F471591
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 639 | 294 | 636 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300005354|Ga0070675_100468002|Ga0070675_1004680021 |
| Length | 222 |
| Sequence | MSLRLFDVFHAMRAAPVAALLVAVLAAGRSEAALKPGDAAPAFKTQASLAGKAFEFNLKDQIAKGPVVVYFYPAAYTNGCNIQAHTFAEHIADFRAAGATVVGVSLDSIERLNEFSADPDYCAGKLPVASDPGGRIALSYDLQLRPAGGGRKDTRGREIDHASTERTTFVVGPDGKVAAAIGGVAPDANVLQALAFVRTLAATPGSRSTSDLTSPLPQRIQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 2 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 94 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 100 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 115 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 116 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 164 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 165 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 174 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 176 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 179 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 180 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 181 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 193 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 194 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 195 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 196 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 197 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 198 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 199 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 200 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 250 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 251 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 252 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 281 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 282 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 283 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 284 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 285 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 287 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 288 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 289 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 290 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 291 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 294 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.08 |
| Metatranscriptomes | 8.45 |
| Isolates | 0.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.24 |
| Nodule | 0 |
| Rhizoplane | 0.63 |
| Rhizosphere | 81.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000968 | 3300001915 | Bacteria | 8639 |
| 2 | JGI24741J21665_1010185 | 3300001915 | Bacteria | 1695 |
| 3 | JGI24740J21852_10000505 | 3300001979 | Bacteria | 16761 |
| 4 | JGI24740J21852_10000511 | 3300001979 | Bacteria | 16661 |
| 5 | JGI25162J39368_1001409 | 3300002737 | Bacteria | 13110 |
| 6 | JGI25157J39369_1000543 | 3300002741 | Bacteria | 22649 |
| 7 | JGI25164J39214_1000163 | 3300002772 | Bacteria | 63006 |
| 8 | JGI25164J39214_1000308 | 3300002772 | Bacteria | 32478 |
| 9 | JGI25164J39214_1005867 | 3300002772 | Bacteria | 1312 |
| 10 | JGI25165J46597_1000326 | 3300003214 | Bacteria | 57016 |
| 11 | JGI25165J46597_1002757 | 3300003214 | Bacteria | 5136 |
| 12 | rootH1_10164261 | 3300003316 | Bacteria | 1054 |
| 13 | rootH2_10161275 | 3300003320 | Bacteria | 8757 |
| 14 | rootH1_10003926 | 3300003323 | Bacteria | 77590 |
| 15 | Ga0055539_1006297 | 3300003752 | Bacteria | 1519 |
| 16 | Ga0055533_1004470 | 3300003756 | Bacteria | 2498 |
| 17 | Ga0055525_1000360 | 3300003759 | Bacteria | 30894 |
| 18 | Ga0055527_1000128 | 3300003760 | Bacteria | 53342 |
| 19 | Ga0055527_1000267 | 3300003760 | Bacteria | 31477 |
| 20 | Ga0055527_1000960 | 3300003760 | Bacteria | 7082 |
| 21 | Ga0055535_1000287 | 3300003761 | Bacteria | 53346 |
| 22 | Ga0055535_1000294 | 3300003761 | Bacteria | 51663 |
| 23 | Ga0055535_1000614 | 3300003761 | Bacteria | 29185 |
| 24 | Ga0055535_1000860 | 3300003761 | Bacteria | 21472 |
| 25 | Ga0055542_1000010 | 3300003762 | Bacteria | 414813 |
| 26 | Ga0055542_1000057 | 3300003762 | Bacteria | 162955 |
| 27 | Ga0055542_1000101 | 3300003762 | Bacteria | 116277 |
| 28 | Ga0055542_1000311 | 3300003762 | Bacteria | 53346 |
| 29 | Ga0055542_1000518 | 3300003762 | Bacteria | 34823 |
| 30 | Ga0055529_1000105 | 3300003763 | Bacteria | 123670 |
| 31 | Ga0055529_1000329 | 3300003763 | Bacteria | 53347 |
| 32 | Ga0055529_1000755 | 3300003763 | Bacteria | 20625 |
| 33 | Ga0055526_1002471 | 3300003771 | Bacteria | 12492 |
| 34 | Ga0055537_1003943 | 3300003773 | Bacteria | 4402 |
| 35 | Ga0055524_1002272 | 3300003775 | Bacteria | 10040 |
| 36 | Ga0055530_10000186 | 3300003791 | Bacteria | 55634 |
| 37 | Ga0058863_10059087 | 3300004799 | Bacteria | 1583 |
| 38 | Ga0058863_11435829 | 3300004799 | Unclassified | 773 |
| 39 | Ga0058861_10012108 | 3300004800 | Bacteria | 742 |
| 40 | Ga0058861_10037249 | 3300004800 | Bacteria | 1304 |
| 41 | Ga0058861_11678086 | 3300004800 | Bacteria | 715 |
| 42 | Ga0058861_12029677 | 3300004800 | Bacteria | 933 |
| 43 | Ga0058862_10060691 | 3300004803 | Bacteria | 926 |
| 44 | Ga0058862_12234460 | 3300004803 | Bacteria | 1071 |
| 45 | Ga0058862_12525583 | 3300004803 | Unclassified | 674 |
| 46 | Ga0058862_12545346 | 3300004803 | Bacteria | 841 |
| 47 | Ga0058862_12867910 | 3300004803 | Bacteria | 793 |
| 48 | Ga0065165_1072998 | 3300005262 | Bacteria | 907 |
| 49 | Ga0065707_10082740 | 3300005295 | Bacteria | 12384 |
| 50 | Ga0070658_10000153 | 3300005327 | Bacteria | 60625 |
| 51 | Ga0070658_10285021 | 3300005327 | Bacteria | 1406 |
| 52 | Ga0070658_11049881 | 3300005327 | Bacteria | 709 |
| 53 | Ga0070683_100207281 | 3300005329 | Bacteria | 1862 |
| 54 | Ga0070683_100457150 | 3300005329 | Bacteria | 1218 |
| 55 | Ga0070683_100477369 | 3300005329 | Bacteria | 1191 |
| 56 | Ga0068869_100157447 | 3300005334 | Bacteria | 1766 |
| 57 | Ga0068869_100281763 | 3300005334 | Bacteria | 1337 |
| 58 | Ga0070680_100001865 | 3300005336 | Bacteria | 15457 |
| 59 | Ga0070680_100034311 | 3300005336 | Bacteria | 4090 |
| 60 | Ga0070680_100050413 | 3300005336 | Bacteria | 3395 |
| 61 | Ga0070680_100062792 | 3300005336 | Bacteria | 3042 |
| 62 | Ga0070680_100322897 | 3300005336 | Bacteria | 1310 |
| 63 | Ga0070680_100553016 | 3300005336 | Bacteria | 986 |
| 64 | Ga0070682_100017773 | 3300005337 | Bacteria | 4148 |
| 65 | Ga0070682_100019204 | 3300005337 | Bacteria | 4006 |
| 66 | Ga0070682_100330824 | 3300005337 | Bacteria | 1129 |
| 67 | Ga0068868_100235765 | 3300005338 | Bacteria | 1536 |
| 68 | Ga0070660_100786687 | 3300005339 | Bacteria | 800 |
| 69 | Ga0070691_10001099 | 3300005341 | Bacteria | 11231 |
| 70 | Ga0070691_10053974 | 3300005341 | Bacteria | 1923 |
| 71 | Ga0070661_100003367 | 3300005344 | Bacteria | 11021 |
| 72 | Ga0070661_100233898 | 3300005344 | Bacteria | 1413 |
| 73 | Ga0070661_100409379 | 3300005344 | Bacteria | 1073 |
| 74 | Ga0070661_100593960 | 3300005344 | Bacteria | 894 |
| 75 | Ga0070692_10001540 | 3300005345 | Bacteria | 8468 |
| 76 | Ga0070692_10016588 | 3300005345 | Bacteria | 3504 |
| 77 | Ga0070692_10094689 | 3300005345 | Bacteria | 1628 |
| 78 | Ga0070692_10150641 | 3300005345 | Bacteria | 1324 |
| 79 | Ga0070675_100327556 | 3300005354 | Bacteria | 1354 |
| 80 | Ga0070675_100468002 | 3300005354 | Bacteria | 1132 |
| 81 | Ga0070671_100000028 | 3300005355 | Bacteria | 113877 |
| 82 | Ga0070659_100081620 | 3300005366 | Bacteria | 2582 |
| 83 | Ga0070667_100427369 | 3300005367 | Bacteria | 1208 |
| 84 | Ga0070714_100016246 | 3300005435 | Bacteria | 6003 |
| 85 | Ga0070713_100032124 | 3300005436 | Bacteria | 4189 |
| 86 | Ga0070701_10012388 | 3300005438 | Bacteria | 3845 |
| 87 | Ga0070663_100031066 | 3300005455 | Bacteria | 3667 |
| 88 | Ga0070663_100067718 | 3300005455 | Bacteria | 2590 |
| 89 | Ga0070663_100332150 | 3300005455 | Bacteria | 1226 |
| 90 | Ga0070681_10000086 | 3300005458 | Bacteria | 70488 |
| 91 | Ga0070681_10000230 | 3300005458 | Bacteria | 44114 |
| 92 | Ga0070681_10000536 | 3300005458 | Bacteria | 31204 |
| 93 | Ga0070681_10006881 | 3300005458 | Bacteria | 11069 |
| 94 | Ga0070681_10017005 | 3300005458 | Bacteria | 7268 |
| 95 | Ga0070681_10051051 | 3300005458 | Bacteria | 4125 |
| 96 | Ga0070681_10144414 | 3300005458 | Bacteria | 2309 |
| 97 | Ga0070681_10187187 | 3300005458 | Bacteria | 1990 |
| 98 | Ga0070681_10294759 | 3300005458 | Unclassified | 1532 |
| 99 | Ga0070679_100001047 | 3300005530 | Bacteria | 24095 |
| 100 | Ga0070679_100002395 | 3300005530 | Bacteria | 16997 |
| 101 | Ga0070679_100008496 | 3300005530 | Bacteria | 9673 |
| 102 | Ga0070679_100015994 | 3300005530 | Bacteria | 7226 |
| 103 | Ga0070679_100021147 | 3300005530 | Bacteria | 6348 |
| 104 | Ga0070684_100047927 | 3300005535 | Bacteria | 3705 |
| 105 | Ga0068853_100048960 | 3300005539 | Bacteria | 3630 |
| 106 | Ga0068853_100446716 | 3300005539 | Bacteria | 1216 |
| 107 | Ga0068853_100882543 | 3300005539 | Bacteria | 858 |
| 108 | Ga0070696_100002360 | 3300005546 | Bacteria | 12478 |
| 109 | Ga0070696_100063698 | 3300005546 | Bacteria | 2583 |
| 110 | Ga0070696_100241196 | 3300005546 | Bacteria | 1363 |
| 111 | Ga0070696_100254122 | 3300005546 | Bacteria | 1330 |
| 112 | Ga0070696_100266232 | 3300005546 | Bacteria | 1301 |
| 113 | Ga0070693_100002470 | 3300005547 | Bacteria | 8518 |
| 114 | Ga0070665_100023152 | 3300005548 | Bacteria | 6256 |
| 115 | Ga0070665_100413603 | 3300005548 | Bacteria | 1357 |
| 116 | Ga0070704_100046602 | 3300005549 | Bacteria | 3025 |
| 117 | Ga0068855_100000261 | 3300005563 | Bacteria | 65836 |
| 118 | Ga0068855_100013395 | 3300005563 | Bacteria | 9889 |
| 119 | Ga0068855_100017551 | 3300005563 | Bacteria | 8606 |
| 120 | Ga0068855_100017553 | 3300005563 | Bacteria | 8605 |
| 121 | Ga0068855_100025560 | 3300005563 | Bacteria | 7063 |
| 122 | Ga0068855_100052298 | 3300005563 | Bacteria | 4809 |
| 123 | Ga0068855_100099202 | 3300005563 | Bacteria | 3355 |
| 124 | Ga0068855_100704758 | 3300005563 | Bacteria | 1080 |
| 125 | Ga0070664_100098768 | 3300005564 | Bacteria | 2537 |
| 126 | Ga0068857_100271887 | 3300005577 | Bacteria | 1557 |
| 127 | Ga0068857_100880756 | 3300005577 | Bacteria | 858 |
| 128 | Ga0068857_100910235 | 3300005577 | Bacteria | 844 |
| 129 | Ga0068854_100009840 | 3300005578 | Bacteria | 6183 |
| 130 | Ga0068854_100030052 | 3300005578 | Bacteria | 3766 |
| 131 | Ga0068854_100289417 | 3300005578 | Bacteria | 1321 |
| 132 | Ga0068856_100140570 | 3300005614 | Bacteria | 2421 |
| 133 | Ga0068856_100142659 | 3300005614 | Bacteria | 2402 |
| 134 | Ga0068852_100643263 | 3300005616 | Bacteria | 1067 |
| 135 | Ga0068852_100730678 | 3300005616 | Bacteria | 1001 |
| 136 | Ga0068859_100231889 | 3300005617 | Bacteria | 1934 |
| 137 | Ga0068861_100314740 | 3300005719 | Unclassified | 1361 |
| 138 | Ga0068851_10044717 | 3300005834 | Bacteria | 2236 |
| 139 | Ga0068851_10248325 | 3300005834 | Bacteria | 1009 |
| 140 | Ga0068863_100658668 | 3300005841 | Bacteria | 1039 |
| 141 | Ga0068860_101133017 | 3300005843 | Bacteria | 802 |
| 142 | Ga0075366_10118877 | 3300006195 | Unclassified | 1592 |
| 143 | Ga0075428_100011828 | 3300006844 | Bacteria | 9714 |
| 144 | Ga0075428_100139703 | 3300006844 | Bacteria | 2634 |
| 145 | Ga0075431_100017829 | 3300006847 | Bacteria | 7218 |
| 146 | Ga0075433_10275185 | 3300006852 | Bacteria | 1492 |
| 147 | Ga0075429_100149809 | 3300006880 | Bacteria | 2042 |
| 148 | Ga0097620_100231889 | 3300006931 | Bacteria | 1934 |
| 149 | Ga0097620_100731721 | 3300006931 | Bacteria | 1079 |
| 150 | Ga0075435_100289600 | 3300007076 | Bacteria | 1399 |
| 151 | Ga0105240_10001826 | 3300009093 | Bacteria | 35711 |
| 152 | Ga0105240_10003386 | 3300009093 | Bacteria | 24782 |
| 153 | Ga0105240_10006479 | 3300009093 | Bacteria | 17192 |
| 154 | Ga0105240_10067254 | 3300009093 | Bacteria | 4442 |
| 155 | Ga0105240_10240929 | 3300009093 | Bacteria | 2097 |
| 156 | Ga0105240_10284162 | 3300009093 | Bacteria | 1899 |
| 157 | Ga0105240_10298602 | 3300009093 | Bacteria | 1843 |
| 158 | Ga0105240_11073758 | 3300009093 | Bacteria | 858 |
| 159 | Ga0111539_10029448 | 3300009094 | Bacteria | 6687 |
| 160 | Ga0111539_10050746 | 3300009094 | Bacteria | 4942 |
| 161 | Ga0111539_10089205 | 3300009094 | Bacteria | 3623 |
| 162 | Ga0111539_10129594 | 3300009094 | Bacteria | 2954 |
| 163 | Ga0111539_10781657 | 3300009094 | Bacteria | 1111 |
| 164 | Ga0114129_10770809 | 3300009147 | Bacteria | 1230 |
| 165 | Ga0105243_10045383 | 3300009148 | Bacteria | 3453 |
| 166 | Ga0105241_10111543 | 3300009174 | Bacteria | 2190 |
| 167 | Ga0105241_10502716 | 3300009174 | Bacteria | 1081 |
| 168 | Ga0105242_11673288 | 3300009176 | Unclassified | 672 |
| 169 | Ga0105237_10000183 | 3300009545 | Bacteria | 88412 |
| 170 | Ga0105237_10095262 | 3300009545 | Bacteria | 2966 |
| 171 | Ga0105238_10004866 | 3300009551 | Bacteria | 13286 |
| 172 | Ga0105238_10007034 | 3300009551 | Bacteria | 11250 |
| 173 | Ga0105238_10190079 | 3300009551 | Bacteria | 2029 |
| 174 | Ga0105238_10354488 | 3300009551 | Bacteria | 1456 |
| 175 | Ga0105249_10292920 | 3300009553 | Bacteria | 1630 |
| 176 | Ga0105239_10512584 | 3300010375 | Bacteria | 1364 |
| 177 | Ga0105246_10013007 | 3300011119 | Bacteria | 5207 |
| 178 | Ga0157373_10008206 | 3300013100 | Bacteria | 7766 |
| 179 | Ga0157373_10021463 | 3300013100 | Bacteria | 4690 |
| 180 | Ga0157373_10034377 | 3300013100 | Bacteria | 3640 |
| 181 | Ga0157371_10096189 | 3300013102 | Bacteria | 2099 |
| 182 | Ga0157370_10002285 | 3300013104 | Bacteria | 23243 |
| 183 | Ga0157370_10007483 | 3300013104 | Bacteria | 11861 |
| 184 | Ga0157370_10022245 | 3300013104 | Bacteria | 6309 |
| 185 | Ga0157370_10029604 | 3300013104 | Bacteria | 5371 |
| 186 | Ga0157370_10057856 | 3300013104 | Bacteria | 3684 |
| 187 | Ga0157370_10145638 | 3300013104 | Bacteria | 2206 |
| 188 | Ga0157369_10017028 | 3300013105 | Bacteria | 8167 |
| 189 | Ga0157369_10077580 | 3300013105 | Bacteria | 3561 |
| 190 | Ga0157369_10215605 | 3300013105 | Bacteria | 2011 |
| 191 | Ga0157369_10532822 | 3300013105 | Bacteria | 1214 |
| 192 | Ga0157369_10757839 | 3300013105 | Bacteria | 998 |
| 193 | Ga0157374_10005513 | 3300013296 | Bacteria | 10634 |
| 194 | Ga0157378_10227978 | 3300013297 | Bacteria | 1774 |
| 195 | Ga0157378_10720815 | 3300013297 | Bacteria | 1018 |
| 196 | Ga0163162_10804410 | 3300013306 | Unclassified | 1057 |
| 197 | Ga0157372_10000913 | 3300013307 | Bacteria | 32140 |
| 198 | Ga0157372_10004388 | 3300013307 | Bacteria | 15052 |
| 199 | Ga0157372_10009662 | 3300013307 | Bacteria | 10253 |
| 200 | Ga0157372_10074492 | 3300013307 | Bacteria | 3828 |
| 201 | Ga0157372_10274693 | 3300013307 | Bacteria | 1959 |
| 202 | Ga0157372_10831085 | 3300013307 | Bacteria | 1073 |
| 203 | Ga0157372_11108245 | 3300013307 | Bacteria | 916 |
| 204 | Ga0157375_10702884 | 3300013308 | Bacteria | 1164 |
| 205 | Ga0157380_10000816 | 3300014326 | Bacteria | 19526 |
| 206 | Ga0157380_10066614 | 3300014326 | Bacteria | 2897 |
| 207 | Ga0182008_10027617 | 3300014497 | Bacteria | 2873 |
| 208 | Ga0182007_10009484 | 3300015262 | Bacteria | 3918 |
| 209 | Ga0163161_10082665 | 3300017792 | Bacteria | 2366 |
| 210 | Ga0163161_10343346 | 3300017792 | Bacteria | 1185 |
| 211 | Ga0197907_10509654 | 3300020069 | Bacteria | 878 |
| 212 | Ga0197907_10527168 | 3300020069 | Bacteria | 4955 |
| 213 | Ga0197907_10639122 | 3300020069 | Bacteria | 1103 |
| 214 | Ga0197907_11156994 | 3300020069 | Bacteria | 854 |
| 215 | Ga0197907_11400373 | 3300020069 | Bacteria | 3737 |
| 216 | Ga0206356_10320396 | 3300020070 | Bacteria | 4242 |
| 217 | Ga0206356_10447347 | 3300020070 | Bacteria | 2884 |
| 218 | Ga0206356_10573590 | 3300020070 | Bacteria | 970 |
| 219 | Ga0206356_10935926 | 3300020070 | Bacteria | 3870 |
| 220 | Ga0206356_11158323 | 3300020070 | Bacteria | 2203 |
| 221 | Ga0206356_11526086 | 3300020070 | Bacteria | 970 |
| 222 | Ga0206356_11734160 | 3300020070 | Bacteria | 1052 |
| 223 | Ga0206349_1411469 | 3300020075 | Bacteria | 1114 |
| 224 | Ga0206349_1780936 | 3300020075 | Bacteria | 649 |
| 225 | Ga0206349_1969738 | 3300020075 | Bacteria | 629 |
| 226 | Ga0206355_1040908 | 3300020076 | Bacteria | 1100 |
| 227 | Ga0206355_1498383 | 3300020076 | Bacteria | 1019 |
| 228 | Ga0206351_10352168 | 3300020077 | Bacteria | 768 |
| 229 | Ga0206352_10568306 | 3300020078 | Bacteria | 1690 |
| 230 | Ga0206352_10607276 | 3300020078 | Bacteria | 836 |
| 231 | Ga0206352_10635024 | 3300020078 | Bacteria | 858 |
| 232 | Ga0206352_11267884 | 3300020078 | Bacteria | 760 |
| 233 | Ga0206350_10104620 | 3300020080 | Bacteria | 1231 |
| 234 | Ga0206350_10531860 | 3300020080 | Bacteria | 1679 |
| 235 | Ga0206350_11189059 | 3300020080 | Bacteria | 1099 |
| 236 | Ga0206354_10147252 | 3300020081 | Bacteria | 3290 |
| 237 | Ga0206354_10629525 | 3300020081 | Bacteria | 831 |
| 238 | Ga0206354_11117816 | 3300020081 | Bacteria | 3763 |
| 239 | Ga0206354_11327790 | 3300020081 | Bacteria | 1000 |
| 240 | Ga0206353_10803669 | 3300020082 | Bacteria | 4720 |
| 241 | Ga0206353_11069350 | 3300020082 | Bacteria | 1330 |
| 242 | Ga0154015_1006590 | 3300020610 | Bacteria | 1079 |
| 243 | Ga0154015_1376900 | 3300020610 | Bacteria | 1034 |
| 244 | Ga0154015_1478509 | 3300020610 | Bacteria | 6333 |
| 245 | Ga0154015_1496403 | 3300020610 | Bacteria | 2548 |
| 246 | Ga0224712_10113064 | 3300022467 | Bacteria | 1167 |
| 247 | Ga0224712_10172925 | 3300022467 | Bacteria | 969 |
| 248 | Ga0224712_10177225 | 3300022467 | Bacteria | 959 |
| 249 | Ga0224712_10217353 | 3300022467 | Bacteria | 874 |
| 250 | Ga0209566_102011 | 3300025225 | Bacteria | 4296 |
| 251 | Ga0209674_100026 | 3300025226 | Bacteria | 490631 |
| 252 | Ga0209674_100416 | 3300025226 | Bacteria | 20955 |
| 253 | Ga0209674_104234 | 3300025226 | Bacteria | 2377 |
| 254 | Ga0209672_100017 | 3300025228 | Bacteria | 514236 |
| 255 | Ga0209672_100024 | 3300025228 | Bacteria | 367869 |
| 256 | Ga0209672_100113 | 3300025228 | Bacteria | 92025 |
| 257 | Ga0209672_100976 | 3300025228 | Bacteria | 12672 |
| 258 | Ga0209672_101419 | 3300025228 | Bacteria | 8678 |
| 259 | Ga0209563_100127 | 3300025230 | Bacteria | 109913 |
| 260 | Ga0207427_100075 | 3300025231 | Bacteria | 150143 |
| 261 | Ga0207427_100192 | 3300025231 | Bacteria | 60054 |
| 262 | Ga0207427_100726 | 3300025231 | Bacteria | 15338 |
| 263 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 264 | Ga0209437_100233 | 3300025233 | Bacteria | 93858 |
| 265 | Ga0209437_100319 | 3300025233 | Bacteria | 63021 |
| 266 | Ga0209437_108345 | 3300025233 | Bacteria | 1659 |
| 267 | Ga0209258_100038 | 3300025242 | Bacteria | 398959 |
| 268 | Ga0209258_100047 | 3300025242 | Bacteria | 367869 |
| 269 | Ga0209258_100144 | 3300025242 | Bacteria | 163814 |
| 270 | Ga0209258_100198 | 3300025242 | Bacteria | 124013 |
| 271 | Ga0209646_1000635 | 3300025246 | Bacteria | 13285 |
| 272 | Ga0209026_1000037 | 3300025250 | Bacteria | 282562 |
| 273 | Ga0209026_1000122 | 3300025250 | Bacteria | 126140 |
| 274 | Ga0209026_1002009 | 3300025250 | Bacteria | 8082 |
| 275 | Ga0209026_1002233 | 3300025250 | Bacteria | 7453 |
| 276 | Ga0209026_1015125 | 3300025250 | Bacteria | 1272 |
| 277 | Ga0209677_101909 | 3300025253 | Bacteria | 8404 |
| 278 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 279 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 280 | Ga0209148_1000024 | 3300025254 | Bacteria | 669890 |
| 281 | Ga0209148_1000054 | 3300025254 | Bacteria | 367869 |
| 282 | Ga0209148_1000141 | 3300025254 | Bacteria | 163821 |
| 283 | Ga0209759_1001003 | 3300025256 | Bacteria | 19283 |
| 284 | Ga0209759_1016179 | 3300025256 | Bacteria | 1895 |
| 285 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 286 | Ga0209233_1000210 | 3300025261 | Bacteria | 112384 |
| 287 | Ga0209233_1000307 | 3300025261 | Bacteria | 57445 |
| 288 | Ga0209233_1007835 | 3300025261 | Bacteria | 3351 |
| 289 | Ga0209233_1018318 | 3300025261 | Bacteria | 1887 |
| 290 | Ga0209565_1004382 | 3300025263 | Bacteria | 4308 |
| 291 | Ga0209565_1005259 | 3300025263 | Bacteria | 3791 |
| 292 | Ga0209455_1000025 | 3300025272 | Bacteria | 670673 |
| 293 | Ga0209455_1000032 | 3300025272 | Bacteria | 514243 |
| 294 | Ga0209455_1000052 | 3300025272 | Bacteria | 367804 |
| 295 | Ga0209455_1000254 | 3300025272 | Bacteria | 62595 |
| 296 | Ga0209455_1000578 | 3300025272 | Bacteria | 23874 |
| 297 | Ga0209455_1001868 | 3300025272 | Bacteria | 8802 |
| 298 | Ga0209455_1005922 | 3300025272 | Bacteria | 3686 |
| 299 | Ga0209675_1021153 | 3300025291 | Bacteria | 1740 |
| 300 | Ga0209564_1000063 | 3300025295 | Bacteria | 318515 |
| 301 | Ga0209050_1000302 | 3300025298 | Bacteria | 103095 |
| 302 | Ga0209256_1000598 | 3300025299 | Bacteria | 50177 |
| 303 | Ga0209256_1008260 | 3300025299 | Bacteria | 4872 |
| 304 | Ga0207656_10019453 | 3300025321 | Bacteria | 2687 |
| 305 | Ga0207656_10093976 | 3300025321 | Bacteria | 1365 |
| 306 | Ga0207647_10001035 | 3300025904 | Bacteria | 21525 |
| 307 | Ga0207647_10009739 | 3300025904 | Bacteria | 6818 |
| 308 | Ga0207643_10215496 | 3300025908 | Bacteria | 1173 |
| 309 | Ga0207705_10000108 | 3300025909 | Bacteria | 93501 |
| 310 | Ga0207705_10000691 | 3300025909 | Bacteria | 27928 |
| 311 | Ga0207705_10000958 | 3300025909 | Bacteria | 23575 |
| 312 | Ga0207705_10028893 | 3300025909 | Bacteria | 3952 |
| 313 | Ga0207705_10075706 | 3300025909 | Bacteria | 2445 |
| 314 | Ga0207705_10110815 | 3300025909 | Bacteria | 2028 |
| 315 | Ga0207705_10501371 | 3300025909 | Bacteria | 943 |
| 316 | Ga0207654_10062351 | 3300025911 | Bacteria | 2184 |
| 317 | Ga0207654_10379453 | 3300025911 | Bacteria | 979 |
| 318 | Ga0207707_10000038 | 3300025912 | Bacteria | 143359 |
| 319 | Ga0207707_10000083 | 3300025912 | Bacteria | 95462 |
| 320 | Ga0207707_10000093 | 3300025912 | Bacteria | 89975 |
| 321 | Ga0207707_10000152 | 3300025912 | Bacteria | 72592 |
| 322 | Ga0207707_10000364 | 3300025912 | Bacteria | 47458 |
| 323 | Ga0207707_10000570 | 3300025912 | Bacteria | 37419 |
| 324 | Ga0207707_10000623 | 3300025912 | Bacteria | 35185 |
| 325 | Ga0207707_10000756 | 3300025912 | Bacteria | 31825 |
| 326 | Ga0207707_10036159 | 3300025912 | Bacteria | 4318 |
| 327 | Ga0207707_10047503 | 3300025912 | Bacteria | 3738 |
| 328 | Ga0207707_10089124 | 3300025912 | Bacteria | 2696 |
| 329 | Ga0207707_10455620 | 3300025912 | Bacteria | 1094 |
| 330 | Ga0207707_10758871 | 3300025912 | Bacteria | 811 |
| 331 | Ga0207695_10002920 | 3300025913 | Bacteria | 24713 |
| 332 | Ga0207695_10004333 | 3300025913 | Bacteria | 19435 |
| 333 | Ga0207695_10004847 | 3300025913 | Bacteria | 18157 |
| 334 | Ga0207695_10012886 | 3300025913 | Bacteria | 10009 |
| 335 | Ga0207695_10019482 | 3300025913 | Bacteria | 7814 |
| 336 | Ga0207695_10022277 | 3300025913 | Bacteria | 7200 |
| 337 | Ga0207695_10027439 | 3300025913 | Bacteria | 6341 |
| 338 | Ga0207695_10050732 | 3300025913 | Bacteria | 4362 |
| 339 | Ga0207695_10530770 | 3300025913 | Bacteria | 1058 |
| 340 | Ga0207671_10000329 | 3300025914 | Bacteria | 69610 |
| 341 | Ga0207671_10331663 | 3300025914 | Bacteria | 1205 |
| 342 | Ga0207660_10000103 | 3300025917 | Bacteria | 47336 |
| 343 | Ga0207660_10000305 | 3300025917 | Bacteria | 32274 |
| 344 | Ga0207660_10005291 | 3300025917 | Bacteria | 8397 |
| 345 | Ga0207660_10038317 | 3300025917 | Bacteria | 3345 |
| 346 | Ga0207660_10216966 | 3300025917 | Bacteria | 1500 |
| 347 | Ga0207660_10324419 | 3300025917 | Bacteria | 1230 |
| 348 | Ga0207657_10002228 | 3300025919 | Bacteria | 21024 |
| 349 | Ga0207657_10022253 | 3300025919 | Bacteria | 5940 |
| 350 | Ga0207657_10205299 | 3300025919 | Bacteria | 1583 |
| 351 | Ga0207657_10259894 | 3300025919 | Bacteria | 1382 |
| 352 | Ga0207657_10318583 | 3300025919 | Bacteria | 1230 |
| 353 | Ga0207649_10018692 | 3300025920 | Bacteria | 3947 |
| 354 | Ga0207652_10000038 | 3300025921 | Bacteria | 133467 |
| 355 | Ga0207652_10000129 | 3300025921 | Bacteria | 81999 |
| 356 | Ga0207652_10000257 | 3300025921 | Bacteria | 55336 |
| 357 | Ga0207652_10000910 | 3300025921 | Bacteria | 27923 |
| 358 | Ga0207652_10001066 | 3300025921 | Bacteria | 24860 |
| 359 | Ga0207652_10010611 | 3300025921 | Bacteria | 7416 |
| 360 | Ga0207694_10200223 | 3300025924 | Bacteria | 1624 |
| 361 | Ga0207650_10785564 | 3300025925 | Unclassified | 807 |
| 362 | Ga0207659_10206205 | 3300025926 | Bacteria | 1573 |
| 363 | Ga0207700_10024162 | 3300025928 | Bacteria | 4202 |
| 364 | Ga0207664_10031080 | 3300025929 | Bacteria | 4082 |
| 365 | Ga0207644_10000051 | 3300025931 | Bacteria | 93644 |
| 366 | Ga0207690_10000782 | 3300025932 | Bacteria | 20597 |
| 367 | Ga0207690_10176935 | 3300025932 | Bacteria | 1603 |
| 368 | Ga0207706_10068915 | 3300025933 | Bacteria | 3112 |
| 369 | Ga0207686_10198186 | 3300025934 | Unclassified | 1436 |
| 370 | Ga0207670_10288898 | 3300025936 | Bacteria | 1280 |
| 371 | Ga0207689_10143121 | 3300025942 | Bacteria | 1970 |
| 372 | Ga0207661_10004323 | 3300025944 | Bacteria | 9943 |
| 373 | Ga0207661_10023756 | 3300025944 | Bacteria | 4636 |
| 374 | Ga0207661_10491988 | 3300025944 | Bacteria | 1120 |
| 375 | Ga0207679_10036141 | 3300025945 | Bacteria | 3501 |
| 376 | Ga0207667_10003257 | 3300025949 | Bacteria | 20032 |
| 377 | Ga0207667_10003401 | 3300025949 | Bacteria | 19639 |
| 378 | Ga0207667_10008663 | 3300025949 | Bacteria | 12060 |
| 379 | Ga0207667_10014973 | 3300025949 | Bacteria | 8820 |
| 380 | Ga0207667_10087006 | 3300025949 | Bacteria | 3233 |
| 381 | Ga0207667_10102061 | 3300025949 | Bacteria | 2959 |
| 382 | Ga0207667_10286102 | 3300025949 | Bacteria | 1684 |
| 383 | Ga0207667_10551145 | 3300025949 | Bacteria | 1166 |
| 384 | Ga0207667_10580084 | 3300025949 | Bacteria | 1132 |
| 385 | Ga0207651_10526985 | 3300025960 | Bacteria | 1025 |
| 386 | Ga0207640_10011511 | 3300025981 | Bacteria | 5011 |
| 387 | Ga0207640_10030160 | 3300025981 | Bacteria | 3337 |
| 388 | Ga0207640_10039617 | 3300025981 | Bacteria | 2984 |
| 389 | Ga0207640_10688267 | 3300025981 | Bacteria | 875 |
| 390 | Ga0207658_10626975 | 3300025986 | Bacteria | 968 |
| 391 | Ga0207677_10416801 | 3300026023 | Bacteria | 1143 |
| 392 | Ga0207677_10734045 | 3300026023 | Bacteria | 879 |
| 393 | Ga0207639_10000833 | 3300026041 | Bacteria | 20934 |
| 394 | Ga0207639_10020629 | 3300026041 | Bacteria | 4719 |
| 395 | Ga0207639_10875481 | 3300026041 | Bacteria | 839 |
| 396 | Ga0207678_10001110 | 3300026067 | Bacteria | 24666 |
| 397 | Ga0207678_10001566 | 3300026067 | Bacteria | 21024 |
| 398 | Ga0207678_10002045 | 3300026067 | Bacteria | 18296 |
| 399 | Ga0207678_10003732 | 3300026067 | Bacteria | 13700 |
| 400 | Ga0207678_10129621 | 3300026067 | Bacteria | 2151 |
| 401 | Ga0207678_10242320 | 3300026067 | Bacteria | 1544 |
| 402 | Ga0207678_10623389 | 3300026067 | Bacteria | 946 |
| 403 | Ga0207702_10000321 | 3300026078 | Bacteria | 54950 |
| 404 | Ga0207702_10000719 | 3300026078 | Bacteria | 35517 |
| 405 | Ga0207702_10001824 | 3300026078 | Bacteria | 20968 |
| 406 | Ga0207702_10004954 | 3300026078 | Bacteria | 11696 |
| 407 | Ga0207702_10005157 | 3300026078 | Bacteria | 11494 |
| 408 | Ga0207702_10007550 | 3300026078 | Bacteria | 9270 |
| 409 | Ga0207674_10002170 | 3300026116 | Bacteria | 24823 |
| 410 | Ga0207674_10158725 | 3300026116 | Bacteria | 2216 |
| 411 | Ga0207674_10683614 | 3300026116 | Bacteria | 991 |
| 412 | Ga0207674_10722703 | 3300026116 | Bacteria | 961 |
| 413 | Ga0207675_100012631 | 3300026118 | Bacteria | 7891 |
| 414 | Ga0207675_100090127 | 3300026118 | Bacteria | 2883 |
| 415 | Ga0207698_10000707 | 3300026142 | Bacteria | 19332 |
| 416 | Ga0207698_10001030 | 3300026142 | Bacteria | 16218 |
| 417 | Ga0207698_10028714 | 3300026142 | Bacteria | 3971 |
| 418 | Ga0207428_10027363 | 3300027907 | Bacteria | 4748 |
| 419 | Ga0207428_10083036 | 3300027907 | Bacteria | 2499 |
| 420 | Ga0207428_10418728 | 3300027907 | Bacteria | 979 |
| 421 | Ga0265354_1000854 | 3300028016 | Bacteria | 4900 |
| 422 | Ga0265356_1000224 | 3300028017 | Bacteria | 10699 |
| 423 | Ga0265357_1001226 | 3300028023 | Bacteria | 1819 |
| 424 | Ga0268266_10072079 | 3300028379 | Bacteria | 2994 |
| 425 | Ga0268266_10230184 | 3300028379 | Unclassified | 1707 |
| 426 | Ga0268266_10265369 | 3300028379 | Bacteria | 1592 |
| 427 | Ga0268266_10566867 | 3300028379 | Bacteria | 1089 |
| 428 | Ga0265338_10163919 | 3300028800 | Unclassified | 1713 |
| 429 | Ga0265762_1028060 | 3300030760 | Bacteria | 1059 |
| 430 | Ga0265767_107275 | 3300030836 | Bacteria | 702 |
| 431 | Ga0265765_1001619 | 3300030879 | Bacteria | 2093 |
| 432 | Ga0265760_10000065 | 3300031090 | Bacteria | 28698 |
| 433 | Ga0265332_10010603 | 3300031238 | Bacteria | 4101 |
| 434 | Ga0265340_10011459 | 3300031247 | Bacteria | 4710 |
| 435 | Ga0265316_10089351 | 3300031344 | Bacteria | 2351 |
| 436 | Ga0307513_10040123 | 3300031456 | Bacteria | 5179 |
| 437 | Ga0307509_10000051 | 3300031507 | Bacteria | 165037 |
| 438 | Ga0307408_100000272 | 3300031548 | Bacteria | 51943 |
| 439 | Ga0307508_10247391 | 3300031616 | Unclassified | 1380 |
| 440 | Ga0307508_10343965 | 3300031616 | Unclassified | 1083 |
| 441 | Ga0307413_10106454 | 3300031824 | Bacteria | 1867 |
| 442 | Ga0307416_100593849 | 3300032002 | Bacteria | 1186 |
| 443 | Ga0373936_0022104 | 3300035113 | Unclassified | 2477 |
| 444 | Ga0373946_0091151 | 3300035171 | Unclassified | 1351 |
| 445 | Ga0373931_0221258 | 3300035691 | Bacteria | 1140 |
| 446 | Ga0373931_0632242 | 3300035691 | Bacteria | 702 |
| 447 | Ga0373927_0012577 | 3300035695 | Bacteria | 5633 |
| 448 | Ga0373937_0023954 | 3300036401 | Bacteria | 5503 |
| 449 | Ga0373925_0387398 | 3300037068 | Unclassified | 1139 |
| 450 | Ga0395899_0001216 | 3300037312 | Bacteria | 22577 |
| 451 | Ga0395899_0005509 | 3300037312 | Bacteria | 9806 |
| 452 | Ga0395899_0025605 | 3300037312 | Bacteria | 4452 |
| 453 | Ga0395899_0214774 | 3300037312 | Bacteria | 1335 |
| 454 | Ga0395900_0000039 | 3300037418 | Bacteria | 248722 |
| 455 | Ga0395900_0000092 | 3300037418 | Bacteria | 166966 |
| 456 | Ga0395900_0010266 | 3300037418 | Bacteria | 9577 |
| 457 | Ga0395900_0045052 | 3300037418 | Bacteria | 4543 |
| 458 | Ga0395900_0701582 | 3300037418 | Bacteria | 945 |
| 459 | Ga0395898_0000069 | 3300037466 | Bacteria | 254587 |
| 460 | Ga0395898_0002344 | 3300037466 | Bacteria | 22585 |
| 461 | Ga0395898_0055944 | 3300037466 | Bacteria | 3847 |
| 462 | Ga0395898_0324121 | 3300037466 | Bacteria | 1469 |
| 463 | Ga0395898_0488521 | 3300037466 | Bacteria | 1171 |
| 464 | Ga0395905_0004097 | 3300037471 | Bacteria | 15271 |
| 465 | Ga0395901_0062401 | 3300038443 | Bacteria | 3878 |
| 466 | Ga0436365_0079353 | 3300039437 | Bacteria | 1466 |
| 467 | Ga0439460_0144588 | 3300042461 | Bacteria | 790 |
| 468 | Ga0466969_0011485 | 3300044656 | Bacteria | 4689 |
| 469 | Ga0466965_0058370 | 3300044683 | Bacteria | 1924 |
| 470 | Ga0466966_0026372 | 3300044684 | Bacteria | 3794 |
| 471 | Ga0466966_0026801 | 3300044684 | Bacteria | 3761 |
| 472 | Ga0466966_0038348 | 3300044684 | Bacteria | 3088 |
| 473 | Ga0466966_0341596 | 3300044684 | Bacteria | 899 |
| 474 | Ga0466961_0000786 | 3300044693 | Bacteria | 19897 |
| 475 | Ga0453684_0001752 | 3300044712 | Bacteria | 58035 |
| 476 | Ga0466971_0076220 | 3300044719 | Bacteria | 1526 |
| 477 | Ga0466970_0189475 | 3300044765 | Bacteria | 1142 |
| 478 | Ga0466957_0004813 | 3300044842 | Bacteria | 7554 |
| 479 | Ga0466957_0011179 | 3300044842 | Bacteria | 5170 |
| 480 | Ga0466959_0028347 | 3300045049 | Bacteria | 4152 |
| 481 | Ga0466959_0049660 | 3300045049 | Bacteria | 3082 |
| 482 | Ga0495592_0120085 | 3300046454 | Bacteria | 1850 |
| 483 | Ga0495590_0000011 | 3300046457 | Bacteria | 307470 |
| 484 | Ga0495590_0001390 | 3300046457 | Bacteria | 10499 |
| 485 | Ga0495638_0000009 | 3300046460 | Bacteria | 525345 |
| 486 | Ga0495638_0000058 | 3300046460 | Bacteria | 192656 |
| 487 | Ga0495638_0002184 | 3300046460 | Bacteria | 16368 |
| 488 | Ga0495638_0114762 | 3300046460 | Bacteria | 1597 |
| 489 | Ga0495651_0000630 | 3300046462 | Bacteria | 27291 |
| 490 | Ga0495651_0004832 | 3300046462 | Bacteria | 10310 |
| 491 | Ga0495653_0140862 | 3300046463 | Bacteria | 1696 |
| 492 | Ga0495653_0421611 | 3300046463 | Bacteria | 844 |
| 493 | Ga0495650_0006156 | 3300046471 | Bacteria | 7548 |
| 494 | Ga0495650_0007960 | 3300046471 | Bacteria | 6276 |
| 495 | Ga0495580_0001881 | 3300046472 | Bacteria | 18480 |
| 496 | Ga0495639_0021950 | 3300046475 | Bacteria | 2797 |
| 497 | Ga0495664_0165245 | 3300046477 | Unclassified | 1343 |
| 498 | Ga0495607_0008251 | 3300046501 | Bacteria | 7125 |
| 499 | Ga0495583_0000751 | 3300046506 | Bacteria | 41181 |
| 500 | Ga0495606_0000159 | 3300046507 | Bacteria | 118613 |
| 501 | Ga0495606_0001241 | 3300046507 | Bacteria | 35622 |
| 502 | Ga0495608_0005627 | 3300046511 | Bacteria | 8950 |
| 503 | Ga0495608_0326274 | 3300046511 | Bacteria | 948 |
| 504 | Ga0495628_0202208 | 3300046516 | Unclassified | 1496 |
| 505 | Ga0495643_0000230 | 3300046522 | Bacteria | 84299 |
| 506 | Ga0495648_0000082 | 3300046524 | Bacteria | 123682 |
| 507 | Ga0495642_0052796 | 3300046528 | Bacteria | 1674 |
| 508 | Ga0495652_0006771 | 3300046529 | Bacteria | 10626 |
| 509 | Ga0495665_0000070 | 3300046531 | Bacteria | 43160 |
| 510 | Ga0495586_0000987 | 3300046535 | Bacteria | 16100 |
| 511 | Ga0495609_0256418 | 3300046538 | Bacteria | 719 |
| 512 | Ga0495597_0000341 | 3300046542 | Bacteria | 41785 |
| 513 | Ga0495597_0000445 | 3300046542 | Bacteria | 35362 |
| 514 | Ga0495645_0129100 | 3300046543 | Bacteria | 1773 |
| 515 | Ga0495633_0000459 | 3300046558 | Bacteria | 41806 |
| 516 | Ga0495667_0005391 | 3300046559 | Bacteria | 8649 |
| 517 | Ga0495667_0079486 | 3300046559 | Unclassified | 2132 |
| 518 | Ga0495668_0000266 | 3300046616 | Bacteria | 73736 |
| 519 | Ga0495625_0000843 | 3300046660 | Bacteria | 41880 |
| 520 | Ga0495625_0007337 | 3300046660 | Bacteria | 9626 |
| 521 | Ga0495625_0017403 | 3300046660 | Bacteria | 5628 |
| 522 | Ga0495625_0086651 | 3300046660 | Bacteria | 2172 |
| 523 | Ga0495588_0135606 | 3300046674 | Bacteria | 1299 |
| 524 | Ga0495623_0050103 | 3300046679 | Bacteria | 2645 |
| 525 | Ga0495613_0043925 | 3300046689 | Bacteria | 3307 |
| 526 | Ga0495624_0007031 | 3300046690 | Bacteria | 7933 |
| 527 | Ga0495649_0011222 | 3300046694 | Bacteria | 5265 |
| 528 | Ga0495649_0070388 | 3300046694 | Bacteria | 1876 |
| 529 | Ga0495600_0028367 | 3300046809 | Bacteria | 3621 |
| 530 | Ga0495600_0164409 | 3300046809 | Unclassified | 1434 |
| 531 | Ga0495660_0004534 | 3300046810 | Bacteria | 8396 |
| 532 | Ga0495660_0029168 | 3300046810 | Bacteria | 3115 |
| 533 | Ga0495604_0015192 | 3300047317 | Bacteria | 6146 |
| 534 | Ga0495680_0000614 | 3300047322 | Bacteria | 40108 |
| 535 | Ga0495687_000317 | 3300047443 | Bacteria | 62824 |
| 536 | Ga0495675_0035586 | 3300047444 | Bacteria | 3179 |
| 537 | Ga0495675_0168397 | 3300047444 | Unclassified | 1346 |
| 538 | Ga0495684_0030781 | 3300047471 | Bacteria | 4120 |
| 539 | Ga0495686_0083076 | 3300047472 | Bacteria | 1954 |
| 540 | Ga0495686_0237302 | 3300047472 | Bacteria | 1030 |
| 541 | Ga0495686_0573887 | 3300047472 | Bacteria | 587 |
| 542 | Ga0495593_0120460 | 3300047673 | Bacteria | 1335 |
| 543 | Ga0495602_0042012 | 3300048088 | Bacteria | 4168 |
| 544 | Ga0495614_0001946 | 3300048089 | Bacteria | 9067 |
| 545 | Ga0496110_0390773 | 3300048913 | Bacteria | 1268 |
| 546 | Ga0496114_0785062 | 3300048917 | Bacteria | 831 |
| 547 | Ga0496115_0000013 | 3300048918 | Bacteria | 213060 |
| 548 | Ga0496115_0002192 | 3300048918 | Bacteria | 13995 |
| 549 | Ga0496118_0289434 | 3300048921 | Unclassified | 906 |
| 550 | Ga0496121_0047112 | 3300048924 | Bacteria | 3681 |
| 551 | Ga0496126_0046377 | 3300048929 | Bacteria | 3986 |
| 552 | Ga0496126_0060909 | 3300048929 | Bacteria | 3392 |
| 553 | Ga0495678_010348 | 3300049459 | Bacteria | 4540 |
| 554 | Ga0501032_0052169 | 3300049569 | Bacteria | 2756 |
| 555 | Ga0501032_0208339 | 3300049569 | Bacteria | 1275 |
| 556 | Ga0501033_0027183 | 3300049570 | Bacteria | 4303 |
| 557 | Ga0501033_0035819 | 3300049570 | Bacteria | 3720 |
| 558 | Ga0501034_0019448 | 3300049571 | Bacteria | 6947 |
| 559 | Ga0501036_0084344 | 3300049572 | Bacteria | 2686 |
| 560 | Ga0501036_0613073 | 3300049572 | Bacteria | 902 |
| 561 | Ga0501037_0028898 | 3300049573 | Bacteria | 4096 |
| 562 | Ga0501037_0617295 | 3300049573 | Bacteria | 727 |
| 563 | Ga0501039_0027391 | 3300049575 | Bacteria | 4382 |
| 564 | Ga0501043_0493962 | 3300049579 | Bacteria | 915 |
| 565 | Ga0501046_0913831 | 3300049580 | Bacteria | 612 |
| 566 | Ga0501047_0005476 | 3300049581 | Bacteria | 11948 |
| 567 | Ga0501047_0055919 | 3300049581 | Bacteria | 3815 |
| 568 | Ga0501048_0082907 | 3300049582 | Bacteria | 2261 |
| 569 | Ga0501069_0001687 | 3300049585 | Bacteria | 10984 |
| 570 | Ga0501069_0004932 | 3300049585 | Bacteria | 6922 |
| 571 | Ga0501069_0077447 | 3300049585 | Bacteria | 1870 |
| 572 | Ga0501070_0029677 | 3300049586 | Bacteria | 4583 |
| 573 | Ga0501070_0059254 | 3300049586 | Bacteria | 3174 |
| 574 | Ga0501070_0061962 | 3300049586 | Bacteria | 3098 |
| 575 | Ga0501070_0116223 | 3300049586 | Bacteria | 2209 |
| 576 | Ga0501070_0204292 | 3300049586 | Bacteria | 1622 |
| 577 | Ga0501070_0329838 | 3300049586 | Bacteria | 1240 |
| 578 | Ga0501070_0663122 | 3300049586 | Bacteria | 827 |
| 579 | Ga0501071_0042894 | 3300049587 | Bacteria | 3242 |
| 580 | Ga0501073_0014628 | 3300049589 | Bacteria | 5701 |
| 581 | Ga0501073_0048509 | 3300049589 | Bacteria | 2980 |
| 582 | Ga0501074_0004621 | 3300049590 | Bacteria | 9855 |
| 583 | Ga0501074_0047977 | 3300049590 | Bacteria | 3085 |
| 584 | Ga0501074_0105274 | 3300049590 | Bacteria | 2019 |
| 585 | Ga0501074_0220560 | 3300049590 | Bacteria | 1350 |
| 586 | Ga0501075_0255333 | 3300049591 | Bacteria | 1336 |
| 587 | Ga0501077_0027216 | 3300049593 | Bacteria | 3631 |
| 588 | Ga0501079_0227269 | 3300049741 | Bacteria | 1458 |
| 589 | Ga0501080_0005199 | 3300049742 | Bacteria | 11599 |
| 590 | Ga0501080_0014472 | 3300049742 | Bacteria | 7266 |
| 591 | Ga0501080_0031960 | 3300049742 | Bacteria | 4906 |
| 592 | Ga0501080_0511586 | 3300049742 | Bacteria | 1072 |
| 593 | Ga0501035_0001381 | 3300049822 | Bacteria | 24962 |
| 594 | Ga0501035_0016328 | 3300049822 | Bacteria | 6849 |
| 595 | Ga0501035_0054175 | 3300049822 | Bacteria | 3584 |
| 596 | Ga0501035_0086364 | 3300049822 | Bacteria | 2764 |
| 597 | Ga0501035_0136804 | 3300049822 | Bacteria | 2132 |
| 598 | Ga0501035_0272483 | 3300049822 | Bacteria | 1432 |
| 599 | Ga0501044_0006414 | 3300049823 | Bacteria | 12999 |
| 600 | Ga0501044_0022620 | 3300049823 | Bacteria | 6697 |
| 601 | Ga0501044_0050896 | 3300049823 | Bacteria | 4273 |
| 602 | Ga0501044_0112192 | 3300049823 | Bacteria | 2734 |
| 603 | Ga0501044_0161093 | 3300049823 | Bacteria | 2220 |
| 604 | Ga0501044_0167515 | 3300049823 | Bacteria | 2170 |
| 605 | Ga0501044_0378156 | 3300049823 | Bacteria | 1331 |
| 606 | Ga0501045_0043345 | 3300049824 | Bacteria | 3277 |
| 607 | nmdc:mga09592_715021_c1 | 3300050508 | Bacteria | 852 |
| 608 | nmdc:mga06r32_12382_c1 | 3300050510 | Bacteria | 7695 |
| 609 | nmdc:mga08y16_117867_c1 | 3300050511 | Unclassified | 2763 |
| 610 | nmdc:mga08y16_289551_c1 | 3300050511 | Bacteria | 1689 |
| 611 | nmdc:mga08y16_79828_c1 | 3300050511 | Bacteria | 3410 |
| 612 | nmdc:mga08y16_81161_c1 | 3300050511 | Bacteria | 3381 |
| 613 | nmdc:mga08y16_90144_c1 | 3300050511 | Bacteria | 3196 |
| 614 | nmdc:mga0rr50_266745_c1 | 3300050513 | Bacteria | 1426 |
| 615 | nmdc:mga0rr50_6155_c1 | 3300050513 | Bacteria | 7265 |
| 616 | nmdc:mga0a205_2164_c1 | 3300050515 | Bacteria | 17268 |
| 617 | nmdc:mga0a205_679366_c1 | 3300050515 | Bacteria | 880 |
| 618 | Ga0500643_012224 | 3300053087 | Unclassified | 3083 |
| 619 | Ga0500646_0173811 | 3300053090 | Unclassified | 726 |
| 620 | Ga0500646_0217295 | 3300053090 | Unclassified | 662 |
| 621 | Ga0500583_0163939 | 3300053092 | Bacteria | 1107 |
| 622 | Ga0500641_0010704 | 3300053096 | Bacteria | 3321 |
| 623 | Ga0500650_0000007 | 3300053098 | Bacteria | 108097 |
| 624 | Ga0500658_0051325 | 3300053134 | Unclassified | 1686 |
| 625 | Ga0500568_0023622 | 3300053139 | Bacteria | 2614 |
| 626 | Ga0500616_0000092 | 3300053153 | Bacteria | 183860 |
| 627 | Ga0500616_0022511 | 3300053153 | Bacteria | 3517 |
| 628 | Ga0500619_000649 | 3300053154 | Bacteria | 5921 |
| 629 | Ga0500622_0001852 | 3300053156 | Bacteria | 15996 |
| 630 | Ga0500622_0006698 | 3300053156 | Bacteria | 6639 |
| 631 | Ga0500622_0064517 | 3300053156 | Bacteria | 1862 |
| 632 | Ga0500637_0000512 | 3300053178 | Bacteria | 15102 |
| 633 | Ga0501084_0056468 | 3300054114 | Bacteria | 3285 |
| 634 | Ga0501082_0001120 | 3300060353 | Bacteria | 23668 |
| 635 | Ga0466962_0186651 | 3300061719 | Bacteria | 1011 |
| 636 | Ga0466962_0201251 | 3300061719 | Bacteria | 973 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0001216 | Ga0395899_0001216_21142_21828 | 175 |
| 2 | 3300037418 | Ga0395900_0000039 | Ga0395900_0000039_63588_64274 | 175 |
| 3 | 3300037466 | Ga0395898_0002344 | Ga0395898_0002344_750_1436 | 175 |
| 4 | 3300025934 | Ga0207686_10198186 | Ga0207686_101981862 | 177 |
| 5 | 3300049571 | Ga0501034_0019448 | Ga0501034_0019448_2302_2889 | 177 |
| 6 | 3300049823 | Ga0501044_0050896 | Ga0501044_0050896_623_1210 | 177 |
| 7 | 3300044684 | Ga0466966_0026801 | Ga0466966_0026801_1111_1815 | 178 |
| 8 | 3300044684 | Ga0466966_0341596 | Ga0466966_0341596_38_724 | 178 |
| 9 | 3300044719 | Ga0466971_0076220 | Ga0466971_0076220_47_733 | 178 |
| 10 | 3300044765 | Ga0466970_0189475 | Ga0466970_0189475_361_1047 | 178 |
| 11 | 3300009094 | Ga0111539_10050746 | Ga0111539_100507463 | 179 |
| 12 | 3300049572 | Ga0501036_0084344 | Ga0501036_0084344_1453_2064 | 179 |
| 13 | 3300049586 | Ga0501070_0029677 | Ga0501070_0029677_2006_2617 | 179 |
| 14 | 3300044683 | Ga0466965_0058370 | Ga0466965_0058370_272_865 | 180 |
| 15 | 3300046538 | Ga0495609_0256418 | Ga0495609_0256418_62_604 | 180 |
| 16 | 3300035691 | Ga0373931_0632242 | Ga0373931_0632242_76_621 | 181 |
| 17 | 3300047472 | Ga0495686_0573887 | Ga0495686_0573887_17_571 | 182 |
| 18 | 3300049580 | Ga0501046_0913831 | Ga0501046_0913831_12_560 | 182 |
| 19 | 3300009094 | Ga0111539_10089205 | Ga0111539_100892052 | 183 |
| 20 | 3300050511 | nmdc:mga08y16_81161_c1 | nmdc:mga08y16_81161_c1_2552_3115 | 183 |
| 21 | 3300053090 | Ga0500646_0173811 | Ga0500646_0173811_27_581 | 184 |
| 22 | 3300049573 | Ga0501037_0617295 | Ga0501037_0617295_18_578 | 185 |
| 23 | 3300049824 | Ga0501045_0043345 | Ga0501045_0043345_2701_3261 | 185 |
| 24 | 3300009553 | Ga0105249_10292920 | Ga0105249_102929202 | 186 |
| 25 | 3300027907 | Ga0207428_10083036 | Ga0207428_100830362 | 186 |
| 26 | 3300050511 | nmdc:mga08y16_90144_c1 | nmdc:mga08y16_90144_c1_268_882 | 186 |
| 27 | iso_pu_bacteria | 639633007 | 639787498 | 186 |
| 28 | 3300003752 | Ga0055539_1006297 | Ga0055539_10062971 | 188 |
| 29 | 3300003756 | Ga0055533_1004470 | Ga0055533_10044701 | 188 |
| 30 | 3300005614 | Ga0068856_100140570 | Ga0068856_1001405702 | 188 |
| 31 | 3300025226 | Ga0209674_100026 | Ga0209674_100026187 | 188 |
| 32 | 3300025226 | Ga0209674_100416 | Ga0209674_10041615 | 188 |
| 33 | 3300025253 | Ga0209677_101909 | Ga0209677_1019091 | 188 |
| 34 | 3300026078 | Ga0207702_10007550 | Ga0207702_100075508 | 188 |
| 35 | 3300044684 | Ga0466966_0038348 | Ga0466966_0038348_2132_2698 | 188 |
| 36 | 3300003316 | rootH1_10164261 | rootH1_101642612 | 189 |
| 37 | 3300003760 | Ga0055527_1000128 | Ga0055527_100012847 | 189 |
| 38 | 3300003761 | Ga0055535_1000287 | Ga0055535_10002871 | 189 |
| 39 | 3300003762 | Ga0055542_1000311 | Ga0055542_10003111 | 189 |
| 40 | 3300003763 | Ga0055529_1000329 | Ga0055529_100032947 | 189 |
| 41 | 3300003771 | Ga0055526_1002471 | Ga0055526_10024713 | 189 |
| 42 | 3300003773 | Ga0055537_1003943 | Ga0055537_10039434 | 189 |
| 43 | 3300003775 | Ga0055524_1002272 | Ga0055524_10022726 | 189 |
| 44 | 3300003791 | Ga0055530_10000186 | Ga0055530_1000018632 | 189 |
| 45 | 3300005262 | Ga0065165_1072998 | Ga0065165_10729982 | 189 |
| 46 | 3300025228 | Ga0209672_100017 | Ga0209672_100017266 | 189 |
| 47 | 3300025242 | Ga0209258_100038 | Ga0209258_10003846 | 189 |
| 48 | 3300025254 | Ga0209148_1000009 | Ga0209148_1000009946 | 189 |
| 49 | 3300025263 | Ga0209565_1004382 | Ga0209565_10043824 | 189 |
| 50 | 3300025263 | Ga0209565_1005259 | Ga0209565_10052592 | 189 |
| 51 | 3300025272 | Ga0209455_1000032 | Ga0209455_1000032266 | 189 |
| 52 | 3300025291 | Ga0209675_1021153 | Ga0209675_10211532 | 189 |
| 53 | 3300025295 | Ga0209564_1000063 | Ga0209564_1000063209 | 189 |
| 54 | 3300025298 | Ga0209050_1000302 | Ga0209050_100030227 | 189 |
| 55 | 3300025299 | Ga0209256_1000598 | Ga0209256_100059823 | 189 |
| 56 | 3300025299 | Ga0209256_1008260 | Ga0209256_10082602 | 189 |
| 57 | 3300031548 | Ga0307408_100000272 | Ga0307408_10000027231 | 189 |
| 58 | iso_pu_bacteria | 2842711865 | 2842715118 | 189 |
| 59 | 3300007076 | Ga0075435_100289600 | Ga0075435_1002896003 | 190 |
| 60 | 3300028379 | Ga0268266_10230184 | Ga0268266_102301843 | 190 |
| 61 | 3300031824 | Ga0307413_10106454 | Ga0307413_101064542 | 190 |
| 62 | 3300032002 | Ga0307416_100593849 | Ga0307416_1005938492 | 190 |
| 63 | 3300050513 | nmdc:mga0rr50_266745_c1 | nmdc:mga0rr50_266745_c1_774_1355 | 190 |
| 64 | 3300003320 | rootH2_10161275 | rootH2_101612755 | 191 |
| 65 | 3300003323 | rootH1_10003926 | rootH1_1000392634 | 191 |
| 66 | 3300005334 | Ga0068869_100281763 | Ga0068869_1002817632 | 191 |
| 67 | 3300005338 | Ga0068868_100235765 | Ga0068868_1002357652 | 191 |
| 68 | 3300005355 | Ga0070671_100000028 | Ga0070671_10000002877 | 191 |
| 69 | 3300005458 | Ga0070681_10144414 | Ga0070681_101444143 | 191 |
| 70 | 3300005548 | Ga0070665_100023152 | Ga0070665_1000231525 | 191 |
| 71 | 3300005577 | Ga0068857_100910235 | Ga0068857_1009102352 | 191 |
| 72 | 3300005841 | Ga0068863_100658668 | Ga0068863_1006586682 | 191 |
| 73 | 3300005843 | Ga0068860_101133017 | Ga0068860_1011330172 | 191 |
| 74 | 3300011119 | Ga0105246_10013007 | Ga0105246_100130073 | 191 |
| 75 | 3300013308 | Ga0157375_10702884 | Ga0157375_107028841 | 191 |
| 76 | 3300017792 | Ga0163161_10343346 | Ga0163161_103433461 | 191 |
| 77 | 3300025912 | Ga0207707_10758871 | Ga0207707_107588711 | 191 |
| 78 | 3300025931 | Ga0207644_10000051 | Ga0207644_1000005121 | 191 |
| 79 | 3300025986 | Ga0207658_10626975 | Ga0207658_106269752 | 191 |
| 80 | 3300026023 | Ga0207677_10416801 | Ga0207677_104168012 | 191 |
| 81 | 3300026023 | Ga0207677_10734045 | Ga0207677_107340451 | 191 |
| 82 | 3300028379 | Ga0268266_10072079 | Ga0268266_100720793 | 191 |
| 83 | 3300028379 | Ga0268266_10566867 | Ga0268266_105668672 | 191 |
| 84 | 3300044712 | Ga0453684_0001752 | Ga0453684_0001752_28949_29536 | 191 |
| 85 | 3300047472 | Ga0495686_0237302 | Ga0495686_0237302_375_956 | 191 |
| 86 | 3300048913 | Ga0496110_0390773 | Ga0496110_0390773_564_1139 | 191 |
| 87 | 3300048917 | Ga0496114_0785062 | Ga0496114_0785062_16_591 | 191 |
| 88 | 3300053092 | Ga0500583_0163939 | Ga0500583_0163939_254_829 | 191 |
| 89 | 3300053096 | Ga0500641_0010704 | Ga0500641_0010704_1185_1841 | 191 |
| 90 | 3300053139 | Ga0500568_0023622 | Ga0500568_0023622_1362_1985 | 191 |
| 91 | 3300053153 | Ga0500616_0022511 | Ga0500616_0022511_558_1220 | 191 |
| 92 | 3300053156 | Ga0500622_0001852 | Ga0500622_0001852_14728_15315 | 191 |
| 93 | 3300053156 | Ga0500622_0006698 | Ga0500622_0006698_5972_6595 | 191 |
| 94 | 3300004803 | Ga0058862_12867910 | Ga0058862_128679102 | 192 |
| 95 | 3300005327 | Ga0070658_11049881 | Ga0070658_110498811 | 192 |
| 96 | 3300005329 | Ga0070683_100207281 | Ga0070683_1002072813 | 192 |
| 97 | 3300005336 | Ga0070680_100050413 | Ga0070680_1000504134 | 192 |
| 98 | 3300005336 | Ga0070680_100553016 | Ga0070680_1005530161 | 192 |
| 99 | 3300005337 | Ga0070682_100330824 | Ga0070682_1003308242 | 192 |
| 100 | 3300005344 | Ga0070661_100233898 | Ga0070661_1002338982 | 192 |
| 101 | 3300005458 | Ga0070681_10017005 | Ga0070681_100170056 | 192 |
| 102 | 3300005458 | Ga0070681_10051051 | Ga0070681_100510514 | 192 |
| 103 | 3300005530 | Ga0070679_100008496 | Ga0070679_1000084966 | 192 |
| 104 | 3300005539 | Ga0068853_100446716 | Ga0068853_1004467161 | 192 |
| 105 | 3300005563 | Ga0068855_100000261 | Ga0068855_10000026110 | 192 |
| 106 | 3300005563 | Ga0068855_100099202 | Ga0068855_1000992024 | 192 |
| 107 | 3300005577 | Ga0068857_100880756 | Ga0068857_1008807561 | 192 |
| 108 | 3300009093 | Ga0105240_10003386 | Ga0105240_100033866 | 192 |
| 109 | 3300009093 | Ga0105240_10067254 | Ga0105240_100672545 | 192 |
| 110 | 3300009093 | Ga0105240_10240929 | Ga0105240_102409293 | 192 |
| 111 | 3300009093 | Ga0105240_11073758 | Ga0105240_110737581 | 192 |
| 112 | 3300009545 | Ga0105237_10095262 | Ga0105237_100952624 | 192 |
| 113 | 3300009551 | Ga0105238_10004866 | Ga0105238_100048666 | 192 |
| 114 | 3300013104 | Ga0157370_10002285 | Ga0157370_1000228515 | 192 |
| 115 | 3300013105 | Ga0157369_10017028 | Ga0157369_100170285 | 192 |
| 116 | 3300013105 | Ga0157369_10532822 | Ga0157369_105328222 | 192 |
| 117 | 3300013307 | Ga0157372_10274693 | Ga0157372_102746933 | 192 |
| 118 | 3300020069 | Ga0197907_11156994 | Ga0197907_111569942 | 192 |
| 119 | 3300020070 | Ga0206356_10573590 | Ga0206356_105735901 | 192 |
| 120 | 3300020070 | Ga0206356_11734160 | Ga0206356_117341602 | 192 |
| 121 | 3300020075 | Ga0206349_1969738 | Ga0206349_19697381 | 192 |
| 122 | 3300020078 | Ga0206352_10635024 | Ga0206352_106350241 | 192 |
| 123 | 3300020081 | Ga0206354_11327790 | Ga0206354_113277902 | 192 |
| 124 | 3300025912 | Ga0207707_10000038 | Ga0207707_10000038103 | 192 |
| 125 | 3300025912 | Ga0207707_10047503 | Ga0207707_100475033 | 192 |
| 126 | 3300025913 | Ga0207695_10019482 | Ga0207695_100194825 | 192 |
| 127 | 3300025913 | Ga0207695_10050732 | Ga0207695_100507322 | 192 |
| 128 | 3300025913 | Ga0207695_10530770 | Ga0207695_105307702 | 192 |
| 129 | 3300025917 | Ga0207660_10038317 | Ga0207660_100383173 | 192 |
| 130 | 3300025921 | Ga0207652_10001066 | Ga0207652_100010664 | 192 |
| 131 | 3300025949 | Ga0207667_10014973 | Ga0207667_100149738 | 192 |
| 132 | 3300025949 | Ga0207667_10286102 | Ga0207667_102861023 | 192 |
| 133 | 3300026041 | Ga0207639_10875481 | Ga0207639_108754812 | 192 |
| 134 | 3300026116 | Ga0207674_10722703 | Ga0207674_107227032 | 192 |
| 135 | 3300030836 | Ga0265767_107275 | Ga0265767_1072751 | 192 |
| 136 | 3300031456 | Ga0307513_10040123 | Ga0307513_100401233 | 192 |
| 137 | 3300035113 | Ga0373936_0022104 | Ga0373936_0022104_1450_2028 | 192 |
| 138 | 3300044842 | Ga0466957_0011179 | Ga0466957_0011179_2818_3435 | 192 |
| 139 | 3300045049 | Ga0466959_0049660 | Ga0466959_0049660_850_1467 | 192 |
| 140 | 3300046471 | Ga0495650_0007960 | Ga0495650_0007960_2053_2631 | 192 |
| 141 | 3300053087 | Ga0500643_012224 | Ga0500643_012224_288_866 | 192 |
| 142 | 3300053090 | Ga0500646_0217295 | Ga0500646_0217295_17_610 | 192 |
| 143 | 3300053098 | Ga0500650_0000007 | Ga0500650_0000007_45380_45958 | 192 |
| 144 | 3300053134 | Ga0500658_0051325 | Ga0500658_0051325_420_1013 | 192 |
| 145 | 3300053156 | Ga0500622_0064517 | Ga0500622_0064517_1174_1767 | 192 |
| 146 | 3300053178 | Ga0500637_0000512 | Ga0500637_0000512_9235_9813 | 192 |
| 147 | 3300061719 | Ga0466962_0201251 | Ga0466962_0201251_87_704 | 192 |
| 148 | 3300004800 | Ga0058861_12029677 | Ga0058861_120296772 | 193 |
| 149 | 3300004803 | Ga0058862_12525583 | Ga0058862_125255831 | 193 |
| 150 | 3300005327 | Ga0070658_10000153 | Ga0070658_100001534 | 193 |
| 151 | 3300005334 | Ga0068869_100157447 | Ga0068869_1001574472 | 193 |
| 152 | 3300005345 | Ga0070692_10150641 | Ga0070692_101506411 | 193 |
| 153 | 3300005367 | Ga0070667_100427369 | Ga0070667_1004273691 | 193 |
| 154 | 3300005438 | Ga0070701_10012388 | Ga0070701_100123884 | 193 |
| 155 | 3300005548 | Ga0070665_100413603 | Ga0070665_1004136032 | 193 |
| 156 | 3300005549 | Ga0070704_100046602 | Ga0070704_1000466023 | 193 |
| 157 | 3300005563 | Ga0068855_100017553 | Ga0068855_1000175532 | 193 |
| 158 | 3300005563 | Ga0068855_100025560 | Ga0068855_1000255602 | 193 |
| 159 | 3300005617 | Ga0068859_100231889 | Ga0068859_1002318892 | 193 |
| 160 | 3300006844 | Ga0075428_100011828 | Ga0075428_1000118282 | 193 |
| 161 | 3300006880 | Ga0075429_100149809 | Ga0075429_1001498092 | 193 |
| 162 | 3300006931 | Ga0097620_100231889 | Ga0097620_1002318892 | 193 |
| 163 | 3300009093 | Ga0105240_10001826 | Ga0105240_1000182611 | 193 |
| 164 | 3300009094 | Ga0111539_10029448 | Ga0111539_100294489 | 193 |
| 165 | 3300009094 | Ga0111539_10781657 | Ga0111539_107816571 | 193 |
| 166 | 3300009148 | Ga0105243_10045383 | Ga0105243_100453833 | 193 |
| 167 | 3300009174 | Ga0105241_10502716 | Ga0105241_105027161 | 193 |
| 168 | 3300009551 | Ga0105238_10354488 | Ga0105238_103544882 | 193 |
| 169 | 3300010375 | Ga0105239_10512584 | Ga0105239_105125841 | 193 |
| 170 | 3300014326 | Ga0157380_10066614 | Ga0157380_100666142 | 193 |
| 171 | 3300020070 | Ga0206356_11526086 | Ga0206356_115260862 | 193 |
| 172 | 3300025908 | Ga0207643_10215496 | Ga0207643_102154962 | 193 |
| 173 | 3300025909 | Ga0207705_10000108 | Ga0207705_10000108109 | 193 |
| 174 | 3300025913 | Ga0207695_10027439 | Ga0207695_100274392 | 193 |
| 175 | 3300025942 | Ga0207689_10143121 | Ga0207689_101431212 | 193 |
| 176 | 3300025949 | Ga0207667_10008663 | Ga0207667_100086639 | 193 |
| 177 | 3300025949 | Ga0207667_10580084 | Ga0207667_105800842 | 193 |
| 178 | 3300026116 | Ga0207674_10683614 | Ga0207674_106836142 | 193 |
| 179 | 3300026118 | Ga0207675_100012631 | Ga0207675_1000126314 | 193 |
| 180 | 3300027907 | Ga0207428_10027363 | Ga0207428_100273632 | 193 |
| 181 | 3300028016 | Ga0265354_1000854 | Ga0265354_10008544 | 193 |
| 182 | 3300028017 | Ga0265356_1000224 | Ga0265356_10002246 | 193 |
| 183 | 3300028023 | Ga0265357_1001226 | Ga0265357_10012263 | 193 |
| 184 | 3300028379 | Ga0268266_10265369 | Ga0268266_102653692 | 193 |
| 185 | 3300028800 | Ga0265338_10163919 | Ga0265338_101639192 | 193 |
| 186 | 3300030760 | Ga0265762_1028060 | Ga0265762_10280601 | 193 |
| 187 | 3300030879 | Ga0265765_1001619 | Ga0265765_10016192 | 193 |
| 188 | 3300031090 | Ga0265760_10000065 | Ga0265760_1000006513 | 193 |
| 189 | 3300031238 | Ga0265332_10010603 | Ga0265332_100106033 | 193 |
| 190 | 3300031247 | Ga0265340_10011459 | Ga0265340_100114593 | 193 |
| 191 | 3300031507 | Ga0307509_10000051 | Ga0307509_1000005150 | 193 |
| 192 | 3300031616 | Ga0307508_10247391 | Ga0307508_102473913 | 193 |
| 193 | 3300031616 | Ga0307508_10343965 | Ga0307508_103439651 | 193 |
| 194 | 3300035691 | Ga0373931_0221258 | Ga0373931_0221258_415_996 | 193 |
| 195 | 3300037471 | Ga0395905_0004097 | Ga0395905_0004097_2231_2830 | 193 |
| 196 | 3300039437 | Ga0436365_0079353 | Ga0436365_0079353_54_659 | 193 |
| 197 | 3300044656 | Ga0466969_0011485 | Ga0466969_0011485_3558_4157 | 193 |
| 198 | 3300044684 | Ga0466966_0026372 | Ga0466966_0026372_855_1454 | 193 |
| 199 | 3300046457 | Ga0495590_0001390 | Ga0495590_0001390_4245_4844 | 193 |
| 200 | 3300046460 | Ga0495638_0114762 | Ga0495638_0114762_850_1431 | 193 |
| 201 | 3300046542 | Ga0495597_0000445 | Ga0495597_0000445_29345_29926 | 193 |
| 202 | 3300046660 | Ga0495625_0007337 | Ga0495625_0007337_5003_5584 | 193 |
| 203 | 3300046810 | Ga0495660_0029168 | Ga0495660_0029168_480_1079 | 193 |
| 204 | 3300047472 | Ga0495686_0083076 | Ga0495686_0083076_120_722 | 193 |
| 205 | 3300049591 | Ga0501075_0255333 | Ga0501075_0255333_554_1138 | 193 |
| 206 | 3300050508 | nmdc:mga09592_715021_c1 | nmdc:mga09592_715021_c1_128_709 | 193 |
| 207 | 3300050511 | nmdc:mga08y16_117867_c1 | nmdc:mga08y16_117867_c1_1570_2154 | 193 |
| 208 | 3300050511 | nmdc:mga08y16_289551_c1 | nmdc:mga08y16_289551_c1_795_1376 | 193 |
| 209 | 3300050515 | nmdc:mga0a205_679366_c1 | nmdc:mga0a205_679366_c1_179_760 | 193 |
| 210 | 3300053153 | Ga0500616_0000092 | Ga0500616_0000092_165585_166172 | 193 |
| 211 | 3300061719 | Ga0466962_0186651 | Ga0466962_0186651_246_848 | 193 |
| 212 | 3300005295 | Ga0065707_10082740 | Ga0065707_1008274012 | 194 |
| 213 | 3300005719 | Ga0068861_100314740 | Ga0068861_1003147403 | 194 |
| 214 | 3300006195 | Ga0075366_10118877 | Ga0075366_101188773 | 194 |
| 215 | 3300013306 | Ga0163162_10804410 | Ga0163162_108044102 | 194 |
| 216 | 3300014326 | Ga0157380_10000816 | Ga0157380_100008167 | 194 |
| 217 | 3300025960 | Ga0207651_10526985 | Ga0207651_105269851 | 194 |
| 218 | 3300026118 | Ga0207675_100090127 | Ga0207675_1000901273 | 194 |
| 219 | 3300031344 | Ga0265316_10089351 | Ga0265316_100893512 | 194 |
| 220 | 3300046457 | Ga0495590_0000011 | Ga0495590_0000011_33164_33754 | 194 |
| 221 | 3300046460 | Ga0495638_0000058 | Ga0495638_0000058_159123_159713 | 194 |
| 222 | 3300046460 | Ga0495638_0002184 | Ga0495638_0002184_3190_3780 | 194 |
| 223 | 3300046471 | Ga0495650_0006156 | Ga0495650_0006156_2687_3277 | 194 |
| 224 | 3300046475 | Ga0495639_0021950 | Ga0495639_0021950_251_841 | 194 |
| 225 | 3300046501 | Ga0495607_0008251 | Ga0495607_0008251_2798_3388 | 194 |
| 226 | 3300046506 | Ga0495583_0000751 | Ga0495583_0000751_23411_24001 | 194 |
| 227 | 3300046507 | Ga0495606_0001241 | Ga0495606_0001241_6109_6699 | 194 |
| 228 | 3300046522 | Ga0495643_0000230 | Ga0495643_0000230_59082_59672 | 194 |
| 229 | 3300046524 | Ga0495648_0000082 | Ga0495648_0000082_90824_91414 | 194 |
| 230 | 3300046528 | Ga0495642_0052796 | Ga0495642_0052796_1000_1590 | 194 |
| 231 | 3300046542 | Ga0495597_0000341 | Ga0495597_0000341_17907_18497 | 194 |
| 232 | 3300046558 | Ga0495633_0000459 | Ga0495633_0000459_20633_21223 | 194 |
| 233 | 3300046616 | Ga0495668_0000266 | Ga0495668_0000266_40921_41511 | 194 |
| 234 | 3300046660 | Ga0495625_0000843 | Ga0495625_0000843_22825_23415 | 194 |
| 235 | 3300046660 | Ga0495625_0017403 | Ga0495625_0017403_4753_5343 | 194 |
| 236 | 3300046694 | Ga0495649_0070388 | Ga0495649_0070388_1031_1621 | 194 |
| 237 | 3300046810 | Ga0495660_0004534 | Ga0495660_0004534_3331_3921 | 194 |
| 238 | 3300047443 | Ga0495687_000317 | Ga0495687_000317_19251_19841 | 194 |
| 239 | 3300048921 | Ga0496118_0289434 | Ga0496118_0289434_38_628 | 194 |
| 240 | 3300048924 | Ga0496121_0047112 | Ga0496121_0047112_2434_3024 | 194 |
| 241 | 3300049459 | Ga0495678_010348 | Ga0495678_010348_222_812 | 194 |
| 242 | 3300053154 | Ga0500619_000649 | Ga0500619_000649_2712_3308 | 194 |
| 243 | 3300035171 | Ga0373946_0091151 | Ga0373946_0091151_368_1000 | 195 |
| 244 | 3300035695 | Ga0373927_0012577 | Ga0373927_0012577_4913_5545 | 195 |
| 245 | 3300036401 | Ga0373937_0023954 | Ga0373937_0023954_277_909 | 195 |
| 246 | 3300037068 | Ga0373925_0387398 | Ga0373925_0387398_379_1011 | 195 |
| 247 | 3300046454 | Ga0495592_0120085 | Ga0495592_0120085_593_1225 | 195 |
| 248 | 3300046462 | Ga0495651_0000630 | Ga0495651_0000630_7359_7967 | 195 |
| 249 | 3300046462 | Ga0495651_0004832 | Ga0495651_0004832_9399_10031 | 195 |
| 250 | 3300046463 | Ga0495653_0140862 | Ga0495653_0140862_709_1341 | 195 |
| 251 | 3300046463 | Ga0495653_0421611 | Ga0495653_0421611_88_696 | 195 |
| 252 | 3300046472 | Ga0495580_0001881 | Ga0495580_0001881_7476_8108 | 195 |
| 253 | 3300046477 | Ga0495664_0165245 | Ga0495664_0165245_277_909 | 195 |
| 254 | 3300046511 | Ga0495608_0005627 | Ga0495608_0005627_3068_3700 | 195 |
| 255 | 3300046511 | Ga0495608_0326274 | Ga0495608_0326274_46_654 | 195 |
| 256 | 3300046516 | Ga0495628_0202208 | Ga0495628_0202208_361_993 | 195 |
| 257 | 3300046529 | Ga0495652_0006771 | Ga0495652_0006771_9320_9952 | 195 |
| 258 | 3300046531 | Ga0495665_0000070 | Ga0495665_0000070_12299_12931 | 195 |
| 259 | 3300046535 | Ga0495586_0000987 | Ga0495586_0000987_15114_15746 | 195 |
| 260 | 3300046543 | Ga0495645_0129100 | Ga0495645_0129100_813_1421 | 195 |
| 261 | 3300046559 | Ga0495667_0005391 | Ga0495667_0005391_3644_4252 | 195 |
| 262 | 3300046559 | Ga0495667_0079486 | Ga0495667_0079486_215_847 | 195 |
| 263 | 3300046679 | Ga0495623_0050103 | Ga0495623_0050103_300_932 | 195 |
| 264 | 3300046689 | Ga0495613_0043925 | Ga0495613_0043925_1076_1708 | 195 |
| 265 | 3300046690 | Ga0495624_0007031 | Ga0495624_0007031_6465_7097 | 195 |
| 266 | 3300046809 | Ga0495600_0028367 | Ga0495600_0028367_2182_2790 | 195 |
| 267 | 3300046809 | Ga0495600_0164409 | Ga0495600_0164409_396_1028 | 195 |
| 268 | 3300047317 | Ga0495604_0015192 | Ga0495604_0015192_4678_5310 | 195 |
| 269 | 3300047322 | Ga0495680_0000614 | Ga0495680_0000614_19326_19934 | 195 |
| 270 | 3300047444 | Ga0495675_0035586 | Ga0495675_0035586_1970_2578 | 195 |
| 271 | 3300047444 | Ga0495675_0168397 | Ga0495675_0168397_397_1029 | 195 |
| 272 | 3300047471 | Ga0495684_0030781 | Ga0495684_0030781_362_994 | 195 |
| 273 | 3300047673 | Ga0495593_0120460 | Ga0495593_0120460_112_744 | 195 |
| 274 | 3300048088 | Ga0495602_0042012 | Ga0495602_0042012_2910_3542 | 195 |
| 275 | 3300048089 | Ga0495614_0001946 | Ga0495614_0001946_112_744 | 195 |
| 276 | 3300004799 | Ga0058863_11435829 | Ga0058863_114358291 | 196 |
| 277 | 3300006844 | Ga0075428_100139703 | Ga0075428_1001397033 | 196 |
| 278 | 3300025912 | Ga0207707_10089124 | Ga0207707_100891241 | 196 |
| 279 | 3300025921 | Ga0207652_10010611 | Ga0207652_100106115 | 196 |
| 280 | 3300005354 | Ga0070675_100327556 | Ga0070675_1003275562 | 197 |
| 281 | 3300006931 | Ga0097620_100731721 | Ga0097620_1007317211 | 197 |
| 282 | 3300009545 | Ga0105237_10000183 | Ga0105237_1000018371 | 197 |
| 283 | 3300013307 | Ga0157372_11108245 | Ga0157372_111082451 | 197 |
| 284 | 3300017792 | Ga0163161_10082665 | Ga0163161_100826653 | 197 |
| 285 | 3300025936 | Ga0207670_10288898 | Ga0207670_102888982 | 197 |
| 286 | 3300027907 | Ga0207428_10418728 | Ga0207428_104187281 | 197 |
| 287 | 3300050513 | nmdc:mga0rr50_6155_c1 | nmdc:mga0rr50_6155_c1_985_1599 | 197 |
| 288 | 3300050515 | nmdc:mga0a205_2164_c1 | nmdc:mga0a205_2164_c1_7109_7723 | 197 |
| 289 | 3300005354 | Ga0070675_100468002 | Ga0070675_1004680021 | 198 |
| 290 | 3300005546 | Ga0070696_100254122 | Ga0070696_1002541222 | 198 |
| 291 | 3300005563 | Ga0068855_100704758 | Ga0068855_1007047582 | 198 |
| 292 | 3300006847 | Ga0075431_100017829 | Ga0075431_1000178292 | 198 |
| 293 | 3300006852 | Ga0075433_10275185 | Ga0075433_102751853 | 198 |
| 294 | 3300009094 | Ga0111539_10129594 | Ga0111539_101295942 | 198 |
| 295 | 3300009147 | Ga0114129_10770809 | Ga0114129_107708092 | 198 |
| 296 | 3300009176 | Ga0105242_11673288 | Ga0105242_116732881 | 198 |
| 297 | 3300013296 | Ga0157374_10005513 | Ga0157374_100055136 | 198 |
| 298 | 3300013297 | Ga0157378_10227978 | Ga0157378_102279783 | 198 |
| 299 | 3300013297 | Ga0157378_10720815 | Ga0157378_107208151 | 198 |
| 300 | 3300025925 | Ga0207650_10785564 | Ga0207650_107855641 | 198 |
| 301 | 3300025926 | Ga0207659_10206205 | Ga0207659_102062052 | 198 |
| 302 | 3300042461 | Ga0439460_0144588 | Ga0439460_0144588_63_662 | 198 |
| 303 | 3300049741 | Ga0501079_0227269 | Ga0501079_0227269_418_1068 | 198 |
| 304 | 3300049742 | Ga0501080_0031960 | Ga0501080_0031960_1002_1652 | 198 |
| 305 | 3300050510 | nmdc:mga06r32_12382_c1 | nmdc:mga06r32_12382_c1_5107_5706 | 198 |
| 306 | 3300050511 | nmdc:mga08y16_79828_c1 | nmdc:mga08y16_79828_c1_546_1145 | 198 |
| 307 | 3300054114 | Ga0501084_0056468 | Ga0501084_0056468_757_1407 | 198 |
| 308 | 3300060353 | Ga0501082_0001120 | Ga0501082_0001120_19497_20147 | 198 |
| 309 | iso_pu_bacteria | 2884411467 | 2884413430 | 198 |
| 310 | 3300044842 | Ga0466957_0004813 | Ga0466957_0004813_6812_7414 | 199 |
| 311 | 3300045049 | Ga0466959_0028347 | Ga0466959_0028347_46_648 | 199 |
| 312 | 3300049822 | Ga0501035_0272483 | Ga0501035_0272483_557_1162 | 199 |
| 313 | 3300002772 | JGI25164J39214_1005867 | JGI25164J39214_10058672 | 200 |
| 314 | 3300003762 | Ga0055542_1000010 | Ga0055542_1000010103 | 200 |
| 315 | 3300005458 | Ga0070681_10000086 | Ga0070681_1000008616 | 200 |
| 316 | 3300005458 | Ga0070681_10294759 | Ga0070681_102947592 | 200 |
| 317 | 3300005530 | Ga0070679_100021147 | Ga0070679_1000211475 | 200 |
| 318 | 3300009551 | Ga0105238_10190079 | Ga0105238_101900792 | 200 |
| 319 | 3300013104 | Ga0157370_10029604 | Ga0157370_100296042 | 200 |
| 320 | 3300020078 | Ga0206352_10607276 | Ga0206352_106072761 | 200 |
| 321 | 3300025228 | Ga0209672_101419 | Ga0209672_1014194 | 200 |
| 322 | 3300025231 | Ga0207427_100726 | Ga0207427_1007265 | 200 |
| 323 | 3300025233 | Ga0209437_100233 | Ga0209437_10023325 | 200 |
| 324 | 3300025250 | Ga0209026_1002233 | Ga0209026_10022332 | 200 |
| 325 | 3300025254 | Ga0209148_1000005 | Ga0209148_1000005242 | 200 |
| 326 | 3300025261 | Ga0209233_1018318 | Ga0209233_10183182 | 200 |
| 327 | 3300025272 | Ga0209455_1000254 | Ga0209455_100025448 | 200 |
| 328 | 3300025272 | Ga0209455_1005922 | Ga0209455_10059223 | 200 |
| 329 | 3300025912 | Ga0207707_10000364 | Ga0207707_1000036433 | 200 |
| 330 | 3300025913 | Ga0207695_10004333 | Ga0207695_1000433311 | 200 |
| 331 | 3300025949 | Ga0207667_10087006 | Ga0207667_100870063 | 200 |
| 332 | 3300025981 | Ga0207640_10030160 | Ga0207640_100301603 | 200 |
| 333 | 3300026067 | Ga0207678_10003732 | Ga0207678_100037322 | 200 |
| 334 | 3300026067 | Ga0207678_10623389 | Ga0207678_106233892 | 200 |
| 335 | 3300046460 | Ga0495638_0000009 | Ga0495638_0000009_155043_155645 | 200 |
| 336 | 3300046507 | Ga0495606_0000159 | Ga0495606_0000159_28458_29060 | 200 |
| 337 | 3300046660 | Ga0495625_0086651 | Ga0495625_0086651_1499_2101 | 200 |
| 338 | 3300046694 | Ga0495649_0011222 | Ga0495649_0011222_2959_3561 | 200 |
| 339 | 3300048918 | Ga0496115_0000013 | Ga0496115_0000013_3899_4501 | 200 |
| 340 | 3300048918 | Ga0496115_0002192 | Ga0496115_0002192_10891_11493 | 200 |
| 341 | 3300048929 | Ga0496126_0046377 | Ga0496126_0046377_1518_2120 | 200 |
| 342 | 3300048929 | Ga0496126_0060909 | Ga0496126_0060909_1873_2475 | 200 |
| 343 | 3300005327 | Ga0070658_10285021 | Ga0070658_102850212 | 201 |
| 344 | 3300005336 | Ga0070680_100322897 | Ga0070680_1003228971 | 201 |
| 345 | 3300005458 | Ga0070681_10187187 | Ga0070681_101871872 | 201 |
| 346 | 3300005546 | Ga0070696_100063698 | Ga0070696_1000636982 | 201 |
| 347 | 3300013100 | Ga0157373_10034377 | Ga0157373_100343772 | 201 |
| 348 | 3300013104 | Ga0157370_10057856 | Ga0157370_100578563 | 201 |
| 349 | 3300013307 | Ga0157372_10074492 | Ga0157372_100744923 | 201 |
| 350 | 3300025909 | Ga0207705_10075706 | Ga0207705_100757062 | 201 |
| 351 | 3300025912 | Ga0207707_10455620 | Ga0207707_104556201 | 201 |
| 352 | 3300025917 | Ga0207660_10324419 | Ga0207660_103244191 | 201 |
| 353 | 3300025919 | Ga0207657_10259894 | Ga0207657_102598941 | 201 |
| 354 | 3300037418 | Ga0395900_0010266 | Ga0395900_0010266_7100_7705 | 201 |
| 355 | 3300049575 | Ga0501039_0027391 | Ga0501039_0027391_2802_3413 | 201 |
| 356 | 3300049579 | Ga0501043_0493962 | Ga0501043_0493962_245_859 | 201 |
| 357 | 3300049822 | Ga0501035_0016328 | Ga0501035_0016328_4748_5362 | 201 |
| 358 | 3300049823 | Ga0501044_0022620 | Ga0501044_0022620_4116_4730 | 201 |
| 359 | 3300001915 | JGI24741J21665_1000968 | JGI24741J21665_10009683 | 202 |
| 360 | 3300001915 | JGI24741J21665_1010185 | JGI24741J21665_10101853 | 202 |
| 361 | 3300001979 | JGI24740J21852_10000505 | JGI24740J21852_1000050514 | 202 |
| 362 | 3300001979 | JGI24740J21852_10000511 | JGI24740J21852_100005117 | 202 |
| 363 | 3300002737 | JGI25162J39368_1001409 | JGI25162J39368_100140910 | 202 |
| 364 | 3300002741 | JGI25157J39369_1000543 | JGI25157J39369_100054311 | 202 |
| 365 | 3300002772 | JGI25164J39214_1000163 | JGI25164J39214_100016335 | 202 |
| 366 | 3300002772 | JGI25164J39214_1000308 | JGI25164J39214_100030826 | 202 |
| 367 | 3300003214 | JGI25165J46597_1000326 | JGI25165J46597_100032634 | 202 |
| 368 | 3300003214 | JGI25165J46597_1002757 | JGI25165J46597_10027572 | 202 |
| 369 | 3300003759 | Ga0055525_1000360 | Ga0055525_100036024 | 202 |
| 370 | 3300003760 | Ga0055527_1000267 | Ga0055527_100026710 | 202 |
| 371 | 3300003760 | Ga0055527_1000960 | Ga0055527_10009604 | 202 |
| 372 | 3300003761 | Ga0055535_1000294 | Ga0055535_100029431 | 202 |
| 373 | 3300003761 | Ga0055535_1000614 | Ga0055535_100061410 | 202 |
| 374 | 3300003761 | Ga0055535_1000860 | Ga0055535_10008605 | 202 |
| 375 | 3300003762 | Ga0055542_1000057 | Ga0055542_100005791 | 202 |
| 376 | 3300003762 | Ga0055542_1000101 | Ga0055542_10001015 | 202 |
| 377 | 3300003762 | Ga0055542_1000518 | Ga0055542_100051823 | 202 |
| 378 | 3300003763 | Ga0055529_1000105 | Ga0055529_100010511 | 202 |
| 379 | 3300003763 | Ga0055529_1000755 | Ga0055529_100075521 | 202 |
| 380 | 3300004799 | Ga0058863_10059087 | Ga0058863_100590872 | 202 |
| 381 | 3300004800 | Ga0058861_10012108 | Ga0058861_100121081 | 202 |
| 382 | 3300004800 | Ga0058861_10037249 | Ga0058861_100372492 | 202 |
| 383 | 3300004800 | Ga0058861_11678086 | Ga0058861_116780861 | 202 |
| 384 | 3300004803 | Ga0058862_10060691 | Ga0058862_100606911 | 202 |
| 385 | 3300004803 | Ga0058862_12234460 | Ga0058862_122344601 | 202 |
| 386 | 3300004803 | Ga0058862_12545346 | Ga0058862_125453461 | 202 |
| 387 | 3300005329 | Ga0070683_100457150 | Ga0070683_1004571501 | 202 |
| 388 | 3300005329 | Ga0070683_100477369 | Ga0070683_1004773692 | 202 |
| 389 | 3300005336 | Ga0070680_100001865 | Ga0070680_1000018654 | 202 |
| 390 | 3300005336 | Ga0070680_100034311 | Ga0070680_1000343116 | 202 |
| 391 | 3300005336 | Ga0070680_100062792 | Ga0070680_1000627923 | 202 |
| 392 | 3300005337 | Ga0070682_100017773 | Ga0070682_1000177733 | 202 |
| 393 | 3300005337 | Ga0070682_100019204 | Ga0070682_1000192046 | 202 |
| 394 | 3300005339 | Ga0070660_100786687 | Ga0070660_1007866871 | 202 |
| 395 | 3300005341 | Ga0070691_10001099 | Ga0070691_1000109911 | 202 |
| 396 | 3300005341 | Ga0070691_10053974 | Ga0070691_100539742 | 202 |
| 397 | 3300005344 | Ga0070661_100003367 | Ga0070661_1000033673 | 202 |
| 398 | 3300005344 | Ga0070661_100409379 | Ga0070661_1004093792 | 202 |
| 399 | 3300005344 | Ga0070661_100593960 | Ga0070661_1005939602 | 202 |
| 400 | 3300005345 | Ga0070692_10001540 | Ga0070692_100015403 | 202 |
| 401 | 3300005345 | Ga0070692_10016588 | Ga0070692_100165885 | 202 |
| 402 | 3300005345 | Ga0070692_10094689 | Ga0070692_100946892 | 202 |
| 403 | 3300005366 | Ga0070659_100081620 | Ga0070659_1000816203 | 202 |
| 404 | 3300005435 | Ga0070714_100016246 | Ga0070714_1000162465 | 202 |
| 405 | 3300005436 | Ga0070713_100032124 | Ga0070713_1000321244 | 202 |
| 406 | 3300005455 | Ga0070663_100031066 | Ga0070663_1000310665 | 202 |
| 407 | 3300005455 | Ga0070663_100067718 | Ga0070663_1000677183 | 202 |
| 408 | 3300005455 | Ga0070663_100332150 | Ga0070663_1003321503 | 202 |
| 409 | 3300005458 | Ga0070681_10000230 | Ga0070681_1000023020 | 202 |
| 410 | 3300005458 | Ga0070681_10000536 | Ga0070681_1000053613 | 202 |
| 411 | 3300005458 | Ga0070681_10006881 | Ga0070681_1000688111 | 202 |
| 412 | 3300005530 | Ga0070679_100001047 | Ga0070679_10000104710 | 202 |
| 413 | 3300005530 | Ga0070679_100002395 | Ga0070679_1000023951 | 202 |
| 414 | 3300005530 | Ga0070679_100015994 | Ga0070679_1000159941 | 202 |
| 415 | 3300005535 | Ga0070684_100047927 | Ga0070684_1000479272 | 202 |
| 416 | 3300005539 | Ga0068853_100048960 | Ga0068853_1000489605 | 202 |
| 417 | 3300005539 | Ga0068853_100882543 | Ga0068853_1008825432 | 202 |
| 418 | 3300005546 | Ga0070696_100002360 | Ga0070696_1000023606 | 202 |
| 419 | 3300005546 | Ga0070696_100241196 | Ga0070696_1002411962 | 202 |
| 420 | 3300005546 | Ga0070696_100266232 | Ga0070696_1002662322 | 202 |
| 421 | 3300005547 | Ga0070693_100002470 | Ga0070693_1000024702 | 202 |
| 422 | 3300005563 | Ga0068855_100013395 | Ga0068855_1000133952 | 202 |
| 423 | 3300005563 | Ga0068855_100017551 | Ga0068855_1000175518 | 202 |
| 424 | 3300005563 | Ga0068855_100052298 | Ga0068855_1000522983 | 202 |
| 425 | 3300005564 | Ga0070664_100098768 | Ga0070664_1000987683 | 202 |
| 426 | 3300005577 | Ga0068857_100271887 | Ga0068857_1002718872 | 202 |
| 427 | 3300005578 | Ga0068854_100009840 | Ga0068854_1000098401 | 202 |
| 428 | 3300005578 | Ga0068854_100030052 | Ga0068854_1000300523 | 202 |
| 429 | 3300005578 | Ga0068854_100289417 | Ga0068854_1002894171 | 202 |
| 430 | 3300005614 | Ga0068856_100142659 | Ga0068856_1001426594 | 202 |
| 431 | 3300005616 | Ga0068852_100643263 | Ga0068852_1006432632 | 202 |
| 432 | 3300005616 | Ga0068852_100730678 | Ga0068852_1007306782 | 202 |
| 433 | 3300005834 | Ga0068851_10044717 | Ga0068851_100447174 | 202 |
| 434 | 3300005834 | Ga0068851_10248325 | Ga0068851_102483251 | 202 |
| 435 | 3300009093 | Ga0105240_10006479 | Ga0105240_1000647911 | 202 |
| 436 | 3300009093 | Ga0105240_10284162 | Ga0105240_102841623 | 202 |
| 437 | 3300009093 | Ga0105240_10298602 | Ga0105240_102986023 | 202 |
| 438 | 3300009174 | Ga0105241_10111543 | Ga0105241_101115434 | 202 |
| 439 | 3300009551 | Ga0105238_10007034 | Ga0105238_100070346 | 202 |
| 440 | 3300013100 | Ga0157373_10008206 | Ga0157373_100082064 | 202 |
| 441 | 3300013100 | Ga0157373_10021463 | Ga0157373_100214636 | 202 |
| 442 | 3300013102 | Ga0157371_10096189 | Ga0157371_100961893 | 202 |
| 443 | 3300013104 | Ga0157370_10007483 | Ga0157370_100074837 | 202 |
| 444 | 3300013104 | Ga0157370_10022245 | Ga0157370_100222454 | 202 |
| 445 | 3300013104 | Ga0157370_10145638 | Ga0157370_101456382 | 202 |
| 446 | 3300013105 | Ga0157369_10077580 | Ga0157369_100775801 | 202 |
| 447 | 3300013105 | Ga0157369_10215605 | Ga0157369_102156053 | 202 |
| 448 | 3300013105 | Ga0157369_10757839 | Ga0157369_107578391 | 202 |
| 449 | 3300013307 | Ga0157372_10000913 | Ga0157372_1000091327 | 202 |
| 450 | 3300013307 | Ga0157372_10004388 | Ga0157372_1000438810 | 202 |
| 451 | 3300013307 | Ga0157372_10009662 | Ga0157372_100096622 | 202 |
| 452 | 3300013307 | Ga0157372_10831085 | Ga0157372_108310852 | 202 |
| 453 | 3300014497 | Ga0182008_10027617 | Ga0182008_100276172 | 202 |
| 454 | 3300015262 | Ga0182007_10009484 | Ga0182007_100094843 | 202 |
| 455 | 3300020069 | Ga0197907_10509654 | Ga0197907_105096541 | 202 |
| 456 | 3300020069 | Ga0197907_10527168 | Ga0197907_105271683 | 202 |
| 457 | 3300020069 | Ga0197907_10639122 | Ga0197907_106391222 | 202 |
| 458 | 3300020069 | Ga0197907_11400373 | Ga0197907_114003733 | 202 |
| 459 | 3300020070 | Ga0206356_10320396 | Ga0206356_103203966 | 202 |
| 460 | 3300020070 | Ga0206356_10447347 | Ga0206356_104473473 | 202 |
| 461 | 3300020070 | Ga0206356_10935926 | Ga0206356_109359263 | 202 |
| 462 | 3300020070 | Ga0206356_11158323 | Ga0206356_111583231 | 202 |
| 463 | 3300020075 | Ga0206349_1411469 | Ga0206349_14114691 | 202 |
| 464 | 3300020075 | Ga0206349_1780936 | Ga0206349_17809361 | 202 |
| 465 | 3300020076 | Ga0206355_1040908 | Ga0206355_10409082 | 202 |
| 466 | 3300020076 | Ga0206355_1498383 | Ga0206355_14983832 | 202 |
| 467 | 3300020077 | Ga0206351_10352168 | Ga0206351_103521681 | 202 |
| 468 | 3300020078 | Ga0206352_10568306 | Ga0206352_105683062 | 202 |
| 469 | 3300020078 | Ga0206352_11267884 | Ga0206352_112678841 | 202 |
| 470 | 3300020080 | Ga0206350_10104620 | Ga0206350_101046201 | 202 |
| 471 | 3300020080 | Ga0206350_10531860 | Ga0206350_105318601 | 202 |
| 472 | 3300020080 | Ga0206350_11189059 | Ga0206350_111890592 | 202 |
| 473 | 3300020081 | Ga0206354_10147252 | Ga0206354_101472523 | 202 |
| 474 | 3300020081 | Ga0206354_10629525 | Ga0206354_106295251 | 202 |
| 475 | 3300020081 | Ga0206354_11117816 | Ga0206354_111178163 | 202 |
| 476 | 3300020082 | Ga0206353_10803669 | Ga0206353_108036694 | 202 |
| 477 | 3300020082 | Ga0206353_11069350 | Ga0206353_110693502 | 202 |
| 478 | 3300020610 | Ga0154015_1006590 | Ga0154015_10065902 | 202 |
| 479 | 3300020610 | Ga0154015_1376900 | Ga0154015_13769001 | 202 |
| 480 | 3300020610 | Ga0154015_1478509 | Ga0154015_14785093 | 202 |
| 481 | 3300020610 | Ga0154015_1496403 | Ga0154015_14964032 | 202 |
| 482 | 3300022467 | Ga0224712_10113064 | Ga0224712_101130642 | 202 |
| 483 | 3300022467 | Ga0224712_10172925 | Ga0224712_101729252 | 202 |
| 484 | 3300022467 | Ga0224712_10177225 | Ga0224712_101772251 | 202 |
| 485 | 3300022467 | Ga0224712_10217353 | Ga0224712_102173531 | 202 |
| 486 | 3300025225 | Ga0209566_102011 | Ga0209566_1020111 | 202 |
| 487 | 3300025226 | Ga0209674_104234 | Ga0209674_1042343 | 202 |
| 488 | 3300025228 | Ga0209672_100024 | Ga0209672_100024239 | 202 |
| 489 | 3300025228 | Ga0209672_100113 | Ga0209672_10011331 | 202 |
| 490 | 3300025228 | Ga0209672_100976 | Ga0209672_1009762 | 202 |
| 491 | 3300025230 | Ga0209563_100127 | Ga0209563_10012732 | 202 |
| 492 | 3300025231 | Ga0207427_100075 | Ga0207427_10007535 | 202 |
| 493 | 3300025231 | Ga0207427_100192 | Ga0207427_10019213 | 202 |
| 494 | 3300025233 | Ga0209437_100020 | Ga0209437_100020313 | 202 |
| 495 | 3300025233 | Ga0209437_100319 | Ga0209437_10031910 | 202 |
| 496 | 3300025233 | Ga0209437_108345 | Ga0209437_1083451 | 202 |
| 497 | 3300025242 | Ga0209258_100047 | Ga0209258_100047239 | 202 |
| 498 | 3300025242 | Ga0209258_100144 | Ga0209258_10014449 | 202 |
| 499 | 3300025242 | Ga0209258_100198 | Ga0209258_10019874 | 202 |
| 500 | 3300025246 | Ga0209646_1000635 | Ga0209646_10006357 | 202 |
| 501 | 3300025250 | Ga0209026_1000037 | Ga0209026_100003734 | 202 |
| 502 | 3300025250 | Ga0209026_1000122 | Ga0209026_100012247 | 202 |
| 503 | 3300025250 | Ga0209026_1002009 | Ga0209026_10020091 | 202 |
| 504 | 3300025250 | Ga0209026_1015125 | Ga0209026_10151252 | 202 |
| 505 | 3300025254 | Ga0209148_1000024 | Ga0209148_1000024223 | 202 |
| 506 | 3300025254 | Ga0209148_1000054 | Ga0209148_1000054239 | 202 |
| 507 | 3300025254 | Ga0209148_1000141 | Ga0209148_100014188 | 202 |
| 508 | 3300025256 | Ga0209759_1001003 | Ga0209759_100100311 | 202 |
| 509 | 3300025256 | Ga0209759_1016179 | Ga0209759_10161791 | 202 |
| 510 | 3300025261 | Ga0209233_1000020 | Ga0209233_1000020312 | 202 |
| 511 | 3300025261 | Ga0209233_1000210 | Ga0209233_100021036 | 202 |
| 512 | 3300025261 | Ga0209233_1000307 | Ga0209233_100030713 | 202 |
| 513 | 3300025261 | Ga0209233_1007835 | Ga0209233_10078352 | 202 |
| 514 | 3300025272 | Ga0209455_1000025 | Ga0209455_1000025223 | 202 |
| 515 | 3300025272 | Ga0209455_1000052 | Ga0209455_1000052239 | 202 |
| 516 | 3300025272 | Ga0209455_1000578 | Ga0209455_10005787 | 202 |
| 517 | 3300025272 | Ga0209455_1001868 | Ga0209455_10018684 | 202 |
| 518 | 3300025321 | Ga0207656_10019453 | Ga0207656_100194533 | 202 |
| 519 | 3300025321 | Ga0207656_10093976 | Ga0207656_100939763 | 202 |
| 520 | 3300025904 | Ga0207647_10001035 | Ga0207647_100010357 | 202 |
| 521 | 3300025904 | Ga0207647_10009739 | Ga0207647_100097391 | 202 |
| 522 | 3300025909 | Ga0207705_10000691 | Ga0207705_1000069117 | 202 |
| 523 | 3300025909 | Ga0207705_10000958 | Ga0207705_100009582 | 202 |
| 524 | 3300025909 | Ga0207705_10028893 | Ga0207705_100288935 | 202 |
| 525 | 3300025909 | Ga0207705_10110815 | Ga0207705_101108153 | 202 |
| 526 | 3300025909 | Ga0207705_10501371 | Ga0207705_105013712 | 202 |
| 527 | 3300025911 | Ga0207654_10062351 | Ga0207654_100623514 | 202 |
| 528 | 3300025911 | Ga0207654_10379453 | Ga0207654_103794531 | 202 |
| 529 | 3300025912 | Ga0207707_10000083 | Ga0207707_1000008327 | 202 |
| 530 | 3300025912 | Ga0207707_10000093 | Ga0207707_1000009353 | 202 |
| 531 | 3300025912 | Ga0207707_10000152 | Ga0207707_1000015241 | 202 |
| 532 | 3300025912 | Ga0207707_10000570 | Ga0207707_1000057020 | 202 |
| 533 | 3300025912 | Ga0207707_10000623 | Ga0207707_1000062322 | 202 |
| 534 | 3300025912 | Ga0207707_10000756 | Ga0207707_1000075615 | 202 |
| 535 | 3300025912 | Ga0207707_10036159 | Ga0207707_100361595 | 202 |
| 536 | 3300025913 | Ga0207695_10002920 | Ga0207695_100029206 | 202 |
| 537 | 3300025913 | Ga0207695_10004847 | Ga0207695_100048477 | 202 |
| 538 | 3300025913 | Ga0207695_10012886 | Ga0207695_100128866 | 202 |
| 539 | 3300025913 | Ga0207695_10022277 | Ga0207695_100222772 | 202 |
| 540 | 3300025914 | Ga0207671_10000329 | Ga0207671_1000032937 | 202 |
| 541 | 3300025914 | Ga0207671_10331663 | Ga0207671_103316631 | 202 |
| 542 | 3300025917 | Ga0207660_10000103 | Ga0207660_1000010318 | 202 |
| 543 | 3300025917 | Ga0207660_10000305 | Ga0207660_1000030518 | 202 |
| 544 | 3300025917 | Ga0207660_10005291 | Ga0207660_100052916 | 202 |
| 545 | 3300025917 | Ga0207660_10216966 | Ga0207660_102169663 | 202 |
| 546 | 3300025919 | Ga0207657_10002228 | Ga0207657_1000222824 | 202 |
| 547 | 3300025919 | Ga0207657_10022253 | Ga0207657_100222534 | 202 |
| 548 | 3300025919 | Ga0207657_10205299 | Ga0207657_102052991 | 202 |
| 549 | 3300025919 | Ga0207657_10318583 | Ga0207657_103185832 | 202 |
| 550 | 3300025920 | Ga0207649_10018692 | Ga0207649_100186923 | 202 |
| 551 | 3300025921 | Ga0207652_10000038 | Ga0207652_1000003871 | 202 |
| 552 | 3300025921 | Ga0207652_10000129 | Ga0207652_1000012911 | 202 |
| 553 | 3300025921 | Ga0207652_10000257 | Ga0207652_1000025751 | 202 |
| 554 | 3300025921 | Ga0207652_10000910 | Ga0207652_100009108 | 202 |
| 555 | 3300025924 | Ga0207694_10200223 | Ga0207694_102002232 | 202 |
| 556 | 3300025928 | Ga0207700_10024162 | Ga0207700_100241622 | 202 |
| 557 | 3300025929 | Ga0207664_10031080 | Ga0207664_100310803 | 202 |
| 558 | 3300025932 | Ga0207690_10000782 | Ga0207690_100007826 | 202 |
| 559 | 3300025932 | Ga0207690_10176935 | Ga0207690_101769351 | 202 |
| 560 | 3300025933 | Ga0207706_10068915 | Ga0207706_100689153 | 202 |
| 561 | 3300025944 | Ga0207661_10004323 | Ga0207661_100043232 | 202 |
| 562 | 3300025944 | Ga0207661_10023756 | Ga0207661_100237563 | 202 |
| 563 | 3300025944 | Ga0207661_10491988 | Ga0207661_104919881 | 202 |
| 564 | 3300025945 | Ga0207679_10036141 | Ga0207679_100361415 | 202 |
| 565 | 3300025949 | Ga0207667_10003257 | Ga0207667_1000325713 | 202 |
| 566 | 3300025949 | Ga0207667_10003401 | Ga0207667_100034018 | 202 |
| 567 | 3300025949 | Ga0207667_10102061 | Ga0207667_101020612 | 202 |
| 568 | 3300025949 | Ga0207667_10551145 | Ga0207667_105511451 | 202 |
| 569 | 3300025981 | Ga0207640_10011511 | Ga0207640_100115116 | 202 |
| 570 | 3300025981 | Ga0207640_10039617 | Ga0207640_100396173 | 202 |
| 571 | 3300025981 | Ga0207640_10688267 | Ga0207640_106882672 | 202 |
| 572 | 3300026041 | Ga0207639_10000833 | Ga0207639_1000083312 | 202 |
| 573 | 3300026041 | Ga0207639_10020629 | Ga0207639_100206296 | 202 |
| 574 | 3300026067 | Ga0207678_10001110 | Ga0207678_1000111016 | 202 |
| 575 | 3300026067 | Ga0207678_10001566 | Ga0207678_100015662 | 202 |
| 576 | 3300026067 | Ga0207678_10002045 | Ga0207678_100020454 | 202 |
| 577 | 3300026067 | Ga0207678_10129621 | Ga0207678_101296212 | 202 |
| 578 | 3300026067 | Ga0207678_10242320 | Ga0207678_102423202 | 202 |
| 579 | 3300026078 | Ga0207702_10000321 | Ga0207702_1000032116 | 202 |
| 580 | 3300026078 | Ga0207702_10000719 | Ga0207702_1000071926 | 202 |
| 581 | 3300026078 | Ga0207702_10001824 | Ga0207702_1000182415 | 202 |
| 582 | 3300026078 | Ga0207702_10004954 | Ga0207702_100049545 | 202 |
| 583 | 3300026078 | Ga0207702_10005157 | Ga0207702_100051573 | 202 |
| 584 | 3300026116 | Ga0207674_10002170 | Ga0207674_100021707 | 202 |
| 585 | 3300026116 | Ga0207674_10158725 | Ga0207674_101587252 | 202 |
| 586 | 3300026142 | Ga0207698_10000707 | Ga0207698_1000070717 | 202 |
| 587 | 3300026142 | Ga0207698_10001030 | Ga0207698_100010303 | 202 |
| 588 | 3300026142 | Ga0207698_10028714 | Ga0207698_100287145 | 202 |
| 589 | 3300037312 | Ga0395899_0005509 | Ga0395899_0005509_4295_4906 | 202 |
| 590 | 3300037312 | Ga0395899_0025605 | Ga0395899_0025605_1163_1771 | 202 |
| 591 | 3300037312 | Ga0395899_0214774 | Ga0395899_0214774_115_723 | 202 |
| 592 | 3300037418 | Ga0395900_0000092 | Ga0395900_0000092_7762_8373 | 202 |
| 593 | 3300037418 | Ga0395900_0045052 | Ga0395900_0045052_3479_4129 | 202 |
| 594 | 3300037418 | Ga0395900_0701582 | Ga0395900_0701582_84_692 | 202 |
| 595 | 3300037466 | Ga0395898_0000069 | Ga0395898_0000069_43062_43673 | 202 |
| 596 | 3300037466 | Ga0395898_0055944 | Ga0395898_0055944_1260_1868 | 202 |
| 597 | 3300037466 | Ga0395898_0324121 | Ga0395898_0324121_441_1049 | 202 |
| 598 | 3300037466 | Ga0395898_0488521 | Ga0395898_0488521_166_777 | 202 |
| 599 | 3300038443 | Ga0395901_0062401 | Ga0395901_0062401_1410_2018 | 202 |
| 600 | 3300044693 | Ga0466961_0000786 | Ga0466961_0000786_10812_11423 | 202 |
| 601 | 3300046674 | Ga0495588_0135606 | Ga0495588_0135606_432_1043 | 202 |
| 602 | 3300049569 | Ga0501032_0052169 | Ga0501032_0052169_503_1117 | 202 |
| 603 | 3300049569 | Ga0501032_0208339 | Ga0501032_0208339_123_806 | 202 |
| 604 | 3300049570 | Ga0501033_0027183 | Ga0501033_0027183_231_839 | 202 |
| 605 | 3300049570 | Ga0501033_0035819 | Ga0501033_0035819_200_814 | 202 |
| 606 | 3300049572 | Ga0501036_0613073 | Ga0501036_0613073_145_828 | 202 |
| 607 | 3300049573 | Ga0501037_0028898 | Ga0501037_0028898_72_680 | 202 |
| 608 | 3300049581 | Ga0501047_0005476 | Ga0501047_0005476_32_640 | 202 |
| 609 | 3300049581 | Ga0501047_0055919 | Ga0501047_0055919_1198_1812 | 202 |
| 610 | 3300049582 | Ga0501048_0082907 | Ga0501048_0082907_1435_2049 | 202 |
| 611 | 3300049585 | Ga0501069_0001687 | Ga0501069_0001687_6689_7312 | 202 |
| 612 | 3300049585 | Ga0501069_0004932 | Ga0501069_0004932_337_1020 | 202 |
| 613 | 3300049585 | Ga0501069_0077447 | Ga0501069_0077447_356_964 | 202 |
| 614 | 3300049586 | Ga0501070_0059254 | Ga0501070_0059254_2191_2799 | 202 |
| 615 | 3300049586 | Ga0501070_0061962 | Ga0501070_0061962_2053_2661 | 202 |
| 616 | 3300049586 | Ga0501070_0116223 | Ga0501070_0116223_311_919 | 202 |
| 617 | 3300049586 | Ga0501070_0204292 | Ga0501070_0204292_996_1607 | 202 |
| 618 | 3300049586 | Ga0501070_0329838 | Ga0501070_0329838_388_1011 | 202 |
| 619 | 3300049586 | Ga0501070_0663122 | Ga0501070_0663122_19_627 | 202 |
| 620 | 3300049587 | Ga0501071_0042894 | Ga0501071_0042894_1342_1950 | 202 |
| 621 | 3300049589 | Ga0501073_0014628 | Ga0501073_0014628_3904_4512 | 202 |
| 622 | 3300049589 | Ga0501073_0048509 | Ga0501073_0048509_258_941 | 202 |
| 623 | 3300049590 | Ga0501074_0004621 | Ga0501074_0004621_6140_6748 | 202 |
| 624 | 3300049590 | Ga0501074_0047977 | Ga0501074_0047977_1858_2466 | 202 |
| 625 | 3300049590 | Ga0501074_0105274 | Ga0501074_0105274_183_866 | 202 |
| 626 | 3300049590 | Ga0501074_0220560 | Ga0501074_0220560_298_906 | 202 |
| 627 | 3300049593 | Ga0501077_0027216 | Ga0501077_0027216_2553_3299 | 202 |
| 628 | 3300049742 | Ga0501080_0005199 | Ga0501080_0005199_3034_3642 | 202 |
| 629 | 3300049742 | Ga0501080_0014472 | Ga0501080_0014472_989_1597 | 202 |
| 630 | 3300049742 | Ga0501080_0511586 | Ga0501080_0511586_397_1011 | 202 |
| 631 | 3300049822 | Ga0501035_0001381 | Ga0501035_0001381_15961_16569 | 202 |
| 632 | 3300049822 | Ga0501035_0054175 | Ga0501035_0054175_438_1046 | 202 |
| 633 | 3300049822 | Ga0501035_0086364 | Ga0501035_0086364_206_820 | 202 |
| 634 | 3300049822 | Ga0501035_0136804 | Ga0501035_0136804_17_625 | 202 |
| 635 | 3300049823 | Ga0501044_0006414 | Ga0501044_0006414_3573_4181 | 202 |
| 636 | 3300049823 | Ga0501044_0112192 | Ga0501044_0112192_884_1492 | 202 |
| 637 | 3300049823 | Ga0501044_0161093 | Ga0501044_0161093_1348_1962 | 202 |
| 638 | 3300049823 | Ga0501044_0167515 | Ga0501044_0167515_1282_1965 | 202 |
| 639 | 3300049823 | Ga0501044_0378156 | Ga0501044_0378156_72_686 | 202 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5epf-assembly1.cif.gz_A | crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis | 0.8958 | 26 | 196 |
| 3drn-assembly2.cif.gz_B | the crystal structure of bcp1 from sulfolobus sulfataricus | 0.8779 | 26 | 199 |
| 5epf-assembly1.cif.gz_A | crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis | 0.8737 | 26 | 196 |
| 3drn-assembly2.cif.gz_B | the crystal structure of bcp1 from sulfolobus sulfataricus | 0.8669 | 26 | 199 |
| 3hjp-assembly2.cif.gz_D | the crystal structure of bcp4 from sulfolobus solfataricus | 0.8618 | 26 | 198 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q55E48_3_135_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9032 | 26 | 173 | 3.40.30.10 |
| 5epfA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8958 | 26 | 196 | 3.40.30.10 |
| af_Q54W30_4_152_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8819 | 26 | 198 | 3.40.30.10 |
| 3drnB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8779 | 26 | 199 | 3.40.30.10 |
| af_Q559T9_1_157_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8742 | 26 | 198 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X0J0U8-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9674 | 26 | 194 |
GO:0005737
GO:0008379 GO:0009579 GO:0034599 GO:0045454 |
| AF-A0A317IDL9-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9654 | 23 | 195 |
GO:0005737
GO:0008379 GO:0009579 GO:0034599 GO:0045454 |
| AF-A0A370X6L9-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) | 0.9507 | 18 | 202 |
GO:0005737
GO:0008379 GO:0009579 GO:0034599 GO:0045454 |
| AF-A0A7X0J0U8-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9455 | 26 | 194 |
GO:0005737
GO:0008379 GO:0009579 GO:0034599 GO:0045454 |
| AF-A0A418RQD4-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) | 0.9441 | 51 | 198 |
GO:0005737
GO:0008379 GO:0009579 GO:0034599 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar