093 | 166 |
| 255 | 3300009174 | Ga0105241_10540860 | Ga0105241_105408602 | 166 |
| 256 | 3300009177 | Ga0105248_10132082 | Ga0105248_101320823 | 166 |
| 257 | 3300009545 | Ga0105237_10033420 | Ga0105237_100334204 | 166 |
| 258 | 3300009545 | Ga0105237_10270532 | Ga0105237_102705321 | 166 |
| 259 | 3300009545 | Ga0105237_10336991 | Ga0105237_103369912 | 166 |
| 260 | 3300009545 | Ga0105237_10375552 | Ga0105237_103755522 | 166 |
| 261 | 3300009551 | Ga0105238_10011847 | Ga0105238_100118476 | 166 |
| 262 | 3300009551 | Ga0105238_10043500 | Ga0105238_100435005 | 166 |
| 263 | 3300009551 | Ga0105238_10135849 | Ga0105238_101358493 | 166 |
| 264 | 3300009551 | Ga0105238_10207742 | Ga0105238_102077423 | 166 |
| 265 | 3300009553 | Ga0105249_11337409 | Ga0105249_113374091 | 166 |
| 266 | 3300010159 | Ga0099796_10050507 | Ga0099796_100505072 | 166 |
| 267 | 3300010375 | Ga0105239_10005731 | Ga0105239_100057318 | 166 |
| 268 | 3300010375 | Ga0105239_10152059 | Ga0105239_101520592 | 166 |
| 269 | 3300010375 | Ga0105239_10202910 | Ga0105239_102029101 | 166 |
| 270 | 3300010375 | Ga0105239_11173993 | Ga0105239_111739931 | 166 |
| 271 | 3300011119 | Ga0105246_10018834 | Ga0105246_100188342 | 166 |
| 272 | 3300011119 | Ga0105246_10120812 | Ga0105246_101208123 | 166 |
| 273 | 3300012494 | Ga0157341_1000853 | Ga0157341_10008531 | 166 |
| 274 | 3300013104 | Ga0157370_10195235 | Ga0157370_101952353 | 166 |
| 275 | 3300013104 | Ga0157370_10731622 | Ga0157370_107316222 | 166 |
| 276 | 3300013105 | Ga0157369_10004254 | Ga0157369_100042549 | 166 |
| 277 | 3300013105 | Ga0157369_10321336 | Ga0157369_103213362 | 166 |
| 278 | 3300013105 | Ga0157369_10324636 | Ga0157369_103246361 | 166 |
| 279 | 3300013297 | Ga0157378_10353806 | Ga0157378_103538062 | 166 |
| 280 | 3300013297 | Ga0157378_10687754 | Ga0157378_106877542 | 166 |
| 281 | 3300013297 | Ga0157378_11764968 | Ga0157378_117649681 | 166 |
| 282 | 3300013306 | Ga0163162_10627786 | Ga0163162_106277862 | 166 |
| 283 | 3300013307 | Ga0157372_10072697 | Ga0157372_100726973 | 166 |
| 284 | 3300013307 | Ga0157372_11133771 | Ga0157372_111337712 | 166 |
| 285 | 3300013308 | Ga0157375_10244925 | Ga0157375_102449251 | 166 |
| 286 | 3300013308 | Ga0157375_11089005 | Ga0157375_110890052 | 166 |
| 287 | 3300014325 | Ga0163163_10211478 | Ga0163163_102114783 | 166 |
| 288 | 3300014326 | Ga0157380_10053042 | Ga0157380_100530421 | 166 |
| 289 | 3300014326 | Ga0157380_10181823 | Ga0157380_101818233 | 166 |
| 290 | 3300014497 | Ga0182008_10482588 | Ga0182008_104825881 | 166 |
| 291 | 3300014969 | Ga0157376_10425805 | Ga0157376_104258051 | 166 |
| 292 | 3300014969 | Ga0157376_10743192 | Ga0157376_107431921 | 166 |
| 293 | 3300017792 | Ga0163161_10271495 | Ga0163161_102714951 | 166 |
| 294 | 3300020075 | Ga0206349_1461959 | Ga0206349_14619591 | 166 |
| 295 | 3300020078 | Ga0206352_10796597 | Ga0206352_107965971 | 166 |
| 296 | 3300020080 | Ga0206350_10048311 | Ga0206350_100483111 | 166 |
| 297 | 3300020081 | Ga0206354_10396399 | Ga0206354_103963991 | 166 |
| 298 | 3300020610 | Ga0154015_1510599 | Ga0154015_15105992 | 166 |
| 299 | 3300021358 | Ga0213873_10009607 | Ga0213873_100096072 | 166 |
| 300 | 3300021358 | Ga0213873_10096041 | Ga0213873_100960412 | 166 |
| 301 | 3300021377 | Ga0213874_10196572 | Ga0213874_101965721 | 166 |
| 302 | 3300021384 | Ga0213876_10002980 | Ga0213876_100029809 | 166 |
| 303 | 3300021388 | Ga0213875_10176625 | Ga0213875_101766251 | 166 |
| 304 | 3300021388 | Ga0213875_10511004 | Ga0213875_105110041 | 166 |
| 305 | 3300021441 | Ga0213871_10025594 | Ga0213871_100255942 | 166 |
| 306 | 3300022467 | Ga0224712_10103731 | Ga0224712_101037312 | 166 |
| 307 | 3300022467 | Ga0224712_10300031 | Ga0224712_103000311 | 166 |
| 308 | 3300025297 | Ga0209758_1004160 | Ga0209758_10041608 | 166 |
| 309 | 3300025315 | Ga0207697_10085541 | Ga0207697_100855412 | 166 |
| 310 | 3300025321 | Ga0207656_10250066 | Ga0207656_102500661 | 166 |
| 311 | 3300025898 | Ga0207692_10025911 | Ga0207692_100259112 | 166 |
| 312 | 3300025900 | Ga0207710_10034072 | Ga0207710_100340722 | 166 |
| 313 | 3300025904 | Ga0207647_10003198 | Ga0207647_100031987 | 166 |
| 314 | 3300025906 | Ga0207699_10000204 | Ga0207699_1000020410 | 166 |
| 315 | 3300025906 | Ga0207699_10946293 | Ga0207699_109462931 | 166 |
| 316 | 3300025907 | Ga0207645_10040688 | Ga0207645_100406882 | 166 |
| 317 | 3300025907 | Ga0207645_10263742 | Ga0207645_102637422 | 166 |
| 318 | 3300025907 | Ga0207645_10377158 | Ga0207645_103771581 | 166 |
| 319 | 3300025908 | Ga0207643_10011042 | Ga0207643_100110423 | 166 |
| 320 | 3300025910 | Ga0207684_10092912 | Ga0207684_100929122 | 166 |
| 321 | 3300025911 | Ga0207654_10024350 | Ga0207654_100243503 | 166 |
| 322 | 3300025911 | Ga0207654_10034013 | Ga0207654_100340132 | 166 |
| 323 | 3300025913 | Ga0207695_10000424 | Ga0207695_1000042422 | 166 |
| 324 | 3300025913 | Ga0207695_10012405 | Ga0207695_100124052 | 166 |
| 325 | 3300025913 | Ga0207695_10149175 | Ga0207695_101491753 | 166 |
| 326 | 3300025913 | Ga0207695_10385302 | Ga0207695_103853022 | 166 |
| 327 | 3300025914 | Ga0207671_10079659 | Ga0207671_100796592 | 166 |
| 328 | 3300025914 | Ga0207671_10129439 | Ga0207671_101294392 | 166 |
| 329 | 3300025914 | Ga0207671_10170922 | Ga0207671_101709222 | 166 |
| 330 | 3300025915 | Ga0207693_10028299 | Ga0207693_100282994 | 166 |
| 331 | 3300025916 | Ga0207663_10024044 | Ga0207663_100240442 | 166 |
| 332 | 3300025917 | Ga0207660_10709395 | Ga0207660_107093952 | 166 |
| 333 | 3300025920 | Ga0207649_10268370 | Ga0207649_102683702 | 166 |
| 334 | 3300025921 | Ga0207652_10171583 | Ga0207652_101715833 | 166 |
| 335 | 3300025921 | Ga0207652_10231775 | Ga0207652_102317753 | 166 |
| 336 | 3300025922 | Ga0207646_10175749 | Ga0207646_101757492 | 166 |
| 337 | 3300025923 | Ga0207681_10552068 | Ga0207681_105520682 | 166 |
| 338 | 3300025923 | Ga0207681_10747233 | Ga0207681_107472332 | 166 |
| 339 | 3300025924 | Ga0207694_10000119 | Ga0207694_1000011956 | 166 |
| 340 | 3300025924 | Ga0207694_10079907 | Ga0207694_100799073 | 166 |
| 341 | 3300025925 | Ga0207650_10249368 | Ga0207650_102493681 | 166 |
| 342 | 3300025928 | Ga0207700_10009772 | Ga0207700_100097724 | 166 |
| 343 | 3300025929 | Ga0207664_10704221 | Ga0207664_107042211 | 166 |
| 344 | 3300025931 | Ga0207644_10088691 | Ga0207644_100886912 | 166 |
| 345 | 3300025932 | Ga0207690_10424637 | Ga0207690_104246371 | 166 |
| 346 | 3300025933 | Ga0207706_10343491 | Ga0207706_103434911 | 166 |
| 347 | 3300025933 | Ga0207706_10550529 | Ga0207706_105505291 | 166 |
| 348 | 3300025934 | Ga0207686_10457169 | Ga0207686_104571691 | 166 |
| 349 | 3300025935 | Ga0207709_10700204 | Ga0207709_107002041 | 166 |
| 350 | 3300025937 | Ga0207669_10058015 | Ga0207669_100580152 | 166 |
| 351 | 3300025938 | Ga0207704_10063870 | Ga0207704_100638702 | 166 |
| 352 | 3300025938 | Ga0207704_10336993 | Ga0207704_103369932 | 166 |
| 353 | 3300025939 | Ga0207665_10002479 | Ga0207665_100024798 | 166 |
| 354 | 3300025940 | Ga0207691_10540647 | Ga0207691_105406472 | 166 |
| 355 | 3300025941 | Ga0207711_10254250 | Ga0207711_102542501 | 166 |
| 356 | 3300025942 | Ga0207689_10038611 | Ga0207689_100386113 | 166 |
| 357 | 3300025942 | Ga0207689_10325483 | Ga0207689_103254832 | 166 |
| 358 | 3300025945 | Ga0207679_10319723 | Ga0207679_103197232 | 166 |
| 359 | 3300025945 | Ga0207679_11081388 | Ga0207679_110813881 | 166 |
| 360 | 3300025949 | Ga0207667_10008027 | Ga0207667_100080275 | 166 |
| 361 | 3300025949 | Ga0207667_10057455 | Ga0207667_100574553 | 166 |
| 362 | 3300025960 | Ga0207651_10053509 | Ga0207651_100535092 | 166 |
| 363 | 3300025960 | Ga0207651_11451177 | Ga0207651_114511771 | 166 |
| 364 | 3300025972 | Ga0207668_10022936 | Ga0207668_100229363 | 166 |
| 365 | 3300025972 | Ga0207668_10585561 | Ga0207668_105855611 | 166 |
| 366 | 3300025981 | Ga0207640_10006001 | Ga0207640_100060011 | 166 |
| 367 | 3300025986 | Ga0207658_10590830 | Ga0207658_105908302 | 166 |
| 368 | 3300026035 | Ga0207703_10058819 | Ga0207703_100588192 | 166 |
| 369 | 3300026035 | Ga0207703_10485271 | Ga0207703_104852711 | 166 |
| 370 | 3300026041 | Ga0207639_10009164 | Ga0207639_100091645 | 166 |
| 371 | 3300026041 | Ga0207639_10090472 | Ga0207639_100904723 | 166 |
| 372 | 3300026041 | Ga0207639_10207692 | Ga0207639_102076921 | 166 |
| 373 | 3300026041 | Ga0207639_11594870 | Ga0207639_115948701 | 166 |
| 374 | 3300026067 | Ga0207678_10039602 | Ga0207678_100396023 | 166 |
| 375 | 3300026067 | Ga0207678_10057735 | Ga0207678_100577352 | 166 |
| 376 | 3300026067 | Ga0207678_10146825 | Ga0207678_101468253 | 166 |
| 377 | 3300026078 | Ga0207702_10000002 | Ga0207702_1000000256 | 166 |
| 378 | 3300026078 | Ga0207702_10007362 | Ga0207702_100073626 | 166 |
| 379 | 3300026078 | Ga0207702_10163454 | Ga0207702_101634543 | 166 |
| 380 | 3300026078 | Ga0207702_10380415 | Ga0207702_103804152 | 166 |
| 381 | 3300026078 | Ga0207702_10813991 | Ga0207702_108139911 | 166 |
| 382 | 3300026088 | Ga0207641_10962871 | Ga0207641_109628711 | 166 |
| 383 | 3300026089 | Ga0207648_10150855 | Ga0207648_101508551 | 166 |
| 384 | 3300026095 | Ga0207676_10064094 | Ga0207676_100640942 | 166 |
| 385 | 3300026095 | Ga0207676_10825961 | Ga0207676_108259611 | 166 |
| 386 | 3300026116 | Ga0207674_10001403 | Ga0207674_1000140317 | 166 |
| 387 | 3300026116 | Ga0207674_10003336 | Ga0207674_100033368 | 166 |
| 388 | 3300026116 | Ga0207674_10490379 | Ga0207674_104903792 | 166 |
| 389 | 3300026118 | Ga0207675_100446579 | Ga0207675_1004465791 | 166 |
| 390 | 3300026121 | Ga0207683_10088488 | Ga0207683_100884882 | 166 |
| 391 | 3300026121 | Ga0207683_10165671 | Ga0207683_101656711 | 166 |
| 392 | 3300026142 | Ga0207698_10114018 | Ga0207698_101140181 | 166 |
| 393 | 3300026142 | Ga0207698_10404562 | Ga0207698_104045621 | 166 |
| 394 | 3300026142 | Ga0207698_10430350 | Ga0207698_104303502 | 166 |
| 395 | 3300027512 | Ga0209179_1001160 | Ga0209179_10011602 | 166 |
| 396 | 3300027671 | Ga0209588_1002049 | Ga0209588_10020492 | 166 |
| 397 | 3300027907 | Ga0207428_10423596 | Ga0207428_104235962 | 166 |
| 398 | 3300028379 | Ga0268266_10007641 | Ga0268266_100076414 | 166 |
| 399 | 3300028379 | Ga0268266_10204944 | Ga0268266_102049441 | 166 |
| 400 | 3300028380 | Ga0268265_10164205 | Ga0268265_101642052 | 166 |
| 401 | 3300028380 | Ga0268265_10346076 | Ga0268265_103460761 | 166 |
| 402 | 3300028381 | Ga0268264_10298325 | Ga0268264_102983252 | 166 |
| 403 | 3300028381 | Ga0268264_10300312 | Ga0268264_103003122 | 166 |
| 404 | 3300028381 | Ga0268264_10824206 | Ga0268264_108242061 | 166 |
| 405 | 3300031507 | Ga0307509_10100629 | Ga0307509_101006291 | 166 |
| 406 | 3300031548 | Ga0307408_100336685 | Ga0307408_1003366851 | 166 |
| 407 | 3300031616 | Ga0307508_10099082 | Ga0307508_100990823 | 166 |
| 408 | 3300031711 | Ga0265314_10042546 | Ga0265314_100425462 | 166 |
| 409 | 3300031731 | Ga0307405_10698304 | Ga0307405_106983041 | 166 |
| 410 | 3300031911 | Ga0307412_10163237 | Ga0307412_101632372 | 166 |
| 411 | 3300032002 | Ga0307416_101129291 | Ga0307416_1011292911 | 166 |
| 412 | 3300032004 | Ga0307414_10150456 | Ga0307414_101504562 | 166 |
| 413 | 3300032126 | Ga0307415_100643805 | Ga0307415_1006438051 | 166 |
| 414 | 3300035086 | Ga0373934_0025224 | Ga0373934_0025224_441_941 | 166 |
| 415 | 3300035086 | Ga0373934_0154505 | Ga0373934_0154505_405_923 | 166 |
| 416 | 3300035111 | Ga0373923_0055492 | Ga0373923_0055492_204_722 | 166 |
| 417 | 3300035113 | Ga0373936_0130961 | Ga0373936_0130961_236_754 | 166 |
| 418 | 3300035116 | Ga0373945_0165776 | Ga0373945_0165776_219_737 | 166 |
| 419 | 3300035118 | Ga0373954_0010657 | Ga0373954_0010657_227_727 | 166 |
| 420 | 3300035118 | Ga0373954_0017973 | Ga0373954_0017973_1260_1778 | 166 |
| 421 | 3300035119 | Ga0373956_0015069 | Ga0373956_0015069_368_868 | 166 |
| 422 | 3300035119 | Ga0373956_0099609 | Ga0373956_0099609_178_696 | 166 |
| 423 | 3300035120 | Ga0373957_0031050 | Ga0373957_0031050_557_1057 | 166 |
| 424 | 3300035120 | Ga0373957_0040807 | Ga0373957_0040807_341_859 | 166 |
| 425 | 3300035170 | Ga0373943_0011977 | Ga0373943_0011977_2879_3397 | 166 |
| 426 | 3300035170 | Ga0373943_0024541 | Ga0373943_0024541_827_1330 | 166 |
| 427 | 3300035171 | Ga0373946_0365309 | Ga0373946_0365309_34_552 | 166 |
| 428 | 3300035172 | Ga0373955_0061075 | Ga0373955_0061075_959_1459 | 166 |
| 429 | 3300035172 | Ga0373955_0076606 | Ga0373955_0076606_1198_1716 | 166 |
| 430 | 3300035410 | Ga0373924_0031931 | Ga0373924_0031931_376_894 | 166 |
| 431 | 3300035410 | Ga0373924_0243713 | Ga0373924_0243713_266_766 | 166 |
| 432 | 3300035691 | Ga0373931_0019175 | Ga0373931_0019175_573_1091 | 166 |
| 433 | 3300035692 | Ga0373935_0194267 | Ga0373935_0194267_231_749 | 166 |
| 434 | 3300035695 | Ga0373927_0075982 | Ga0373927_0075982_531_1049 | 166 |
| 435 | 3300035724 | Ga0373933_0184492 | Ga0373933_0184492_198_698 | 166 |
| 436 | 3300035724 | Ga0373933_0311232 | Ga0373933_0311232_159_677 | 166 |
| 437 | 3300035725 | Ga0373947_0050666 | Ga0373947_0050666_355_873 | 166 |
| 438 | 3300035725 | Ga0373947_0110591 | Ga0373947_0110591_1064_1567 | 166 |
| 439 | 3300035725 | Ga0373947_0213873 | Ga0373947_0213873_62_565 | 166 |
| 440 | 3300036242 | Ga0310104_04734 | Ga0310104_04734_267_773 | 166 |
| 441 | 3300036401 | Ga0373937_0043093 | Ga0373937_0043093_2966_3466 | 166 |
| 442 | 3300036401 | Ga0373937_0155095 | Ga0373937_0155095_818_1336 | 166 |
| 443 | 3300036458 | Ga0310112_026682 | Ga0310112_026682_245_745 | 166 |
| 444 | 3300036459 | Ga0372808_003072 | Ga0372808_003072_907_1413 | 166 |
| 445 | 3300036534 | Ga0310109_024891 | Ga0310109_024891_99_605 | 166 |
| 446 | 3300037068 | Ga0373925_0886400 | Ga0373925_0886400_111_629 | 166 |
| 447 | 3300039437 | Ga0436365_0109261 | Ga0436365_0109261_277_780 | 166 |
| 448 | 3300039437 | Ga0436365_0740383 | Ga0436365_0740383_460_963 | 166 |
| 449 | 3300039437 | Ga0436365_1835761 | Ga0436365_1835761_26701_27201 | 166 |
| 450 | 3300039438 | Ga0436360_0550228 | Ga0436360_0550228_51_554 | 166 |
| 451 | 3300039438 | Ga0436360_0854373 | Ga0436360_0854373_116_619 | 166 |
| 452 | 3300039447 | Ga0436361_0467457 | Ga0436361_0467457_409_912 | 166 |
| 453 | 3300039447 | Ga0436361_1014259 | Ga0436361_1014259_15816_16319 | 166 |
| 454 | 3300039453 | Ga0436362_0006141 | Ga0436362_0006141_966_1574 | 166 |
| 455 | 3300039453 | Ga0436362_0643370 | Ga0436362_0643370_162_665 | 166 |
| 456 | 3300039453 | Ga0436362_1206035 | Ga0436362_1206035_734_1237 | 166 |
| 457 | 3300041453 | Ga0451797_1308170 | Ga0451797_1308170_180_683 | 166 |
| 458 | 3300041460 | Ga0451802_2006855 | Ga0451802_2006855_204_707 | 166 |
| 459 | 3300041486 | Ga0451807_1787443 | Ga0451807_1787443_1849_2352 | 166 |
| 460 | 3300044694 | Ga0466963_0058718 | Ga0466963_0058718_1953_2453 | 166 |
| 461 | 3300044735 | Ga0466968_0194455 | Ga0466968_0194455_321_824 | 166 |
| 462 | 3300045976 | Ga0466967_0500724 | Ga0466967_0500724_448_999 | 166 |
| 463 | 3300046453 | Ga0495627_026739 | Ga0495627_026739_1329_1847 | 166 |
| 464 | 3300046454 | Ga0495592_0009399 | Ga0495592_0009399_2748_3248 | 166 |
| 465 | 3300046455 | Ga0495603_0023365 | Ga0495603_0023365_2590_3108 | 166 |
| 466 | 3300046455 | Ga0495603_0795587 | Ga0495603_0795587_22_525 | 166 |
| 467 | 3300046457 | Ga0495590_0266702 | Ga0495590_0266702_78_596 | 166 |
| 468 | 3300046459 | Ga0495629_0083386 | Ga0495629_0083386_278_778 | 166 |
| 469 | 3300046460 | Ga0495638_0181682 | Ga0495638_0181682_91_594 | 166 |
| 470 | 3300046460 | Ga0495638_0217040 | Ga0495638_0217040_440_958 | 166 |
| 471 | 3300046461 | Ga0495641_0024865 | Ga0495641_0024865_2332_2850 | 166 |
| 472 | 3300046462 | Ga0495651_0043105 | Ga0495651_0043105_962_1462 | 166 |
| 473 | 3300046463 | Ga0495653_0022987 | Ga0495653_0022987_1010_1510 | 166 |
| 474 | 3300046471 | Ga0495650_0167220 | Ga0495650_0167220_78_596 | 166 |
| 475 | 3300046472 | Ga0495580_0125990 | Ga0495580_0125990_316_834 | 166 |
| 476 | 3300046474 | Ga0495605_0078489 | Ga0495605_0078489_117_635 | 166 |
| 477 | 3300046475 | Ga0495639_0015742 | Ga0495639_0015742_1350_1868 | 166 |
| 478 | 3300046475 | Ga0495639_0097446 | Ga0495639_0097446_142_660 | 166 |
| 479 | 3300046477 | Ga0495664_0069929 | Ga0495664_0069929_1236_1754 | 166 |
| 480 | 3300046491 | Ga0495584_0254153 | Ga0495584_0254153_133_651 | 166 |
| 481 | 3300046492 | Ga0495585_0119329 | Ga0495585_0119329_679_1197 | 166 |
| 482 | 3300046499 | Ga0495594_0162800 | Ga0495594_0162800_461_979 | 166 |
| 483 | 3300046499 | Ga0495594_0484849 | Ga0495594_0484849_83_601 | 166 |
| 484 | 3300046500 | Ga0495596_0150727 | Ga0495596_0150727_116_634 | 166 |
| 485 | 3300046501 | Ga0495607_0058223 | Ga0495607_0058223_37_555 | 166 |
| 486 | 3300046506 | Ga0495583_0086754 | Ga0495583_0086754_22_540 | 166 |
| 487 | 3300046511 | Ga0495608_0015773 | Ga0495608_0015773_336_836 | 166 |
| 488 | 3300046513 | Ga0495616_0096142 | Ga0495616_0096142_519_1037 | 166 |
| 489 | 3300046513 | Ga0495616_0310745 | Ga0495616_0310745_55_558 | 166 |
| 490 | 3300046514 | Ga0495618_0071700 | Ga0495618_0071700_980_1498 | 166 |
| 491 | 3300046516 | Ga0495628_0022019 | Ga0495628_0022019_557_1057 | 166 |
| 492 | 3300046516 | Ga0495628_0345834 | Ga0495628_0345834_296_814 | 166 |
| 493 | 3300046517 | Ga0495630_0379938 | Ga0495630_0379938_110_610 | 166 |
| 494 | 3300046517 | Ga0495630_0509393 | Ga0495630_0509393_392_895 | 166 |
| 495 | 3300046518 | Ga0495631_0146989 | Ga0495631_0146989_249_767 | 166 |
| 496 | 3300046523 | Ga0495644_0049465 | Ga0495644_0049465_217_735 | 166 |
| 497 | 3300046523 | Ga0495644_0092261 | Ga0495644_0092261_364_882 | 166 |
| 498 | 3300046524 | Ga0495648_0260888 | Ga0495648_0260888_94_612 | 166 |
| 499 | 3300046525 | Ga0495663_0033759 | Ga0495663_0033759_446_964 | 166 |
| 500 | 3300046528 | Ga0495642_0220839 | Ga0495642_0220839_261_779 | 166 |
| 501 | 3300046529 | Ga0495652_0248543 | Ga0495652_0248543_365_883 | 166 |
| 502 | 3300046530 | Ga0495654_0226690 | Ga0495654_0226690_53_571 | 166 |
| 503 | 3300046531 | Ga0495665_0021120 | Ga0495665_0021120_2788_3306 | 166 |
| 504 | 3300046531 | Ga0495665_0151436 | Ga0495665_0151436_47_565 | 166 |
| 505 | 3300046533 | Ga0495640_0095959 | Ga0495640_0095959_153_671 | 166 |
| 506 | 3300046535 | Ga0495586_0189702 | Ga0495586_0189702_194_712 | 166 |
| 507 | 3300046536 | Ga0495587_0069857 | Ga0495587_0069857_461_961 | 166 |
| 508 | 3300046537 | Ga0495598_0008239 | Ga0495598_0008239_380_898 | 166 |
| 509 | 3300046538 | Ga0495609_0149835 | Ga0495609_0149835_225_743 | 166 |
| 510 | 3300046539 | Ga0495621_0070013 | Ga0495621_0070013_485_1003 | 166 |
| 511 | 3300046543 | Ga0495645_0034669 | Ga0495645_0034669_2901_3401 | 166 |
| 512 | 3300046543 | Ga0495645_0091984 | Ga0495645_0091984_1194_1712 | 166 |
| 513 | 3300046557 | Ga0495622_0242617 | Ga0495622_0242617_19_522 | 166 |
| 514 | 3300046558 | Ga0495633_0111468 | Ga0495633_0111468_152_670 | 166 |
| 515 | 3300046559 | Ga0495667_0016017 | Ga0495667_0016017_2261_2761 | 166 |
| 516 | 3300046559 | Ga0495667_0095002 | Ga0495667_0095002_916_1434 | 166 |
| 517 | 3300046616 | Ga0495668_0036112 | Ga0495668_0036112_1529_2032 | 166 |
| 518 | 3300046616 | Ga0495668_0171280 | Ga0495668_0171280_470_988 | 166 |
| 519 | 3300046642 | Ga0495634_0123627 | Ga0495634_0123627_832_1332 | 166 |
| 520 | 3300046642 | Ga0495634_0394044 | Ga0495634_0394044_294_812 | 166 |
| 521 | 3300046648 | Ga0495611_0174174 | Ga0495611_0174174_13_531 | 166 |
| 522 | 3300046660 | Ga0495625_0274623 | Ga0495625_0274623_280_798 | 166 |
| 523 | 3300046660 | Ga0495625_0536515 | Ga0495625_0536515_53_556 | 166 |
| 524 | 3300046663 | Ga0495635_0090861 | Ga0495635_0090861_1309_1809 | 166 |
| 525 | 3300046663 | Ga0495635_0102556 | Ga0495635_0102556_1279_1797 | 166 |
| 526 | 3300046664 | Ga0495659_0250155 | Ga0495659_0250155_93_611 | 166 |
| 527 | 3300046665 | Ga0495661_0169867 | Ga0495661_0169867_631_1149 | 166 |
| 528 | 3300046674 | Ga0495588_0143243 | Ga0495588_0143243_388_906 | 166 |
| 529 | 3300046675 | Ga0495657_0011755 | Ga0495657_0011755_1252_1752 | 166 |
| 530 | 3300046675 | Ga0495657_0361038 | Ga0495657_0361038_280_780 | 166 |
| 531 | 3300046678 | Ga0495599_0005538 | Ga0495599_0005538_5017_5517 | 166 |
| 532 | 3300046679 | Ga0495623_0015881 | Ga0495623_0015881_833_1333 | 166 |
| 533 | 3300046680 | Ga0495646_0020397 | Ga0495646_0020397_198_698 | 166 |
| 534 | 3300046680 | Ga0495646_0169137 | Ga0495646_0169137_44_562 | 166 |
| 535 | 3300046683 | Ga0495658_0587474 | Ga0495658_0587474_91_609 | 166 |
| 536 | 3300046684 | Ga0495669_0014266 | Ga0495669_0014266_268_786 | 166 |
| 537 | 3300046684 | Ga0495669_0299130 | Ga0495669_0299130_245_763 | 166 |
| 538 | 3300046689 | Ga0495613_0166784 | Ga0495613_0166784_125_643 | 166 |
| 539 | 3300046692 | Ga0495671_0161733 | Ga0495671_0161733_263_766 | 166 |
| 540 | 3300046692 | Ga0495671_0222564 | Ga0495671_0222564_244_762 | 166 |
| 541 | 3300046694 | Ga0495649_0120774 | Ga0495649_0120774_95_613 | 166 |
| 542 | 3300046794 | Ga0495589_0084056 | Ga0495589_0084056_499_1017 | 166 |
| 543 | 3300046794 | Ga0495589_0329198 | Ga0495589_0329198_143_646 | 166 |
| 544 | 3300046809 | Ga0495600_0147270 | Ga0495600_0147270_774_1292 | 166 |
| 545 | 3300046809 | Ga0495600_0182408 | Ga0495600_0182408_198_698 | 166 |
| 546 | 3300046810 | Ga0495660_0309600 | Ga0495660_0309600_115_633 | 166 |
| 547 | 3300047315 | Ga0495581_0630063 | Ga0495581_0630063_101_604 | 166 |
| 548 | 3300047317 | Ga0495604_0032197 | Ga0495604_0032197_1033_1533 | 166 |
| 549 | 3300047317 | Ga0495604_0235671 | Ga0495604_0235671_326_844 | 166 |
| 550 | 3300047317 | Ga0495604_0442851 | Ga0495604_0442851_203_706 | 166 |
| 551 | 3300047318 | Ga0495636_0114962 | Ga0495636_0114962_191_709 | 166 |
| 552 | 3300047319 | Ga0495674_0040165 | Ga0495674_0040165_1936_2436 | 166 |
| 553 | 3300047319 | Ga0495674_0117043 | Ga0495674_0117043_949_1467 | 166 |
| 554 | 3300047320 | Ga0495672_0420459 | Ga0495672_0420459_37_555 | 166 |
| 555 | 3300047322 | Ga0495680_0032674 | Ga0495680_0032674_1102_1602 | 166 |
| 556 | 3300047322 | Ga0495680_0761933 | Ga0495680_0761933_13_531 | 166 |
| 557 | 3300047444 | Ga0495675_0028977 | Ga0495675_0028977_71_571 | 166 |
| 558 | 3300047445 | Ga0495677_0128955 | Ga0495677_0128955_242_760 | 166 |
| 559 | 3300047446 | Ga0495679_086633 | Ga0495679_086633_249_764 | 166 |
| 560 | 3300047447 | Ga0495685_072302 | Ga0495685_072302_247_765 | 166 |
| 561 | 3300047470 | Ga0495681_0118086 | Ga0495681_0118086_365_883 | 166 |
| 562 | 3300047471 | Ga0495684_0028966 | Ga0495684_0028966_1863_2381 | 166 |
| 563 | 3300047471 | Ga0495684_0033165 | Ga0495684_0033165_761_1261 | 166 |
| 564 | 3300047472 | Ga0495686_0098254 | Ga0495686_0098254_901_1401 | 166 |
| 565 | 3300047472 | Ga0495686_0309689 | Ga0495686_0309689_137_640 | 166 |
| 566 | 3300047472 | Ga0495686_0373863 | Ga0495686_0373863_241_759 | 166 |
| 567 | 3300047673 | Ga0495593_0211211 | Ga0495593_0211211_288_806 | 166 |
| 568 | 3300048088 | Ga0495602_0099301 | Ga0495602_0099301_557_1057 | 166 |
| 569 | 3300048089 | Ga0495614_0113685 | Ga0495614_0113685_327_845 | 166 |
| 570 | 3300048090 | Ga0495615_0085491 | Ga0495615_0085491_102_620 | 166 |
| 571 | 3300048091 | Ga0495626_0290351 | Ga0495626_0290351_51_569 | 166 |
| 572 | 3300048904 | Ga0496101_0154408 | Ga0496101_0154408_1204_1722 | 166 |
| 573 | 3300048906 | Ga0496103_0806292 | Ga0496103_0806292_62_580 | 166 |
| 574 | 3300048907 | Ga0496104_0056482 | Ga0496104_0056482_2582_3100 | 166 |
| 575 | 3300048907 | Ga0496104_0156921 | Ga0496104_0156921_606_1124 | 166 |
| 576 | 3300048908 | Ga0496105_0034864 | Ga0496105_0034864_3011_3529 | 166 |
| 577 | 3300048908 | Ga0496105_0288088 | Ga0496105_0288088_230_733 | 166 |
| 578 | 3300048909 | Ga0496106_0198104 | Ga0496106_0198104_11_529 | 166 |
| 579 | 3300048909 | Ga0496106_0268337 | Ga0496106_0268337_758_1261 | 166 |
| 580 | 3300048909 | Ga0496106_0571314 | Ga0496106_0571314_199_717 | 166 |
| 581 | 3300048910 | Ga0496107_0195303 | Ga0496107_0195303_677_1195 | 166 |
| 582 | 3300048911 | Ga0496108_0938772 | Ga0496108_0938772_164_667 | 166 |
| 583 | 3300048913 | Ga0496110_0215074 | Ga0496110_0215074_445_963 | 166 |
| 584 | 3300048913 | Ga0496110_0317481 | Ga0496110_0317481_215_718 | 166 |
| 585 | 3300048913 | Ga0496110_0376315 | Ga0496110_0376315_455_973 | 166 |
| 586 | 3300048914 | Ga0496111_0529448 | Ga0496111_0529448_204_722 | 166 |
| 587 | 3300048915 | Ga0496112_0006924 | Ga0496112_0006924_3008_3526 | 166 |
| 588 | 3300048915 | Ga0496112_0090831 | Ga0496112_0090831_322_840 | 166 |
| 589 | 3300048915 | Ga0496112_0149815 | Ga0496112_0149815_1494_1997 | 166 |
| 590 | 3300048916 | Ga0496113_0086279 | Ga0496113_0086279_280_780 | 166 |
| 591 | 3300048916 | Ga0496113_0238654 | Ga0496113_0238654_151_654 | 166 |
| 592 | 3300048922 | Ga0496119_0135808 | Ga0496119_0135808_147_650 | 166 |
| 593 | 3300048924 | Ga0496121_0087668 | Ga0496121_0087668_226_729 | 166 |
| 594 | 3300048924 | Ga0496121_0158350 | Ga0496121_0158350_873_1376 | 166 |
| 595 | 3300048926 | Ga0496123_0213462 | Ga0496123_0213462_67_570 | 166 |
| 596 | 3300048927 | Ga0496124_0071117 | Ga0496124_0071117_2166_2669 | 166 |
| 597 | 3300048928 | Ga0496125_0000040 | Ga0496125_0000040_53691_54191 | 166 |
| 598 | 3300048929 | Ga0496126_0020883 | Ga0496126_0020883_5225_5728 | 166 |
| 599 | 3300049460 | Ga0495682_0172079 | Ga0495682_0172079_31_549 | 166 |
| 600 | 3300049583 | Ga0501067_0310648 | Ga0501067_0310648_103_606 | 166 |
| 601 | 3300050489 | nmdc:mga03683_129021_c1 | nmdc:mga03683_129021_c1_420_938 | 166 |
| 602 | 3300050489 | nmdc:mga03683_240165_c1 | nmdc:mga03683_240165_c1_13_531 | 166 |
| 603 | 3300050490 | nmdc:mga03n38_241069_c1 | nmdc:mga03n38_241069_c1_289_789 | 166 |
| 604 | 3300050490 | nmdc:mga03n38_2988_c1 | nmdc:mga03n38_2988_c1_1965_2483 | 166 |
| 605 | 3300050491 | nmdc:mga00v17_71775_c1 | nmdc:mga00v17_71775_c1_490_993 | 166 |
| 606 | 3300050492 | nmdc:mga0yw44_133459_c1 | nmdc:mga0yw44_133459_c1_26_529 | 166 |
| 607 | 3300050492 | nmdc:mga0yw44_139144_c1 | nmdc:mga0yw44_139144_c1_189_692 | 166 |
| 608 | 3300050492 | nmdc:mga0yw44_378424_c1 | nmdc:mga0yw44_378424_c1_219_737 | 166 |
| 609 | 3300050493 | nmdc:mga0k408_290094_c1 | nmdc:mga0k408_290094_c1_329_832 | 166 |
| 610 | 3300050494 | nmdc:mga06z11_440500_c1 | nmdc:mga06z11_440500_c1_95_598 | 166 |
| 611 | 3300050494 | nmdc:mga06z11_61125_c1 | nmdc:mga06z11_61125_c1_413_931 | 166 |
| 612 | 3300050496 | nmdc:mga07m45_22659_c1 | nmdc:mga07m45_22659_c1_1784_2302 | 166 |
| 613 | 3300050496 | nmdc:mga07m45_531273_c1 | nmdc:mga07m45_531273_c1_33_536 | 166 |
| 614 | 3300050511 | nmdc:mga08y16_369268_c1 | nmdc:mga08y16_369268_c1_624_1142 | 166 |
| 615 | 3300050512 | nmdc:mga0n895_15503_c1 | nmdc:mga0n895_15503_c1_2790_3335 | 166 |
| 616 | 3300050515 | nmdc:mga0a205_223818_c1 | nmdc:mga0a205_223818_c1_846_1349 | 166 |
| 617 | 3300050516 | nmdc:mga0sz30_29942_c1 | nmdc:mga0sz30_29942_c1_846_1349 | 166 |
| 618 | 3300053077 | Ga0495601_0175156 | Ga0495601_0175156_159_677 | 166 |
| 619 | 3300053080 | Ga0500635_0092058 | Ga0500635_0092058_465_983 | 166 |
| 620 | 3300053083 | Ga0495655_0249085 | Ga0495655_0249085_29_547 | 166 |
| 621 | 3300053085 | Ga0495619_0089151 | Ga0495619_0089151_1388_1888 | 166 |
| 622 | 3300053090 | Ga0500646_0024762 | Ga0500646_0024762_30_533 | 166 |
| 623 | 3300053091 | Ga0500647_0283931 | Ga0500647_0283931_134_652 | 166 |
| 624 | 3300053094 | Ga0500566_0038049 | Ga0500566_0038049_735_1253 | 166 |
| 625 | 3300053096 | Ga0500641_0008512 | Ga0500641_0008512_719_1222 | 166 |
| 626 | 3300053102 | Ga0500554_000257 | Ga0500554_000257_804_1322 | 166 |
| 627 | 3300053118 | Ga0500594_0117380 | Ga0500594_0117380_279_782 | 166 |
| 628 | 3300053119 | Ga0500595_002263 | Ga0500595_002263_5315_5833 | 166 |
| 629 | 3300053134 | Ga0500658_0231389 | Ga0500658_0231389_116_634 | 166 |
| 630 | 3300053147 | Ga0500589_012741 | Ga0500589_012741_2984_3487 | 166 |
| 631 | 3300053150 | Ga0500603_000177 | Ga0500603_000177_10201_10719 | 166 |
| 632 | 3300053150 | Ga0500603_006316 | Ga0500603_006316_1003_1521 | 166 |
| 633 | 3300053162 | Ga0500638_025050 | Ga0500638_025050_81_599 | 166 |
| 634 | 3300053177 | Ga0500636_0002975 | Ga0500636_0002975_4018_4518 | 166 |
| 635 | 3300053178 | Ga0500637_0000927 | Ga0500637_0000927_8463_8981 | 166 |
| 636 | 3300053178 | Ga0500637_0002404 | Ga0500637_0002404_5315_5833 | 166 |
| 637 | 3300055283 | Ga0500661_000024 | Ga0500661_000024_8691_9209 | 166 |
| 638 | 3300059491 | Ga0587070_092344 | Ga0587070_092344_147_650 | 166 |
| 639 | 3300059645 | Ga0587076_132961 | Ga0587076_132961_46_549 | 166 |
| 640 | iso_pu_bacteria | 2721755755 | 2723843721 | 166 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wjc-assembly1.cif.gz_B | crystal structure of mutant nitrobindin m75l/h76l/q96c/m148l/h158l covalently linked with [rh(cp-mal)(cod)] (nb4-rh) from arabidopsis thaliana | 0.8294 | 35 | 166 |
| 4ymy-assembly1.cif.gz_A-2 | crystal structure of mutant nitrobindin m75a/h76l/q96c/m148l/h158a (nb11) from arabidopsis thaliana | 0.8103 | 35 | 166 |
| 3wjg-assembly1.cif.gz_A-2 | crystal structure of mutant nitrobindin m75l/h76l/q96c/m148w/h158l (nb10) from arabidopsis thaliana | 0.8087 | 35 | 166 |
| 7bbm-assembly1.cif.gz_A-2 | mutant nitrobindin m75l/h76l/q96c/m148l (nb4h) from arabidopsis thaliana with cofactor mnppix | 0.8086 | 35 | 166 |
| 3wje-assembly1.cif.gz_A | crystal structure of mutant nitrobindin m75w/h76l/q96c/m148l/h158l (nb6) from arabidopsis thaliana | 0.8012 | 35 | 166 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vt8A00 | Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; | 0.819 | 120 | 162 | 3.40.1000.30 |
| af_A0A1D6NFT9_14_110_2.40.128.20 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.8134 | 39 | 119 | 2.40.128.20 |
| af_Q22857_66_227_2.40.128.20 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.8128 | 40 | 166 | 2.40.128.20 |
| 3wjeB00 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.7896 | 35 | 166 | 2.40.128.20 |
| 2fr2A00 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.7854 | 40 | 166 | 2.40.128.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L3T2C0-F1-model_v4 | Uncharacterized protein | 0.9804 | 35 | 166 |
|
| AF-A0A2A2VDC0-F1-model_v4 | Uncharacterized protein | 0.9789 | 40 | 165 |
|
| AF-A0A2A2VDC0-F1-model_v4 | Uncharacterized protein | 0.9636 | 40 | 165 |
|
| AF-A0A2S5MTQ3-F1-model_v4 | Lipocalin-like domain-containing protein | 0.9622 | 39 | 166 |
|
| AF-A0A537UGA3-F1-model_v4 | Uncharacterized protein | 0.9407 | 24 | 166 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar