F471591

General Info

Members Datasets Scaffolds Average Seq Length
639 294 636 201

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100468002|Ga0070675_1004680021
Length 222
Sequence MSLRLFDVFHAMRAAPVAALLVAVLAAGRSEAALKPGDAAPAFKTQASLAGKAFEFNLKDQIAKGPVVVYFYPAAYTNGCNIQAHTFAEHIADFRAAGATVVGVSLDSIERLNEFSADPDYCAGKLPVASDPGGRIALSYDLQLRPAGGGRKDTRGREIDHASTERTTFVVGPDGKVAAAIGGVAPDANVLQALAFVRTLAATPGSRSTSDLTSPLPQRIQP

Samples

Sample ID Description Type Environment
1 2842711865 Duganella sp. R-73148 Isolate Unclassified
2 2884411467 Dyella sp. AD56 Isolate Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
100 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
164 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
165 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
269 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
281 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
282 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
283 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
284 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
285 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
286 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
287 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
288 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
289 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
290 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
294 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.08
Metatranscriptomes 8.45
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.24
Nodule 0
Rhizoplane 0.63
Rhizosphere 81.53
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000968 3300001915 Bacteria 8639
2 JGI24741J21665_1010185 3300001915 Bacteria 1695
3 JGI24740J21852_10000505 3300001979 Bacteria 16761
4 JGI24740J21852_10000511 3300001979 Bacteria 16661
5 JGI25162J39368_1001409 3300002737 Bacteria 13110
6 JGI25157J39369_1000543 3300002741 Bacteria 22649
7 JGI25164J39214_1000163 3300002772 Bacteria 63006
8 JGI25164J39214_1000308 3300002772 Bacteria 32478
9 JGI25164J39214_1005867 3300002772 Bacteria 1312
10 JGI25165J46597_1000326 3300003214 Bacteria 57016
11 JGI25165J46597_1002757 3300003214 Bacteria 5136
12 rootH1_10164261 3300003316 Bacteria 1054
13 rootH2_10161275 3300003320 Bacteria 8757
14 rootH1_10003926 3300003323 Bacteria 77590
15 Ga0055539_1006297 3300003752 Bacteria 1519
16 Ga0055533_1004470 3300003756 Bacteria 2498
17 Ga0055525_1000360 3300003759 Bacteria 30894
18 Ga0055527_1000128 3300003760 Bacteria 53342
19 Ga0055527_1000267 3300003760 Bacteria 31477
20 Ga0055527_1000960 3300003760 Bacteria 7082
21 Ga0055535_1000287 3300003761 Bacteria 53346
22 Ga0055535_1000294 3300003761 Bacteria 51663
23 Ga0055535_1000614 3300003761 Bacteria 29185
24 Ga0055535_1000860 3300003761 Bacteria 21472
25 Ga0055542_1000010 3300003762 Bacteria 414813
26 Ga0055542_1000057 3300003762 Bacteria 162955
27 Ga0055542_1000101 3300003762 Bacteria 116277
28 Ga0055542_1000311 3300003762 Bacteria 53346
29 Ga0055542_1000518 3300003762 Bacteria 34823
30 Ga0055529_1000105 3300003763 Bacteria 123670
31 Ga0055529_1000329 3300003763 Bacteria 53347
32 Ga0055529_1000755 3300003763 Bacteria 20625
33 Ga0055526_1002471 3300003771 Bacteria 12492
34 Ga0055537_1003943 3300003773 Bacteria 4402
35 Ga0055524_1002272 3300003775 Bacteria 10040
36 Ga0055530_10000186 3300003791 Bacteria 55634
37 Ga0058863_10059087 3300004799 Bacteria 1583
38 Ga0058863_11435829 3300004799 Unclassified 773
39 Ga0058861_10012108 3300004800 Bacteria 742
40 Ga0058861_10037249 3300004800 Bacteria 1304
41 Ga0058861_11678086 3300004800 Bacteria 715
42 Ga0058861_12029677 3300004800 Bacteria 933
43 Ga0058862_10060691 3300004803 Bacteria 926
44 Ga0058862_12234460 3300004803 Bacteria 1071
45 Ga0058862_12525583 3300004803 Unclassified 674
46 Ga0058862_12545346 3300004803 Bacteria 841
47 Ga0058862_12867910 3300004803 Bacteria 793
48 Ga0065165_1072998 3300005262 Bacteria 907
49 Ga0065707_10082740 3300005295 Bacteria 12384
50 Ga0070658_10000153 3300005327 Bacteria 60625
51 Ga0070658_10285021 3300005327 Bacteria 1406
52 Ga0070658_11049881 3300005327 Bacteria 709
53 Ga0070683_100207281 3300005329 Bacteria 1862
54 Ga0070683_100457150 3300005329 Bacteria 1218
55 Ga0070683_100477369 3300005329 Bacteria 1191
56 Ga0068869_100157447 3300005334 Bacteria 1766
57 Ga0068869_100281763 3300005334 Bacteria 1337
58 Ga0070680_100001865 3300005336 Bacteria 15457
59 Ga0070680_100034311 3300005336 Bacteria 4090
60 Ga0070680_100050413 3300005336 Bacteria 3395
61 Ga0070680_100062792 3300005336 Bacteria 3042
62 Ga0070680_100322897 3300005336 Bacteria 1310
63 Ga0070680_100553016 3300005336 Bacteria 986
64 Ga0070682_100017773 3300005337 Bacteria 4148
65 Ga0070682_100019204 3300005337 Bacteria 4006
66 Ga0070682_100330824 3300005337 Bacteria 1129
67 Ga0068868_100235765 3300005338 Bacteria 1536
68 Ga0070660_100786687 3300005339 Bacteria 800
69 Ga0070691_10001099 3300005341 Bacteria 11231
70 Ga0070691_10053974 3300005341 Bacteria 1923
71 Ga0070661_100003367 3300005344 Bacteria 11021
72 Ga0070661_100233898 3300005344 Bacteria 1413
73 Ga0070661_100409379 3300005344 Bacteria 1073
74 Ga0070661_100593960 3300005344 Bacteria 894
75 Ga0070692_10001540 3300005345 Bacteria 8468
76 Ga0070692_10016588 3300005345 Bacteria 3504
77 Ga0070692_10094689 3300005345 Bacteria 1628
78 Ga0070692_10150641 3300005345 Bacteria 1324
79 Ga0070675_100327556 3300005354 Bacteria 1354
80 Ga0070675_100468002 3300005354 Bacteria 1132
81 Ga0070671_100000028 3300005355 Bacteria 113877
82 Ga0070659_100081620 3300005366 Bacteria 2582
83 Ga0070667_100427369 3300005367 Bacteria 1208
84 Ga0070714_100016246 3300005435 Bacteria 6003
85 Ga0070713_100032124 3300005436 Bacteria 4189
86 Ga0070701_10012388 3300005438 Bacteria 3845
87 Ga0070663_100031066 3300005455 Bacteria 3667
88 Ga0070663_100067718 3300005455 Bacteria 2590
89 Ga0070663_100332150 3300005455 Bacteria 1226
90 Ga0070681_10000086 3300005458 Bacteria 70488
91 Ga0070681_10000230 3300005458 Bacteria 44114
92 Ga0070681_10000536 3300005458 Bacteria 31204
93 Ga0070681_10006881 3300005458 Bacteria 11069
94 Ga0070681_10017005 3300005458 Bacteria 7268
95 Ga0070681_10051051 3300005458 Bacteria 4125
96 Ga0070681_10144414 3300005458 Bacteria 2309
97 Ga0070681_10187187 3300005458 Bacteria 1990
98 Ga0070681_10294759 3300005458 Unclassified 1532
99 Ga0070679_100001047 3300005530 Bacteria 24095
100 Ga0070679_100002395 3300005530 Bacteria 16997
101 Ga0070679_100008496 3300005530 Bacteria 9673
102 Ga0070679_100015994 3300005530 Bacteria 7226
103 Ga0070679_100021147 3300005530 Bacteria 6348
104 Ga0070684_100047927 3300005535 Bacteria 3705
105 Ga0068853_100048960 3300005539 Bacteria 3630
106 Ga0068853_100446716 3300005539 Bacteria 1216
107 Ga0068853_100882543 3300005539 Bacteria 858
108 Ga0070696_100002360 3300005546 Bacteria 12478
109 Ga0070696_100063698 3300005546 Bacteria 2583
110 Ga0070696_100241196 3300005546 Bacteria 1363
111 Ga0070696_100254122 3300005546 Bacteria 1330
112 Ga0070696_100266232 3300005546 Bacteria 1301
113 Ga0070693_100002470 3300005547 Bacteria 8518
114 Ga0070665_100023152 3300005548 Bacteria 6256
115 Ga0070665_100413603 3300005548 Bacteria 1357
116 Ga0070704_100046602 3300005549 Bacteria 3025
117 Ga0068855_100000261 3300005563 Bacteria 65836
118 Ga0068855_100013395 3300005563 Bacteria 9889
119 Ga0068855_100017551 3300005563 Bacteria 8606
120 Ga0068855_100017553 3300005563 Bacteria 8605
121 Ga0068855_100025560 3300005563 Bacteria 7063
122 Ga0068855_100052298 3300005563 Bacteria 4809
123 Ga0068855_100099202 3300005563 Bacteria 3355
124 Ga0068855_100704758 3300005563 Bacteria 1080
125 Ga0070664_100098768 3300005564 Bacteria 2537
126 Ga0068857_100271887 3300005577 Bacteria 1557
127 Ga0068857_100880756 3300005577 Bacteria 858
128 Ga0068857_100910235 3300005577 Bacteria 844
129 Ga0068854_100009840 3300005578 Bacteria 6183
130 Ga0068854_100030052 3300005578 Bacteria 3766
131 Ga0068854_100289417 3300005578 Bacteria 1321
132 Ga0068856_100140570 3300005614 Bacteria 2421
133 Ga0068856_100142659 3300005614 Bacteria 2402
134 Ga0068852_100643263 3300005616 Bacteria 1067
135 Ga0068852_100730678 3300005616 Bacteria 1001
136 Ga0068859_100231889 3300005617 Bacteria 1934
137 Ga0068861_100314740 3300005719 Unclassified 1361
138 Ga0068851_10044717 3300005834 Bacteria 2236
139 Ga0068851_10248325 3300005834 Bacteria 1009
140 Ga0068863_100658668 3300005841 Bacteria 1039
141 Ga0068860_101133017 3300005843 Bacteria 802
142 Ga0075366_10118877 3300006195 Unclassified 1592
143 Ga0075428_100011828 3300006844 Bacteria 9714
144 Ga0075428_100139703 3300006844 Bacteria 2634
145 Ga0075431_100017829 3300006847 Bacteria 7218
146 Ga0075433_10275185 3300006852 Bacteria 1492
147 Ga0075429_100149809 3300006880 Bacteria 2042
148 Ga0097620_100231889 3300006931 Bacteria 1934
149 Ga0097620_100731721 3300006931 Bacteria 1079
150 Ga0075435_100289600 3300007076 Bacteria 1399
151 Ga0105240_10001826 3300009093 Bacteria 35711
152 Ga0105240_10003386 3300009093 Bacteria 24782
153 Ga0105240_10006479 3300009093 Bacteria 17192
154 Ga0105240_10067254 3300009093 Bacteria 4442
155 Ga0105240_10240929 3300009093 Bacteria 2097
156 Ga0105240_10284162 3300009093 Bacteria 1899
157 Ga0105240_10298602 3300009093 Bacteria 1843
158 Ga0105240_11073758 3300009093 Bacteria 858
159 Ga0111539_10029448 3300009094 Bacteria 6687
160 Ga0111539_10050746 3300009094 Bacteria 4942
161 Ga0111539_10089205 3300009094 Bacteria 3623
162 Ga0111539_10129594 3300009094 Bacteria 2954
163 Ga0111539_10781657 3300009094 Bacteria 1111
164 Ga0114129_10770809 3300009147 Bacteria 1230
165 Ga0105243_10045383 3300009148 Bacteria 3453
166 Ga0105241_10111543 3300009174 Bacteria 2190
167 Ga0105241_10502716 3300009174 Bacteria 1081
168 Ga0105242_11673288 3300009176 Unclassified 672
169 Ga0105237_10000183 3300009545 Bacteria 88412
170 Ga0105237_10095262 3300009545 Bacteria 2966
171 Ga0105238_10004866 3300009551 Bacteria 13286
172 Ga0105238_10007034 3300009551 Bacteria 11250
173 Ga0105238_10190079 3300009551 Bacteria 2029
174 Ga0105238_10354488 3300009551 Bacteria 1456
175 Ga0105249_10292920 3300009553 Bacteria 1630
176 Ga0105239_10512584 3300010375 Bacteria 1364
177 Ga0105246_10013007 3300011119 Bacteria 5207
178 Ga0157373_10008206 3300013100 Bacteria 7766
179 Ga0157373_10021463 3300013100 Bacteria 4690
180 Ga0157373_10034377 3300013100 Bacteria 3640
181 Ga0157371_10096189 3300013102 Bacteria 2099
182 Ga0157370_10002285 3300013104 Bacteria 23243
183 Ga0157370_10007483 3300013104 Bacteria 11861
184 Ga0157370_10022245 3300013104 Bacteria 6309
185 Ga0157370_10029604 3300013104 Bacteria 5371
186 Ga0157370_10057856 3300013104 Bacteria 3684
187 Ga0157370_10145638 3300013104 Bacteria 2206
188 Ga0157369_10017028 3300013105 Bacteria 8167
189 Ga0157369_10077580 3300013105 Bacteria 3561
190 Ga0157369_10215605 3300013105 Bacteria 2011
191 Ga0157369_10532822 3300013105 Bacteria 1214
192 Ga0157369_10757839 3300013105 Bacteria 998
193 Ga0157374_10005513 3300013296 Bacteria 10634
194 Ga0157378_10227978 3300013297 Bacteria 1774
195 Ga0157378_10720815 3300013297 Bacteria 1018
196 Ga0163162_10804410 3300013306 Unclassified 1057
197 Ga0157372_10000913 3300013307 Bacteria 32140
198 Ga0157372_10004388 3300013307 Bacteria 15052
199 Ga0157372_10009662 3300013307 Bacteria 10253
200 Ga0157372_10074492 3300013307 Bacteria 3828
201 Ga0157372_10274693 3300013307 Bacteria 1959
202 Ga0157372_10831085 3300013307 Bacteria 1073
203 Ga0157372_11108245 3300013307 Bacteria 916
204 Ga0157375_10702884 3300013308 Bacteria 1164
205 Ga0157380_10000816 3300014326 Bacteria 19526
206 Ga0157380_10066614 3300014326 Bacteria 2897
207 Ga0182008_10027617 3300014497 Bacteria 2873
208 Ga0182007_10009484 3300015262 Bacteria 3918
209 Ga0163161_10082665 3300017792 Bacteria 2366
210 Ga0163161_10343346 3300017792 Bacteria 1185
211 Ga0197907_10509654 3300020069 Bacteria 878
212 Ga0197907_10527168 3300020069 Bacteria 4955
213 Ga0197907_10639122 3300020069 Bacteria 1103
214 Ga0197907_11156994 3300020069 Bacteria 854
215 Ga0197907_11400373 3300020069 Bacteria 3737
216 Ga0206356_10320396 3300020070 Bacteria 4242
217 Ga0206356_10447347 3300020070 Bacteria 2884
218 Ga0206356_10573590 3300020070 Bacteria 970
219 Ga0206356_10935926 3300020070 Bacteria 3870
220 Ga0206356_11158323 3300020070 Bacteria 2203
221 Ga0206356_11526086 3300020070 Bacteria 970
222 Ga0206356_11734160 3300020070 Bacteria 1052
223 Ga0206349_1411469 3300020075 Bacteria 1114
224 Ga0206349_1780936 3300020075 Bacteria 649
225 Ga0206349_1969738 3300020075 Bacteria 629
226 Ga0206355_1040908 3300020076 Bacteria 1100
227 Ga0206355_1498383 3300020076 Bacteria 1019
228 Ga0206351_10352168 3300020077 Bacteria 768
229 Ga0206352_10568306 3300020078 Bacteria 1690
230 Ga0206352_10607276 3300020078 Bacteria 836
231 Ga0206352_10635024 3300020078 Bacteria 858
232 Ga0206352_11267884 3300020078 Bacteria 760
233 Ga0206350_10104620 3300020080 Bacteria 1231
234 Ga0206350_10531860 3300020080 Bacteria 1679
235 Ga0206350_11189059 3300020080 Bacteria 1099
236 Ga0206354_10147252 3300020081 Bacteria 3290
237 Ga0206354_10629525 3300020081 Bacteria 831
238 Ga0206354_11117816 3300020081 Bacteria 3763
239 Ga0206354_11327790 3300020081 Bacteria 1000
240 Ga0206353_10803669 3300020082 Bacteria 4720
241 Ga0206353_11069350 3300020082 Bacteria 1330
242 Ga0154015_1006590 3300020610 Bacteria 1079
243 Ga0154015_1376900 3300020610 Bacteria 1034
244 Ga0154015_1478509 3300020610 Bacteria 6333
245 Ga0154015_1496403 3300020610 Bacteria 2548
246 Ga0224712_10113064 3300022467 Bacteria 1167
247 Ga0224712_10172925 3300022467 Bacteria 969
248 Ga0224712_10177225 3300022467 Bacteria 959
249 Ga0224712_10217353 3300022467 Bacteria 874
250 Ga0209566_102011 3300025225 Bacteria 4296
251 Ga0209674_100026 3300025226 Bacteria 490631
252 Ga0209674_100416 3300025226 Bacteria 20955
253 Ga0209674_104234 3300025226 Bacteria 2377
254 Ga0209672_100017 3300025228 Bacteria 514236
255 Ga0209672_100024 3300025228 Bacteria 367869
256 Ga0209672_100113 3300025228 Bacteria 92025
257 Ga0209672_100976 3300025228 Bacteria 12672
258 Ga0209672_101419 3300025228 Bacteria 8678
259 Ga0209563_100127 3300025230 Bacteria 109913
260 Ga0207427_100075 3300025231 Bacteria 150143
261 Ga0207427_100192 3300025231 Bacteria 60054
262 Ga0207427_100726 3300025231 Bacteria 15338
263 Ga0209437_100020 3300025233 Bacteria 656374
264 Ga0209437_100233 3300025233 Bacteria 93858
265 Ga0209437_100319 3300025233 Bacteria 63021
266 Ga0209437_108345 3300025233 Bacteria 1659
267 Ga0209258_100038 3300025242 Bacteria 398959
268 Ga0209258_100047 3300025242 Bacteria 367869
269 Ga0209258_100144 3300025242 Bacteria 163814
270 Ga0209258_100198 3300025242 Bacteria 124013
271 Ga0209646_1000635 3300025246 Bacteria 13285
272 Ga0209026_1000037 3300025250 Bacteria 282562
273 Ga0209026_1000122 3300025250 Bacteria 126140
274 Ga0209026_1002009 3300025250 Bacteria 8082
275 Ga0209026_1002233 3300025250 Bacteria 7453
276 Ga0209026_1015125 3300025250 Bacteria 1272
277 Ga0209677_101909 3300025253 Bacteria 8404
278 Ga0209148_1000005 3300025254 Bacteria 1806504
279 Ga0209148_1000009 3300025254 Bacteria 1395625
280 Ga0209148_1000024 3300025254 Bacteria 669890
281 Ga0209148_1000054 3300025254 Bacteria 367869
282 Ga0209148_1000141 3300025254 Bacteria 163821
283 Ga0209759_1001003 3300025256 Bacteria 19283
284 Ga0209759_1016179 3300025256 Bacteria 1895
285 Ga0209233_1000020 3300025261 Bacteria 798224
286 Ga0209233_1000210 3300025261 Bacteria 112384
287 Ga0209233_1000307 3300025261 Bacteria 57445
288 Ga0209233_1007835 3300025261 Bacteria 3351
289 Ga0209233_1018318 3300025261 Bacteria 1887
290 Ga0209565_1004382 3300025263 Bacteria 4308
291 Ga0209565_1005259 3300025263 Bacteria 3791
292 Ga0209455_1000025 3300025272 Bacteria 670673
293 Ga0209455_1000032 3300025272 Bacteria 514243
294 Ga0209455_1000052 3300025272 Bacteria 367804
295 Ga0209455_1000254 3300025272 Bacteria 62595
296 Ga0209455_1000578 3300025272 Bacteria 23874
297 Ga0209455_1001868 3300025272 Bacteria 8802
298 Ga0209455_1005922 3300025272 Bacteria 3686
299 Ga0209675_1021153 3300025291 Bacteria 1740
300 Ga0209564_1000063 3300025295 Bacteria 318515
301 Ga0209050_1000302 3300025298 Bacteria 103095
302 Ga0209256_1000598 3300025299 Bacteria 50177
303 Ga0209256_1008260 3300025299 Bacteria 4872
304 Ga0207656_10019453 3300025321 Bacteria 2687
305 Ga0207656_10093976 3300025321 Bacteria 1365
306 Ga0207647_10001035 3300025904 Bacteria 21525
307 Ga0207647_10009739 3300025904 Bacteria 6818
308 Ga0207643_10215496 3300025908 Bacteria 1173
309 Ga0207705_10000108 3300025909 Bacteria 93501
310 Ga0207705_10000691 3300025909 Bacteria 27928
311 Ga0207705_10000958 3300025909 Bacteria 23575
312 Ga0207705_10028893 3300025909 Bacteria 3952
313 Ga0207705_10075706 3300025909 Bacteria 2445
314 Ga0207705_10110815 3300025909 Bacteria 2028
315 Ga0207705_10501371 3300025909 Bacteria 943
316 Ga0207654_10062351 3300025911 Bacteria 2184
317 Ga0207654_10379453 3300025911 Bacteria 979
318 Ga0207707_10000038 3300025912 Bacteria 143359
319 Ga0207707_10000083 3300025912 Bacteria 95462
320 Ga0207707_10000093 3300025912 Bacteria 89975
321 Ga0207707_10000152 3300025912 Bacteria 72592
322 Ga0207707_10000364 3300025912 Bacteria 47458
323 Ga0207707_10000570 3300025912 Bacteria 37419
324 Ga0207707_10000623 3300025912 Bacteria 35185
325 Ga0207707_10000756 3300025912 Bacteria 31825
326 Ga0207707_10036159 3300025912 Bacteria 4318
327 Ga0207707_10047503 3300025912 Bacteria 3738
328 Ga0207707_10089124 3300025912 Bacteria 2696
329 Ga0207707_10455620 3300025912 Bacteria 1094
330 Ga0207707_10758871 3300025912 Bacteria 811
331 Ga0207695_10002920 3300025913 Bacteria 24713
332 Ga0207695_10004333 3300025913 Bacteria 19435
333 Ga0207695_10004847 3300025913 Bacteria 18157
334 Ga0207695_10012886 3300025913 Bacteria 10009
335 Ga0207695_10019482 3300025913 Bacteria 7814
336 Ga0207695_10022277 3300025913 Bacteria 7200
337 Ga0207695_10027439 3300025913 Bacteria 6341
338 Ga0207695_10050732 3300025913 Bacteria 4362
339 Ga0207695_10530770 3300025913 Bacteria 1058
340 Ga0207671_10000329 3300025914 Bacteria 69610
341 Ga0207671_10331663 3300025914 Bacteria 1205
342 Ga0207660_10000103 3300025917 Bacteria 47336
343 Ga0207660_10000305 3300025917 Bacteria 32274
344 Ga0207660_10005291 3300025917 Bacteria 8397
345 Ga0207660_10038317 3300025917 Bacteria 3345
346 Ga0207660_10216966 3300025917 Bacteria 1500
347 Ga0207660_10324419 3300025917 Bacteria 1230
348 Ga0207657_10002228 3300025919 Bacteria 21024
349 Ga0207657_10022253 3300025919 Bacteria 5940
350 Ga0207657_10205299 3300025919 Bacteria 1583
351 Ga0207657_10259894 3300025919 Bacteria 1382
352 Ga0207657_10318583 3300025919 Bacteria 1230
353 Ga0207649_10018692 3300025920 Bacteria 3947
354 Ga0207652_10000038 3300025921 Bacteria 133467
355 Ga0207652_10000129 3300025921 Bacteria 81999
356 Ga0207652_10000257 3300025921 Bacteria 55336
357 Ga0207652_10000910 3300025921 Bacteria 27923
358 Ga0207652_10001066 3300025921 Bacteria 24860
359 Ga0207652_10010611 3300025921 Bacteria 7416
360 Ga0207694_10200223 3300025924 Bacteria 1624
361 Ga0207650_10785564 3300025925 Unclassified 807
362 Ga0207659_10206205 3300025926 Bacteria 1573
363 Ga0207700_10024162 3300025928 Bacteria 4202
364 Ga0207664_10031080 3300025929 Bacteria 4082
365 Ga0207644_10000051 3300025931 Bacteria 93644
366 Ga0207690_10000782 3300025932 Bacteria 20597
367 Ga0207690_10176935 3300025932 Bacteria 1603
368 Ga0207706_10068915 3300025933 Bacteria 3112
369 Ga0207686_10198186 3300025934 Unclassified 1436
370 Ga0207670_10288898 3300025936 Bacteria 1280
371 Ga0207689_10143121 3300025942 Bacteria 1970
372 Ga0207661_10004323 3300025944 Bacteria 9943
373 Ga0207661_10023756 3300025944 Bacteria 4636
374 Ga0207661_10491988 3300025944 Bacteria 1120
375 Ga0207679_10036141 3300025945 Bacteria 3501
376 Ga0207667_10003257 3300025949 Bacteria 20032
377 Ga0207667_10003401 3300025949 Bacteria 19639
378 Ga0207667_10008663 3300025949 Bacteria 12060
379 Ga0207667_10014973 3300025949 Bacteria 8820
380 Ga0207667_10087006 3300025949 Bacteria 3233
381 Ga0207667_10102061 3300025949 Bacteria 2959
382 Ga0207667_10286102 3300025949 Bacteria 1684
383 Ga0207667_10551145 3300025949 Bacteria 1166
384 Ga0207667_10580084 3300025949 Bacteria 1132
385 Ga0207651_10526985 3300025960 Bacteria 1025
386 Ga0207640_10011511 3300025981 Bacteria 5011
387 Ga0207640_10030160 3300025981 Bacteria 3337
388 Ga0207640_10039617 3300025981 Bacteria 2984
389 Ga0207640_10688267 3300025981 Bacteria 875
390 Ga0207658_10626975 3300025986 Bacteria 968
391 Ga0207677_10416801 3300026023 Bacteria 1143
392 Ga0207677_10734045 3300026023 Bacteria 879
393 Ga0207639_10000833 3300026041 Bacteria 20934
394 Ga0207639_10020629 3300026041 Bacteria 4719
395 Ga0207639_10875481 3300026041 Bacteria 839
396 Ga0207678_10001110 3300026067 Bacteria 24666
397 Ga0207678_10001566 3300026067 Bacteria 21024
398 Ga0207678_10002045 3300026067 Bacteria 18296
399 Ga0207678_10003732 3300026067 Bacteria 13700
400 Ga0207678_10129621 3300026067 Bacteria 2151
401 Ga0207678_10242320 3300026067 Bacteria 1544
402 Ga0207678_10623389 3300026067 Bacteria 946
403 Ga0207702_10000321 3300026078 Bacteria 54950
404 Ga0207702_10000719 3300026078 Bacteria 35517
405 Ga0207702_10001824 3300026078 Bacteria 20968
406 Ga0207702_10004954 3300026078 Bacteria 11696
407 Ga0207702_10005157 3300026078 Bacteria 11494
408 Ga0207702_10007550 3300026078 Bacteria 9270
409 Ga0207674_10002170 3300026116 Bacteria 24823
410 Ga0207674_10158725 3300026116 Bacteria 2216
411 Ga0207674_10683614 3300026116 Bacteria 991
412 Ga0207674_10722703 3300026116 Bacteria 961
413 Ga0207675_100012631 3300026118 Bacteria 7891
414 Ga0207675_100090127 3300026118 Bacteria 2883
415 Ga0207698_10000707 3300026142 Bacteria 19332
416 Ga0207698_10001030 3300026142 Bacteria 16218
417 Ga0207698_10028714 3300026142 Bacteria 3971
418 Ga0207428_10027363 3300027907 Bacteria 4748
419 Ga0207428_10083036 3300027907 Bacteria 2499
420 Ga0207428_10418728 3300027907 Bacteria 979
421 Ga0265354_1000854 3300028016 Bacteria 4900
422 Ga0265356_1000224 3300028017 Bacteria 10699
423 Ga0265357_1001226 3300028023 Bacteria 1819
424 Ga0268266_10072079 3300028379 Bacteria 2994
425 Ga0268266_10230184 3300028379 Unclassified 1707
426 Ga0268266_10265369 3300028379 Bacteria 1592
427 Ga0268266_10566867 3300028379 Bacteria 1089
428 Ga0265338_10163919 3300028800 Unclassified 1713
429 Ga0265762_1028060 3300030760 Bacteria 1059
430 Ga0265767_107275 3300030836 Bacteria 702
431 Ga0265765_1001619 3300030879 Bacteria 2093
432 Ga0265760_10000065 3300031090 Bacteria 28698
433 Ga0265332_10010603 3300031238 Bacteria 4101
434 Ga0265340_10011459 3300031247 Bacteria 4710
435 Ga0265316_10089351 3300031344 Bacteria 2351
436 Ga0307513_10040123 3300031456 Bacteria 5179
437 Ga0307509_10000051 3300031507 Bacteria 165037
438 Ga0307408_100000272 3300031548 Bacteria 51943
439 Ga0307508_10247391 3300031616 Unclassified 1380
440 Ga0307508_10343965 3300031616 Unclassified 1083
441 Ga0307413_10106454 3300031824 Bacteria 1867
442 Ga0307416_100593849 3300032002 Bacteria 1186
443 Ga0373936_0022104 3300035113 Unclassified 2477
444 Ga0373946_0091151 3300035171 Unclassified 1351
445 Ga0373931_0221258 3300035691 Bacteria 1140
446 Ga0373931_0632242 3300035691 Bacteria 702
447 Ga0373927_0012577 3300035695 Bacteria 5633
448 Ga0373937_0023954 3300036401 Bacteria 5503
449 Ga0373925_0387398 3300037068 Unclassified 1139
450 Ga0395899_0001216 3300037312 Bacteria 22577
451 Ga0395899_0005509 3300037312 Bacteria 9806
452 Ga0395899_0025605 3300037312 Bacteria 4452
453 Ga0395899_0214774 3300037312 Bacteria 1335
454 Ga0395900_0000039 3300037418 Bacteria 248722
455 Ga0395900_0000092 3300037418 Bacteria 166966
456 Ga0395900_0010266 3300037418 Bacteria 9577
457 Ga0395900_0045052 3300037418 Bacteria 4543
458 Ga0395900_0701582 3300037418 Bacteria 945
459 Ga0395898_0000069 3300037466 Bacteria 254587
460 Ga0395898_0002344 3300037466 Bacteria 22585
461 Ga0395898_0055944 3300037466 Bacteria 3847
462 Ga0395898_0324121 3300037466 Bacteria 1469
463 Ga0395898_0488521 3300037466 Bacteria 1171
464 Ga0395905_0004097 3300037471 Bacteria 15271
465 Ga0395901_0062401 3300038443 Bacteria 3878
466 Ga0436365_0079353 3300039437 Bacteria 1466
467 Ga0439460_0144588 3300042461 Bacteria 790
468 Ga0466969_0011485 3300044656 Bacteria 4689
469 Ga0466965_0058370 3300044683 Bacteria 1924
470 Ga0466966_0026372 3300044684 Bacteria 3794
471 Ga0466966_0026801 3300044684 Bacteria 3761
472 Ga0466966_0038348 3300044684 Bacteria 3088
473 Ga0466966_0341596 3300044684 Bacteria 899
474 Ga0466961_0000786 3300044693 Bacteria 19897
475 Ga0453684_0001752 3300044712 Bacteria 58035
476 Ga0466971_0076220 3300044719 Bacteria 1526
477 Ga0466970_0189475 3300044765 Bacteria 1142
478 Ga0466957_0004813 3300044842 Bacteria 7554
479 Ga0466957_0011179 3300044842 Bacteria 5170
480 Ga0466959_0028347 3300045049 Bacteria 4152
481 Ga0466959_0049660 3300045049 Bacteria 3082
482 Ga0495592_0120085 3300046454 Bacteria 1850
483 Ga0495590_0000011 3300046457 Bacteria 307470
484 Ga0495590_0001390 3300046457 Bacteria 10499
485 Ga0495638_0000009 3300046460 Bacteria 525345
486 Ga0495638_0000058 3300046460 Bacteria 192656
487 Ga0495638_0002184 3300046460 Bacteria 16368
488 Ga0495638_0114762 3300046460 Bacteria 1597
489 Ga0495651_0000630 3300046462 Bacteria 27291
490 Ga0495651_0004832 3300046462 Bacteria 10310
491 Ga0495653_0140862 3300046463 Bacteria 1696
492 Ga0495653_0421611 3300046463 Bacteria 844
493 Ga0495650_0006156 3300046471 Bacteria 7548
494 Ga0495650_0007960 3300046471 Bacteria 6276
495 Ga0495580_0001881 3300046472 Bacteria 18480
496 Ga0495639_0021950 3300046475 Bacteria 2797
497 Ga0495664_0165245 3300046477 Unclassified 1343
498 Ga0495607_0008251 3300046501 Bacteria 7125
499 Ga0495583_0000751 3300046506 Bacteria 41181
500 Ga0495606_0000159 3300046507 Bacteria 118613
501 Ga0495606_0001241 3300046507 Bacteria 35622
502 Ga0495608_0005627 3300046511 Bacteria 8950
503 Ga0495608_0326274 3300046511 Bacteria 948
504 Ga0495628_0202208 3300046516 Unclassified 1496
505 Ga0495643_0000230 3300046522 Bacteria 84299
506 Ga0495648_0000082 3300046524 Bacteria 123682
507 Ga0495642_0052796 3300046528 Bacteria 1674
508 Ga0495652_0006771 3300046529 Bacteria 10626
509 Ga0495665_0000070 3300046531 Bacteria 43160
510 Ga0495586_0000987 3300046535 Bacteria 16100
511 Ga0495609_0256418 3300046538 Bacteria 719
512 Ga0495597_0000341 3300046542 Bacteria 41785
513 Ga0495597_0000445 3300046542 Bacteria 35362
514 Ga0495645_0129100 3300046543 Bacteria 1773
515 Ga0495633_0000459 3300046558 Bacteria 41806
516 Ga0495667_0005391 3300046559 Bacteria 8649
517 Ga0495667_0079486 3300046559 Unclassified 2132
518 Ga0495668_0000266 3300046616 Bacteria 73736
519 Ga0495625_0000843 3300046660 Bacteria 41880
520 Ga0495625_0007337 3300046660 Bacteria 9626
521 Ga0495625_0017403 3300046660 Bacteria 5628
522 Ga0495625_0086651 3300046660 Bacteria 2172
523 Ga0495588_0135606 3300046674 Bacteria 1299
524 Ga0495623_0050103 3300046679 Bacteria 2645
525 Ga0495613_0043925 3300046689 Bacteria 3307
526 Ga0495624_0007031 3300046690 Bacteria 7933
527 Ga0495649_0011222 3300046694 Bacteria 5265
528 Ga0495649_0070388 3300046694 Bacteria 1876
529 Ga0495600_0028367 3300046809 Bacteria 3621
530 Ga0495600_0164409 3300046809 Unclassified 1434
531 Ga0495660_0004534 3300046810 Bacteria 8396
532 Ga0495660_0029168 3300046810 Bacteria 3115
533 Ga0495604_0015192 3300047317 Bacteria 6146
534 Ga0495680_0000614 3300047322 Bacteria 40108
535 Ga0495687_000317 3300047443 Bacteria 62824
536 Ga0495675_0035586 3300047444 Bacteria 3179
537 Ga0495675_0168397 3300047444 Unclassified 1346
538 Ga0495684_0030781 3300047471 Bacteria 4120
539 Ga0495686_0083076 3300047472 Bacteria 1954
540 Ga0495686_0237302 3300047472 Bacteria 1030
541 Ga0495686_0573887 3300047472 Bacteria 587
542 Ga0495593_0120460 3300047673 Bacteria 1335
543 Ga0495602_0042012 3300048088 Bacteria 4168
544 Ga0495614_0001946 3300048089 Bacteria 9067
545 Ga0496110_0390773 3300048913 Bacteria 1268
546 Ga0496114_0785062 3300048917 Bacteria 831
547 Ga0496115_0000013 3300048918 Bacteria 213060
548 Ga0496115_0002192 3300048918 Bacteria 13995
549 Ga0496118_0289434 3300048921 Unclassified 906
550 Ga0496121_0047112 3300048924 Bacteria 3681
551 Ga0496126_0046377 3300048929 Bacteria 3986
552 Ga0496126_0060909 3300048929 Bacteria 3392
553 Ga0495678_010348 3300049459 Bacteria 4540
554 Ga0501032_0052169 3300049569 Bacteria 2756
555 Ga0501032_0208339 3300049569 Bacteria 1275
556 Ga0501033_0027183 3300049570 Bacteria 4303
557 Ga0501033_0035819 3300049570 Bacteria 3720
558 Ga0501034_0019448 3300049571 Bacteria 6947
559 Ga0501036_0084344 3300049572 Bacteria 2686
560 Ga0501036_0613073 3300049572 Bacteria 902
561 Ga0501037_0028898 3300049573 Bacteria 4096
562 Ga0501037_0617295 3300049573 Bacteria 727
563 Ga0501039_0027391 3300049575 Bacteria 4382
564 Ga0501043_0493962 3300049579 Bacteria 915
565 Ga0501046_0913831 3300049580 Bacteria 612
566 Ga0501047_0005476 3300049581 Bacteria 11948
567 Ga0501047_0055919 3300049581 Bacteria 3815
568 Ga0501048_0082907 3300049582 Bacteria 2261
569 Ga0501069_0001687 3300049585 Bacteria 10984
570 Ga0501069_0004932 3300049585 Bacteria 6922
571 Ga0501069_0077447 3300049585 Bacteria 1870
572 Ga0501070_0029677 3300049586 Bacteria 4583
573 Ga0501070_0059254 3300049586 Bacteria 3174
574 Ga0501070_0061962 3300049586 Bacteria 3098
575 Ga0501070_0116223 3300049586 Bacteria 2209
576 Ga0501070_0204292 3300049586 Bacteria 1622
577 Ga0501070_0329838 3300049586 Bacteria 1240
578 Ga0501070_0663122 3300049586 Bacteria 827
579 Ga0501071_0042894 3300049587 Bacteria 3242
580 Ga0501073_0014628 3300049589 Bacteria 5701
581 Ga0501073_0048509 3300049589 Bacteria 2980
582 Ga0501074_0004621 3300049590 Bacteria 9855
583 Ga0501074_0047977 3300049590 Bacteria 3085
584 Ga0501074_0105274 3300049590 Bacteria 2019
585 Ga0501074_0220560 3300049590 Bacteria 1350
586 Ga0501075_0255333 3300049591 Bacteria 1336
587 Ga0501077_0027216 3300049593 Bacteria 3631
588 Ga0501079_0227269 3300049741 Bacteria 1458
589 Ga0501080_0005199 3300049742 Bacteria 11599
590 Ga0501080_0014472 3300049742 Bacteria 7266
591 Ga0501080_0031960 3300049742 Bacteria 4906
592 Ga0501080_0511586 3300049742 Bacteria 1072
593 Ga0501035_0001381 3300049822 Bacteria 24962
594 Ga0501035_0016328 3300049822 Bacteria 6849
595 Ga0501035_0054175 3300049822 Bacteria 3584
596 Ga0501035_0086364 3300049822 Bacteria 2764
597 Ga0501035_0136804 3300049822 Bacteria 2132
598 Ga0501035_0272483 3300049822 Bacteria 1432
599 Ga0501044_0006414 3300049823 Bacteria 12999
600 Ga0501044_0022620 3300049823 Bacteria 6697
601 Ga0501044_0050896 3300049823 Bacteria 4273
602 Ga0501044_0112192 3300049823 Bacteria 2734
603 Ga0501044_0161093 3300049823 Bacteria 2220
604 Ga0501044_0167515 3300049823 Bacteria 2170
605 Ga0501044_0378156 3300049823 Bacteria 1331
606 Ga0501045_0043345 3300049824 Bacteria 3277
607 nmdc:mga09592_715021_c1 3300050508 Bacteria 852
608 nmdc:mga06r32_12382_c1 3300050510 Bacteria 7695
609 nmdc:mga08y16_117867_c1 3300050511 Unclassified 2763
610 nmdc:mga08y16_289551_c1 3300050511 Bacteria 1689
611 nmdc:mga08y16_79828_c1 3300050511 Bacteria 3410
612 nmdc:mga08y16_81161_c1 3300050511 Bacteria 3381
613 nmdc:mga08y16_90144_c1 3300050511 Bacteria 3196
614 nmdc:mga0rr50_266745_c1 3300050513 Bacteria 1426
615 nmdc:mga0rr50_6155_c1 3300050513 Bacteria 7265
616 nmdc:mga0a205_2164_c1 3300050515 Bacteria 17268
617 nmdc:mga0a205_679366_c1 3300050515 Bacteria 880
618 Ga0500643_012224 3300053087 Unclassified 3083
619 Ga0500646_0173811 3300053090 Unclassified 726
620 Ga0500646_0217295 3300053090 Unclassified 662
621 Ga0500583_0163939 3300053092 Bacteria 1107
622 Ga0500641_0010704 3300053096 Bacteria 3321
623 Ga0500650_0000007 3300053098 Bacteria 108097
624 Ga0500658_0051325 3300053134 Unclassified 1686
625 Ga0500568_0023622 3300053139 Bacteria 2614
626 Ga0500616_0000092 3300053153 Bacteria 183860
627 Ga0500616_0022511 3300053153 Bacteria 3517
628 Ga0500619_000649 3300053154 Bacteria 5921
629 Ga0500622_0001852 3300053156 Bacteria 15996
630 Ga0500622_0006698 3300053156 Bacteria 6639
631 Ga0500622_0064517 3300053156 Bacteria 1862
632 Ga0500637_0000512 3300053178 Bacteria 15102
633 Ga0501084_0056468 3300054114 Bacteria 3285
634 Ga0501082_0001120 3300060353 Bacteria 23668
635 Ga0466962_0186651 3300061719 Bacteria 1011
636 Ga0466962_0201251 3300061719 Bacteria 973

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0001216 Ga0395899_0001216_21142_21828 175
2 3300037418 Ga0395900_0000039 Ga0395900_0000039_63588_64274 175
3 3300037466 Ga0395898_0002344 Ga0395898_0002344_750_1436 175
4 3300025934 Ga0207686_10198186 Ga0207686_101981862 177
5 3300049571 Ga0501034_0019448 Ga0501034_0019448_2302_2889 177
6 3300049823 Ga0501044_0050896 Ga0501044_0050896_623_1210 177
7 3300044684 Ga0466966_0026801 Ga0466966_0026801_1111_1815 178
8 3300044684 Ga0466966_0341596 Ga0466966_0341596_38_724 178
9 3300044719 Ga0466971_0076220 Ga0466971_0076220_47_733 178
10 3300044765 Ga0466970_0189475 Ga0466970_0189475_361_1047 178
11 3300009094 Ga0111539_10050746 Ga0111539_100507463 179
12 3300049572 Ga0501036_0084344 Ga0501036_0084344_1453_2064 179
13 3300049586 Ga0501070_0029677 Ga0501070_0029677_2006_2617 179
14 3300044683 Ga0466965_0058370 Ga0466965_0058370_272_865 180
15 3300046538 Ga0495609_0256418 Ga0495609_0256418_62_604 180
16 3300035691 Ga0373931_0632242 Ga0373931_0632242_76_621 181
17 3300047472 Ga0495686_0573887 Ga0495686_0573887_17_571 182
18 3300049580 Ga0501046_0913831 Ga0501046_0913831_12_560 182
19 3300009094 Ga0111539_10089205 Ga0111539_100892052 183
20 3300050511 nmdc:mga08y16_81161_c1 nmdc:mga08y16_81161_c1_2552_3115 183
21 3300053090 Ga0500646_0173811 Ga0500646_0173811_27_581 184
22 3300049573 Ga0501037_0617295 Ga0501037_0617295_18_578 185
23 3300049824 Ga0501045_0043345 Ga0501045_0043345_2701_3261 185
24 3300009553 Ga0105249_10292920 Ga0105249_102929202 186
25 3300027907 Ga0207428_10083036 Ga0207428_100830362 186
26 3300050511 nmdc:mga08y16_90144_c1 nmdc:mga08y16_90144_c1_268_882 186
27 iso_pu_bacteria 639633007 639787498 186
28 3300003752 Ga0055539_1006297 Ga0055539_10062971 188
29 3300003756 Ga0055533_1004470 Ga0055533_10044701 188
30 3300005614 Ga0068856_100140570 Ga0068856_1001405702 188
31 3300025226 Ga0209674_100026 Ga0209674_100026187 188
32 3300025226 Ga0209674_100416 Ga0209674_10041615 188
33 3300025253 Ga0209677_101909 Ga0209677_1019091 188
34 3300026078 Ga0207702_10007550 Ga0207702_100075508 188
35 3300044684 Ga0466966_0038348 Ga0466966_0038348_2132_2698 188
36 3300003316 rootH1_10164261 rootH1_101642612 189
37 3300003760 Ga0055527_1000128 Ga0055527_100012847 189
38 3300003761 Ga0055535_1000287 Ga0055535_10002871 189
39 3300003762 Ga0055542_1000311 Ga0055542_10003111 189
40 3300003763 Ga0055529_1000329 Ga0055529_100032947 189
41 3300003771 Ga0055526_1002471 Ga0055526_10024713 189
42 3300003773 Ga0055537_1003943 Ga0055537_10039434 189
43 3300003775 Ga0055524_1002272 Ga0055524_10022726 189
44 3300003791 Ga0055530_10000186 Ga0055530_1000018632 189
45 3300005262 Ga0065165_1072998 Ga0065165_10729982 189
46 3300025228 Ga0209672_100017 Ga0209672_100017266 189
47 3300025242 Ga0209258_100038 Ga0209258_10003846 189
48 3300025254 Ga0209148_1000009 Ga0209148_1000009946 189
49 3300025263 Ga0209565_1004382 Ga0209565_10043824 189
50 3300025263 Ga0209565_1005259 Ga0209565_10052592 189
51 3300025272 Ga0209455_1000032 Ga0209455_1000032266 189
52 3300025291 Ga0209675_1021153 Ga0209675_10211532 189
53 3300025295 Ga0209564_1000063 Ga0209564_1000063209 189
54 3300025298 Ga0209050_1000302 Ga0209050_100030227 189
55 3300025299 Ga0209256_1000598 Ga0209256_100059823 189
56 3300025299 Ga0209256_1008260 Ga0209256_10082602 189
57 3300031548 Ga0307408_100000272 Ga0307408_10000027231 189
58 iso_pu_bacteria 2842711865 2842715118 189
59 3300007076 Ga0075435_100289600 Ga0075435_1002896003 190
60 3300028379 Ga0268266_10230184 Ga0268266_102301843 190
61 3300031824 Ga0307413_10106454 Ga0307413_101064542 190
62 3300032002 Ga0307416_100593849 Ga0307416_1005938492 190
63 3300050513 nmdc:mga0rr50_266745_c1 nmdc:mga0rr50_266745_c1_774_1355 190
64 3300003320 rootH2_10161275 rootH2_101612755 191
65 3300003323 rootH1_10003926 rootH1_1000392634 191
66 3300005334 Ga0068869_100281763 Ga0068869_1002817632 191
67 3300005338 Ga0068868_100235765 Ga0068868_1002357652 191
68 3300005355 Ga0070671_100000028 Ga0070671_10000002877 191
69 3300005458 Ga0070681_10144414 Ga0070681_101444143 191
70 3300005548 Ga0070665_100023152 Ga0070665_1000231525 191
71 3300005577 Ga0068857_100910235 Ga0068857_1009102352 191
72 3300005841 Ga0068863_100658668 Ga0068863_1006586682 191
73 3300005843 Ga0068860_101133017 Ga0068860_1011330172 191
74 3300011119 Ga0105246_10013007 Ga0105246_100130073 191
75 3300013308 Ga0157375_10702884 Ga0157375_107028841 191
76 3300017792 Ga0163161_10343346 Ga0163161_103433461 191
77 3300025912 Ga0207707_10758871 Ga0207707_107588711 191
78 3300025931 Ga0207644_10000051 Ga0207644_1000005121 191
79 3300025986 Ga0207658_10626975 Ga0207658_106269752 191
80 3300026023 Ga0207677_10416801 Ga0207677_104168012 191
81 3300026023 Ga0207677_10734045 Ga0207677_107340451 191
82 3300028379 Ga0268266_10072079 Ga0268266_100720793 191
83 3300028379 Ga0268266_10566867 Ga0268266_105668672 191
84 3300044712 Ga0453684_0001752 Ga0453684_0001752_28949_29536 191
85 3300047472 Ga0495686_0237302 Ga0495686_0237302_375_956 191
86 3300048913 Ga0496110_0390773 Ga0496110_0390773_564_1139 191
87 3300048917 Ga0496114_0785062 Ga0496114_0785062_16_591 191
88 3300053092 Ga0500583_0163939 Ga0500583_0163939_254_829 191
89 3300053096 Ga0500641_0010704 Ga0500641_0010704_1185_1841 191
90 3300053139 Ga0500568_0023622 Ga0500568_0023622_1362_1985 191
91 3300053153 Ga0500616_0022511 Ga0500616_0022511_558_1220 191
92 3300053156 Ga0500622_0001852 Ga0500622_0001852_14728_15315 191
93 3300053156 Ga0500622_0006698 Ga0500622_0006698_5972_6595 191
94 3300004803 Ga0058862_12867910 Ga0058862_128679102 192
95 3300005327 Ga0070658_11049881 Ga0070658_110498811 192
96 3300005329 Ga0070683_100207281 Ga0070683_1002072813 192
97 3300005336 Ga0070680_100050413 Ga0070680_1000504134 192
98 3300005336 Ga0070680_100553016 Ga0070680_1005530161 192
99 3300005337 Ga0070682_100330824 Ga0070682_1003308242 192
100 3300005344 Ga0070661_100233898 Ga0070661_1002338982 192
101 3300005458 Ga0070681_10017005 Ga0070681_100170056 192
102 3300005458 Ga0070681_10051051 Ga0070681_100510514 192
103 3300005530 Ga0070679_100008496 Ga0070679_1000084966 192
104 3300005539 Ga0068853_100446716 Ga0068853_1004467161 192
105 3300005563 Ga0068855_100000261 Ga0068855_10000026110 192
106 3300005563 Ga0068855_100099202 Ga0068855_1000992024 192
107 3300005577 Ga0068857_100880756 Ga0068857_1008807561 192
108 3300009093 Ga0105240_10003386 Ga0105240_100033866 192
109 3300009093 Ga0105240_10067254 Ga0105240_100672545 192
110 3300009093 Ga0105240_10240929 Ga0105240_102409293 192
111 3300009093 Ga0105240_11073758 Ga0105240_110737581 192
112 3300009545 Ga0105237_10095262 Ga0105237_100952624 192
113 3300009551 Ga0105238_10004866 Ga0105238_100048666 192
114 3300013104 Ga0157370_10002285 Ga0157370_1000228515 192
115 3300013105 Ga0157369_10017028 Ga0157369_100170285 192
116 3300013105 Ga0157369_10532822 Ga0157369_105328222 192
117 3300013307 Ga0157372_10274693 Ga0157372_102746933 192
118 3300020069 Ga0197907_11156994 Ga0197907_111569942 192
119 3300020070 Ga0206356_10573590 Ga0206356_105735901 192
120 3300020070 Ga0206356_11734160 Ga0206356_117341602 192
121 3300020075 Ga0206349_1969738 Ga0206349_19697381 192
122 3300020078 Ga0206352_10635024 Ga0206352_106350241 192
123 3300020081 Ga0206354_11327790 Ga0206354_113277902 192
124 3300025912 Ga0207707_10000038 Ga0207707_10000038103 192
125 3300025912 Ga0207707_10047503 Ga0207707_100475033 192
126 3300025913 Ga0207695_10019482 Ga0207695_100194825 192
127 3300025913 Ga0207695_10050732 Ga0207695_100507322 192
128 3300025913 Ga0207695_10530770 Ga0207695_105307702 192
129 3300025917 Ga0207660_10038317 Ga0207660_100383173 192
130 3300025921 Ga0207652_10001066 Ga0207652_100010664 192
131 3300025949 Ga0207667_10014973 Ga0207667_100149738 192
132 3300025949 Ga0207667_10286102 Ga0207667_102861023 192
133 3300026041 Ga0207639_10875481 Ga0207639_108754812 192
134 3300026116 Ga0207674_10722703 Ga0207674_107227032 192
135 3300030836 Ga0265767_107275 Ga0265767_1072751 192
136 3300031456 Ga0307513_10040123 Ga0307513_100401233 192
137 3300035113 Ga0373936_0022104 Ga0373936_0022104_1450_2028 192
138 3300044842 Ga0466957_0011179 Ga0466957_0011179_2818_3435 192
139 3300045049 Ga0466959_0049660 Ga0466959_0049660_850_1467 192
140 3300046471 Ga0495650_0007960 Ga0495650_0007960_2053_2631 192
141 3300053087 Ga0500643_012224 Ga0500643_012224_288_866 192
142 3300053090 Ga0500646_0217295 Ga0500646_0217295_17_610 192
143 3300053098 Ga0500650_0000007 Ga0500650_0000007_45380_45958 192
144 3300053134 Ga0500658_0051325 Ga0500658_0051325_420_1013 192
145 3300053156 Ga0500622_0064517 Ga0500622_0064517_1174_1767 192
146 3300053178 Ga0500637_0000512 Ga0500637_0000512_9235_9813 192
147 3300061719 Ga0466962_0201251 Ga0466962_0201251_87_704 192
148 3300004800 Ga0058861_12029677 Ga0058861_120296772 193
149 3300004803 Ga0058862_12525583 Ga0058862_125255831 193
150 3300005327 Ga0070658_10000153 Ga0070658_100001534 193
151 3300005334 Ga0068869_100157447 Ga0068869_1001574472 193
152 3300005345 Ga0070692_10150641 Ga0070692_101506411 193
153 3300005367 Ga0070667_100427369 Ga0070667_1004273691 193
154 3300005438 Ga0070701_10012388 Ga0070701_100123884 193
155 3300005548 Ga0070665_100413603 Ga0070665_1004136032 193
156 3300005549 Ga0070704_100046602 Ga0070704_1000466023 193
157 3300005563 Ga0068855_100017553 Ga0068855_1000175532 193
158 3300005563 Ga0068855_100025560 Ga0068855_1000255602 193
159 3300005617 Ga0068859_100231889 Ga0068859_1002318892 193
160 3300006844 Ga0075428_100011828 Ga0075428_1000118282 193
161 3300006880 Ga0075429_100149809 Ga0075429_1001498092 193
162 3300006931 Ga0097620_100231889 Ga0097620_1002318892 193
163 3300009093 Ga0105240_10001826 Ga0105240_1000182611 193
164 3300009094 Ga0111539_10029448 Ga0111539_100294489 193
165 3300009094 Ga0111539_10781657 Ga0111539_107816571 193
166 3300009148 Ga0105243_10045383 Ga0105243_100453833 193
167 3300009174 Ga0105241_10502716 Ga0105241_105027161 193
168 3300009551 Ga0105238_10354488 Ga0105238_103544882 193
169 3300010375 Ga0105239_10512584 Ga0105239_105125841 193
170 3300014326 Ga0157380_10066614 Ga0157380_100666142 193
171 3300020070 Ga0206356_11526086 Ga0206356_115260862 193
172 3300025908 Ga0207643_10215496 Ga0207643_102154962 193
173 3300025909 Ga0207705_10000108 Ga0207705_10000108109 193
174 3300025913 Ga0207695_10027439 Ga0207695_100274392 193
175 3300025942 Ga0207689_10143121 Ga0207689_101431212 193
176 3300025949 Ga0207667_10008663 Ga0207667_100086639 193
177 3300025949 Ga0207667_10580084 Ga0207667_105800842 193
178 3300026116 Ga0207674_10683614 Ga0207674_106836142 193
179 3300026118 Ga0207675_100012631 Ga0207675_1000126314 193
180 3300027907 Ga0207428_10027363 Ga0207428_100273632 193
181 3300028016 Ga0265354_1000854 Ga0265354_10008544 193
182 3300028017 Ga0265356_1000224 Ga0265356_10002246 193
183 3300028023 Ga0265357_1001226 Ga0265357_10012263 193
184 3300028379 Ga0268266_10265369 Ga0268266_102653692 193
185 3300028800 Ga0265338_10163919 Ga0265338_101639192 193
186 3300030760 Ga0265762_1028060 Ga0265762_10280601 193
187 3300030879 Ga0265765_1001619 Ga0265765_10016192 193
188 3300031090 Ga0265760_10000065 Ga0265760_1000006513 193
189 3300031238 Ga0265332_10010603 Ga0265332_100106033 193
190 3300031247 Ga0265340_10011459 Ga0265340_100114593 193
191 3300031507 Ga0307509_10000051 Ga0307509_1000005150 193
192 3300031616 Ga0307508_10247391 Ga0307508_102473913 193
193 3300031616 Ga0307508_10343965 Ga0307508_103439651 193
194 3300035691 Ga0373931_0221258 Ga0373931_0221258_415_996 193
195 3300037471 Ga0395905_0004097 Ga0395905_0004097_2231_2830 193
196 3300039437 Ga0436365_0079353 Ga0436365_0079353_54_659 193
197 3300044656 Ga0466969_0011485 Ga0466969_0011485_3558_4157 193
198 3300044684 Ga0466966_0026372 Ga0466966_0026372_855_1454 193
199 3300046457 Ga0495590_0001390 Ga0495590_0001390_4245_4844 193
200 3300046460 Ga0495638_0114762 Ga0495638_0114762_850_1431 193
201 3300046542 Ga0495597_0000445 Ga0495597_0000445_29345_29926 193
202 3300046660 Ga0495625_0007337 Ga0495625_0007337_5003_5584 193
203 3300046810 Ga0495660_0029168 Ga0495660_0029168_480_1079 193
204 3300047472 Ga0495686_0083076 Ga0495686_0083076_120_722 193
205 3300049591 Ga0501075_0255333 Ga0501075_0255333_554_1138 193
206 3300050508 nmdc:mga09592_715021_c1 nmdc:mga09592_715021_c1_128_709 193
207 3300050511 nmdc:mga08y16_117867_c1 nmdc:mga08y16_117867_c1_1570_2154 193
208 3300050511 nmdc:mga08y16_289551_c1 nmdc:mga08y16_289551_c1_795_1376 193
209 3300050515 nmdc:mga0a205_679366_c1 nmdc:mga0a205_679366_c1_179_760 193
210 3300053153 Ga0500616_0000092 Ga0500616_0000092_165585_166172 193
211 3300061719 Ga0466962_0186651 Ga0466962_0186651_246_848 193
212 3300005295 Ga0065707_10082740 Ga0065707_1008274012 194
213 3300005719 Ga0068861_100314740 Ga0068861_1003147403 194
214 3300006195 Ga0075366_10118877 Ga0075366_101188773 194
215 3300013306 Ga0163162_10804410 Ga0163162_108044102 194
216 3300014326 Ga0157380_10000816 Ga0157380_100008167 194
217 3300025960 Ga0207651_10526985 Ga0207651_105269851 194
218 3300026118 Ga0207675_100090127 Ga0207675_1000901273 194
219 3300031344 Ga0265316_10089351 Ga0265316_100893512 194
220 3300046457 Ga0495590_0000011 Ga0495590_0000011_33164_33754 194
221 3300046460 Ga0495638_0000058 Ga0495638_0000058_159123_159713 194
222 3300046460 Ga0495638_0002184 Ga0495638_0002184_3190_3780 194
223 3300046471 Ga0495650_0006156 Ga0495650_0006156_2687_3277 194
224 3300046475 Ga0495639_0021950 Ga0495639_0021950_251_841 194
225 3300046501 Ga0495607_0008251 Ga0495607_0008251_2798_3388 194
226 3300046506 Ga0495583_0000751 Ga0495583_0000751_23411_24001 194
227 3300046507 Ga0495606_0001241 Ga0495606_0001241_6109_6699 194
228 3300046522 Ga0495643_0000230 Ga0495643_0000230_59082_59672 194
229 3300046524 Ga0495648_0000082 Ga0495648_0000082_90824_91414 194
230 3300046528 Ga0495642_0052796 Ga0495642_0052796_1000_1590 194
231 3300046542 Ga0495597_0000341 Ga0495597_0000341_17907_18497 194
232 3300046558 Ga0495633_0000459 Ga0495633_0000459_20633_21223 194
233 3300046616 Ga0495668_0000266 Ga0495668_0000266_40921_41511 194
234 3300046660 Ga0495625_0000843 Ga0495625_0000843_22825_23415 194
235 3300046660 Ga0495625_0017403 Ga0495625_0017403_4753_5343 194
236 3300046694 Ga0495649_0070388 Ga0495649_0070388_1031_1621 194
237 3300046810 Ga0495660_0004534 Ga0495660_0004534_3331_3921 194
238 3300047443 Ga0495687_000317 Ga0495687_000317_19251_19841 194
239 3300048921 Ga0496118_0289434 Ga0496118_0289434_38_628 194
240 3300048924 Ga0496121_0047112 Ga0496121_0047112_2434_3024 194
241 3300049459 Ga0495678_010348 Ga0495678_010348_222_812 194
242 3300053154 Ga0500619_000649 Ga0500619_000649_2712_3308 194
243 3300035171 Ga0373946_0091151 Ga0373946_0091151_368_1000 195
244 3300035695 Ga0373927_0012577 Ga0373927_0012577_4913_5545 195
245 3300036401 Ga0373937_0023954 Ga0373937_0023954_277_909 195
246 3300037068 Ga0373925_0387398 Ga0373925_0387398_379_1011 195
247 3300046454 Ga0495592_0120085 Ga0495592_0120085_593_1225 195
248 3300046462 Ga0495651_0000630 Ga0495651_0000630_7359_7967 195
249 3300046462 Ga0495651_0004832 Ga0495651_0004832_9399_10031 195
250 3300046463 Ga0495653_0140862 Ga0495653_0140862_709_1341 195
251 3300046463 Ga0495653_0421611 Ga0495653_0421611_88_696 195
252 3300046472 Ga0495580_0001881 Ga0495580_0001881_7476_8108 195
253 3300046477 Ga0495664_0165245 Ga0495664_0165245_277_909 195
254 3300046511 Ga0495608_0005627 Ga0495608_0005627_3068_3700 195
255 3300046511 Ga0495608_0326274 Ga0495608_0326274_46_654 195
256 3300046516 Ga0495628_0202208 Ga0495628_0202208_361_993 195
257 3300046529 Ga0495652_0006771 Ga0495652_0006771_9320_9952 195
258 3300046531 Ga0495665_0000070 Ga0495665_0000070_12299_12931 195
259 3300046535 Ga0495586_0000987 Ga0495586_0000987_15114_15746 195
260 3300046543 Ga0495645_0129100 Ga0495645_0129100_813_1421 195
261 3300046559 Ga0495667_0005391 Ga0495667_0005391_3644_4252 195
262 3300046559 Ga0495667_0079486 Ga0495667_0079486_215_847 195
263 3300046679 Ga0495623_0050103 Ga0495623_0050103_300_932 195
264 3300046689 Ga0495613_0043925 Ga0495613_0043925_1076_1708 195
265 3300046690 Ga0495624_0007031 Ga0495624_0007031_6465_7097 195
266 3300046809 Ga0495600_0028367 Ga0495600_0028367_2182_2790 195
267 3300046809 Ga0495600_0164409 Ga0495600_0164409_396_1028 195
268 3300047317 Ga0495604_0015192 Ga0495604_0015192_4678_5310 195
269 3300047322 Ga0495680_0000614 Ga0495680_0000614_19326_19934 195
270 3300047444 Ga0495675_0035586 Ga0495675_0035586_1970_2578 195
271 3300047444 Ga0495675_0168397 Ga0495675_0168397_397_1029 195
272 3300047471 Ga0495684_0030781 Ga0495684_0030781_362_994 195
273 3300047673 Ga0495593_0120460 Ga0495593_0120460_112_744 195
274 3300048088 Ga0495602_0042012 Ga0495602_0042012_2910_3542 195
275 3300048089 Ga0495614_0001946 Ga0495614_0001946_112_744 195
276 3300004799 Ga0058863_11435829 Ga0058863_114358291 196
277 3300006844 Ga0075428_100139703 Ga0075428_1001397033 196
278 3300025912 Ga0207707_10089124 Ga0207707_100891241 196
279 3300025921 Ga0207652_10010611 Ga0207652_100106115 196
280 3300005354 Ga0070675_100327556 Ga0070675_1003275562 197
281 3300006931 Ga0097620_100731721 Ga0097620_1007317211 197
282 3300009545 Ga0105237_10000183 Ga0105237_1000018371 197
283 3300013307 Ga0157372_11108245 Ga0157372_111082451 197
284 3300017792 Ga0163161_10082665 Ga0163161_100826653 197
285 3300025936 Ga0207670_10288898 Ga0207670_102888982 197
286 3300027907 Ga0207428_10418728 Ga0207428_104187281 197
287 3300050513 nmdc:mga0rr50_6155_c1 nmdc:mga0rr50_6155_c1_985_1599 197
288 3300050515 nmdc:mga0a205_2164_c1 nmdc:mga0a205_2164_c1_7109_7723 197
289 3300005354 Ga0070675_100468002 Ga0070675_1004680021 198
290 3300005546 Ga0070696_100254122 Ga0070696_1002541222 198
291 3300005563 Ga0068855_100704758 Ga0068855_1007047582 198
292 3300006847 Ga0075431_100017829 Ga0075431_1000178292 198
293 3300006852 Ga0075433_10275185 Ga0075433_102751853 198
294 3300009094 Ga0111539_10129594 Ga0111539_101295942 198
295 3300009147 Ga0114129_10770809 Ga0114129_107708092 198
296 3300009176 Ga0105242_11673288 Ga0105242_116732881 198
297 3300013296 Ga0157374_10005513 Ga0157374_100055136 198
298 3300013297 Ga0157378_10227978 Ga0157378_102279783 198
299 3300013297 Ga0157378_10720815 Ga0157378_107208151 198
300 3300025925 Ga0207650_10785564 Ga0207650_107855641 198
301 3300025926 Ga0207659_10206205 Ga0207659_102062052 198
302 3300042461 Ga0439460_0144588 Ga0439460_0144588_63_662 198
303 3300049741 Ga0501079_0227269 Ga0501079_0227269_418_1068 198
304 3300049742 Ga0501080_0031960 Ga0501080_0031960_1002_1652 198
305 3300050510 nmdc:mga06r32_12382_c1 nmdc:mga06r32_12382_c1_5107_5706 198
306 3300050511 nmdc:mga08y16_79828_c1 nmdc:mga08y16_79828_c1_546_1145 198
307 3300054114 Ga0501084_0056468 Ga0501084_0056468_757_1407 198
308 3300060353 Ga0501082_0001120 Ga0501082_0001120_19497_20147 198
309 iso_pu_bacteria 2884411467 2884413430 198
310 3300044842 Ga0466957_0004813 Ga0466957_0004813_6812_7414 199
311 3300045049 Ga0466959_0028347 Ga0466959_0028347_46_648 199
312 3300049822 Ga0501035_0272483 Ga0501035_0272483_557_1162 199
313 3300002772 JGI25164J39214_1005867 JGI25164J39214_10058672 200
314 3300003762 Ga0055542_1000010 Ga0055542_1000010103 200
315 3300005458 Ga0070681_10000086 Ga0070681_1000008616 200
316 3300005458 Ga0070681_10294759 Ga0070681_102947592 200
317 3300005530 Ga0070679_100021147 Ga0070679_1000211475 200
318 3300009551 Ga0105238_10190079 Ga0105238_101900792 200
319 3300013104 Ga0157370_10029604 Ga0157370_100296042 200
320 3300020078 Ga0206352_10607276 Ga0206352_106072761 200
321 3300025228 Ga0209672_101419 Ga0209672_1014194 200
322 3300025231 Ga0207427_100726 Ga0207427_1007265 200
323 3300025233 Ga0209437_100233 Ga0209437_10023325 200
324 3300025250 Ga0209026_1002233 Ga0209026_10022332 200
325 3300025254 Ga0209148_1000005 Ga0209148_1000005242 200
326 3300025261 Ga0209233_1018318 Ga0209233_10183182 200
327 3300025272 Ga0209455_1000254 Ga0209455_100025448 200
328 3300025272 Ga0209455_1005922 Ga0209455_10059223 200
329 3300025912 Ga0207707_10000364 Ga0207707_1000036433 200
330 3300025913 Ga0207695_10004333 Ga0207695_1000433311 200
331 3300025949 Ga0207667_10087006 Ga0207667_100870063 200
332 3300025981 Ga0207640_10030160 Ga0207640_100301603 200
333 3300026067 Ga0207678_10003732 Ga0207678_100037322 200
334 3300026067 Ga0207678_10623389 Ga0207678_106233892 200
335 3300046460 Ga0495638_0000009 Ga0495638_0000009_155043_155645 200
336 3300046507 Ga0495606_0000159 Ga0495606_0000159_28458_29060 200
337 3300046660 Ga0495625_0086651 Ga0495625_0086651_1499_2101 200
338 3300046694 Ga0495649_0011222 Ga0495649_0011222_2959_3561 200
339 3300048918 Ga0496115_0000013 Ga0496115_0000013_3899_4501 200
340 3300048918 Ga0496115_0002192 Ga0496115_0002192_10891_11493 200
341 3300048929 Ga0496126_0046377 Ga0496126_0046377_1518_2120 200
342 3300048929 Ga0496126_0060909 Ga0496126_0060909_1873_2475 200
343 3300005327 Ga0070658_10285021 Ga0070658_102850212 201
344 3300005336 Ga0070680_100322897 Ga0070680_1003228971 201
345 3300005458 Ga0070681_10187187 Ga0070681_101871872 201
346 3300005546 Ga0070696_100063698 Ga0070696_1000636982 201
347 3300013100 Ga0157373_10034377 Ga0157373_100343772 201
348 3300013104 Ga0157370_10057856 Ga0157370_100578563 201
349 3300013307 Ga0157372_10074492 Ga0157372_100744923 201
350 3300025909 Ga0207705_10075706 Ga0207705_100757062 201
351 3300025912 Ga0207707_10455620 Ga0207707_104556201 201
352 3300025917 Ga0207660_10324419 Ga0207660_103244191 201
353 3300025919 Ga0207657_10259894 Ga0207657_102598941 201
354 3300037418 Ga0395900_0010266 Ga0395900_0010266_7100_7705 201
355 3300049575 Ga0501039_0027391 Ga0501039_0027391_2802_3413 201
356 3300049579 Ga0501043_0493962 Ga0501043_0493962_245_859 201
357 3300049822 Ga0501035_0016328 Ga0501035_0016328_4748_5362 201
358 3300049823 Ga0501044_0022620 Ga0501044_0022620_4116_4730 201
359 3300001915 JGI24741J21665_1000968 JGI24741J21665_10009683 202
360 3300001915 JGI24741J21665_1010185 JGI24741J21665_10101853 202
361 3300001979 JGI24740J21852_10000505 JGI24740J21852_1000050514 202
362 3300001979 JGI24740J21852_10000511 JGI24740J21852_100005117 202
363 3300002737 JGI25162J39368_1001409 JGI25162J39368_100140910 202
364 3300002741 JGI25157J39369_1000543 JGI25157J39369_100054311 202
365 3300002772 JGI25164J39214_1000163 JGI25164J39214_100016335 202
366 3300002772 JGI25164J39214_1000308 JGI25164J39214_100030826 202
367 3300003214 JGI25165J46597_1000326 JGI25165J46597_100032634 202
368 3300003214 JGI25165J46597_1002757 JGI25165J46597_10027572 202
369 3300003759 Ga0055525_1000360 Ga0055525_100036024 202
370 3300003760 Ga0055527_1000267 Ga0055527_100026710 202
371 3300003760 Ga0055527_1000960 Ga0055527_10009604 202
372 3300003761 Ga0055535_1000294 Ga0055535_100029431 202
373 3300003761 Ga0055535_1000614 Ga0055535_100061410 202
374 3300003761 Ga0055535_1000860 Ga0055535_10008605 202
375 3300003762 Ga0055542_1000057 Ga0055542_100005791 202
376 3300003762 Ga0055542_1000101 Ga0055542_10001015 202
377 3300003762 Ga0055542_1000518 Ga0055542_100051823 202
378 3300003763 Ga0055529_1000105 Ga0055529_100010511 202
379 3300003763 Ga0055529_1000755 Ga0055529_100075521 202
380 3300004799 Ga0058863_10059087 Ga0058863_100590872 202
381 3300004800 Ga0058861_10012108 Ga0058861_100121081 202
382 3300004800 Ga0058861_10037249 Ga0058861_100372492 202
383 3300004800 Ga0058861_11678086 Ga0058861_116780861 202
384 3300004803 Ga0058862_10060691 Ga0058862_100606911 202
385 3300004803 Ga0058862_12234460 Ga0058862_122344601 202
386 3300004803 Ga0058862_12545346 Ga0058862_125453461 202
387 3300005329 Ga0070683_100457150 Ga0070683_1004571501 202
388 3300005329 Ga0070683_100477369 Ga0070683_1004773692 202
389 3300005336 Ga0070680_100001865 Ga0070680_1000018654 202
390 3300005336 Ga0070680_100034311 Ga0070680_1000343116 202
391 3300005336 Ga0070680_100062792 Ga0070680_1000627923 202
392 3300005337 Ga0070682_100017773 Ga0070682_1000177733 202
393 3300005337 Ga0070682_100019204 Ga0070682_1000192046 202
394 3300005339 Ga0070660_100786687 Ga0070660_1007866871 202
395 3300005341 Ga0070691_10001099 Ga0070691_1000109911 202
396 3300005341 Ga0070691_10053974 Ga0070691_100539742 202
397 3300005344 Ga0070661_100003367 Ga0070661_1000033673 202
398 3300005344 Ga0070661_100409379 Ga0070661_1004093792 202
399 3300005344 Ga0070661_100593960 Ga0070661_1005939602 202
400 3300005345 Ga0070692_10001540 Ga0070692_100015403 202
401 3300005345 Ga0070692_10016588 Ga0070692_100165885 202
402 3300005345 Ga0070692_10094689 Ga0070692_100946892 202
403 3300005366 Ga0070659_100081620 Ga0070659_1000816203 202
404 3300005435 Ga0070714_100016246 Ga0070714_1000162465 202
405 3300005436 Ga0070713_100032124 Ga0070713_1000321244 202
406 3300005455 Ga0070663_100031066 Ga0070663_1000310665 202
407 3300005455 Ga0070663_100067718 Ga0070663_1000677183 202
408 3300005455 Ga0070663_100332150 Ga0070663_1003321503 202
409 3300005458 Ga0070681_10000230 Ga0070681_1000023020 202
410 3300005458 Ga0070681_10000536 Ga0070681_1000053613 202
411 3300005458 Ga0070681_10006881 Ga0070681_1000688111 202
412 3300005530 Ga0070679_100001047 Ga0070679_10000104710 202
413 3300005530 Ga0070679_100002395 Ga0070679_1000023951 202
414 3300005530 Ga0070679_100015994 Ga0070679_1000159941 202
415 3300005535 Ga0070684_100047927 Ga0070684_1000479272 202
416 3300005539 Ga0068853_100048960 Ga0068853_1000489605 202
417 3300005539 Ga0068853_100882543 Ga0068853_1008825432 202
418 3300005546 Ga0070696_100002360 Ga0070696_1000023606 202
419 3300005546 Ga0070696_100241196 Ga0070696_1002411962 202
420 3300005546 Ga0070696_100266232 Ga0070696_1002662322 202
421 3300005547 Ga0070693_100002470 Ga0070693_1000024702 202
422 3300005563 Ga0068855_100013395 Ga0068855_1000133952 202
423 3300005563 Ga0068855_100017551 Ga0068855_1000175518 202
424 3300005563 Ga0068855_100052298 Ga0068855_1000522983 202
425 3300005564 Ga0070664_100098768 Ga0070664_1000987683 202
426 3300005577 Ga0068857_100271887 Ga0068857_1002718872 202
427 3300005578 Ga0068854_100009840 Ga0068854_1000098401 202
428 3300005578 Ga0068854_100030052 Ga0068854_1000300523 202
429 3300005578 Ga0068854_100289417 Ga0068854_1002894171 202
430 3300005614 Ga0068856_100142659 Ga0068856_1001426594 202
431 3300005616 Ga0068852_100643263 Ga0068852_1006432632 202
432 3300005616 Ga0068852_100730678 Ga0068852_1007306782 202
433 3300005834 Ga0068851_10044717 Ga0068851_100447174 202
434 3300005834 Ga0068851_10248325 Ga0068851_102483251 202
435 3300009093 Ga0105240_10006479 Ga0105240_1000647911 202
436 3300009093 Ga0105240_10284162 Ga0105240_102841623 202
437 3300009093 Ga0105240_10298602 Ga0105240_102986023 202
438 3300009174 Ga0105241_10111543 Ga0105241_101115434 202
439 3300009551 Ga0105238_10007034 Ga0105238_100070346 202
440 3300013100 Ga0157373_10008206 Ga0157373_100082064 202
441 3300013100 Ga0157373_10021463 Ga0157373_100214636 202
442 3300013102 Ga0157371_10096189 Ga0157371_100961893 202
443 3300013104 Ga0157370_10007483 Ga0157370_100074837 202
444 3300013104 Ga0157370_10022245 Ga0157370_100222454 202
445 3300013104 Ga0157370_10145638 Ga0157370_101456382 202
446 3300013105 Ga0157369_10077580 Ga0157369_100775801 202
447 3300013105 Ga0157369_10215605 Ga0157369_102156053 202
448 3300013105 Ga0157369_10757839 Ga0157369_107578391 202
449 3300013307 Ga0157372_10000913 Ga0157372_1000091327 202
450 3300013307 Ga0157372_10004388 Ga0157372_1000438810 202
451 3300013307 Ga0157372_10009662 Ga0157372_100096622 202
452 3300013307 Ga0157372_10831085 Ga0157372_108310852 202
453 3300014497 Ga0182008_10027617 Ga0182008_100276172 202
454 3300015262 Ga0182007_10009484 Ga0182007_100094843 202
455 3300020069 Ga0197907_10509654 Ga0197907_105096541 202
456 3300020069 Ga0197907_10527168 Ga0197907_105271683 202
457 3300020069 Ga0197907_10639122 Ga0197907_106391222 202
458 3300020069 Ga0197907_11400373 Ga0197907_114003733 202
459 3300020070 Ga0206356_10320396 Ga0206356_103203966 202
460 3300020070 Ga0206356_10447347 Ga0206356_104473473 202
461 3300020070 Ga0206356_10935926 Ga0206356_109359263 202
462 3300020070 Ga0206356_11158323 Ga0206356_111583231 202
463 3300020075 Ga0206349_1411469 Ga0206349_14114691 202
464 3300020075 Ga0206349_1780936 Ga0206349_17809361 202
465 3300020076 Ga0206355_1040908 Ga0206355_10409082 202
466 3300020076 Ga0206355_1498383 Ga0206355_14983832 202
467 3300020077 Ga0206351_10352168 Ga0206351_103521681 202
468 3300020078 Ga0206352_10568306 Ga0206352_105683062 202
469 3300020078 Ga0206352_11267884 Ga0206352_112678841 202
470 3300020080 Ga0206350_10104620 Ga0206350_101046201 202
471 3300020080 Ga0206350_10531860 Ga0206350_105318601 202
472 3300020080 Ga0206350_11189059 Ga0206350_111890592 202
473 3300020081 Ga0206354_10147252 Ga0206354_101472523 202
474 3300020081 Ga0206354_10629525 Ga0206354_106295251 202
475 3300020081 Ga0206354_11117816 Ga0206354_111178163 202
476 3300020082 Ga0206353_10803669 Ga0206353_108036694 202
477 3300020082 Ga0206353_11069350 Ga0206353_110693502 202
478 3300020610 Ga0154015_1006590 Ga0154015_10065902 202
479 3300020610 Ga0154015_1376900 Ga0154015_13769001 202
480 3300020610 Ga0154015_1478509 Ga0154015_14785093 202
481 3300020610 Ga0154015_1496403 Ga0154015_14964032 202
482 3300022467 Ga0224712_10113064 Ga0224712_101130642 202
483 3300022467 Ga0224712_10172925 Ga0224712_101729252 202
484 3300022467 Ga0224712_10177225 Ga0224712_101772251 202
485 3300022467 Ga0224712_10217353 Ga0224712_102173531 202
486 3300025225 Ga0209566_102011 Ga0209566_1020111 202
487 3300025226 Ga0209674_104234 Ga0209674_1042343 202
488 3300025228 Ga0209672_100024 Ga0209672_100024239 202
489 3300025228 Ga0209672_100113 Ga0209672_10011331 202
490 3300025228 Ga0209672_100976 Ga0209672_1009762 202
491 3300025230 Ga0209563_100127 Ga0209563_10012732 202
492 3300025231 Ga0207427_100075 Ga0207427_10007535 202
493 3300025231 Ga0207427_100192 Ga0207427_10019213 202
494 3300025233 Ga0209437_100020 Ga0209437_100020313 202
495 3300025233 Ga0209437_100319 Ga0209437_10031910 202
496 3300025233 Ga0209437_108345 Ga0209437_1083451 202
497 3300025242 Ga0209258_100047 Ga0209258_100047239 202
498 3300025242 Ga0209258_100144 Ga0209258_10014449 202
499 3300025242 Ga0209258_100198 Ga0209258_10019874 202
500 3300025246 Ga0209646_1000635 Ga0209646_10006357 202
501 3300025250 Ga0209026_1000037 Ga0209026_100003734 202
502 3300025250 Ga0209026_1000122 Ga0209026_100012247 202
503 3300025250 Ga0209026_1002009 Ga0209026_10020091 202
504 3300025250 Ga0209026_1015125 Ga0209026_10151252 202
505 3300025254 Ga0209148_1000024 Ga0209148_1000024223 202
506 3300025254 Ga0209148_1000054 Ga0209148_1000054239 202
507 3300025254 Ga0209148_1000141 Ga0209148_100014188 202
508 3300025256 Ga0209759_1001003 Ga0209759_100100311 202
509 3300025256 Ga0209759_1016179 Ga0209759_10161791 202
510 3300025261 Ga0209233_1000020 Ga0209233_1000020312 202
511 3300025261 Ga0209233_1000210 Ga0209233_100021036 202
512 3300025261 Ga0209233_1000307 Ga0209233_100030713 202
513 3300025261 Ga0209233_1007835 Ga0209233_10078352 202
514 3300025272 Ga0209455_1000025 Ga0209455_1000025223 202
515 3300025272 Ga0209455_1000052 Ga0209455_1000052239 202
516 3300025272 Ga0209455_1000578 Ga0209455_10005787 202
517 3300025272 Ga0209455_1001868 Ga0209455_10018684 202
518 3300025321 Ga0207656_10019453 Ga0207656_100194533 202
519 3300025321 Ga0207656_10093976 Ga0207656_100939763 202
520 3300025904 Ga0207647_10001035 Ga0207647_100010357 202
521 3300025904 Ga0207647_10009739 Ga0207647_100097391 202
522 3300025909 Ga0207705_10000691 Ga0207705_1000069117 202
523 3300025909 Ga0207705_10000958 Ga0207705_100009582 202
524 3300025909 Ga0207705_10028893 Ga0207705_100288935 202
525 3300025909 Ga0207705_10110815 Ga0207705_101108153 202
526 3300025909 Ga0207705_10501371 Ga0207705_105013712 202
527 3300025911 Ga0207654_10062351 Ga0207654_100623514 202
528 3300025911 Ga0207654_10379453 Ga0207654_103794531 202
529 3300025912 Ga0207707_10000083 Ga0207707_1000008327 202
530 3300025912 Ga0207707_10000093 Ga0207707_1000009353 202
531 3300025912 Ga0207707_10000152 Ga0207707_1000015241 202
532 3300025912 Ga0207707_10000570 Ga0207707_1000057020 202
533 3300025912 Ga0207707_10000623 Ga0207707_1000062322 202
534 3300025912 Ga0207707_10000756 Ga0207707_1000075615 202
535 3300025912 Ga0207707_10036159 Ga0207707_100361595 202
536 3300025913 Ga0207695_10002920 Ga0207695_100029206 202
537 3300025913 Ga0207695_10004847 Ga0207695_100048477 202
538 3300025913 Ga0207695_10012886 Ga0207695_100128866 202
539 3300025913 Ga0207695_10022277 Ga0207695_100222772 202
540 3300025914 Ga0207671_10000329 Ga0207671_1000032937 202
541 3300025914 Ga0207671_10331663 Ga0207671_103316631 202
542 3300025917 Ga0207660_10000103 Ga0207660_1000010318 202
543 3300025917 Ga0207660_10000305 Ga0207660_1000030518 202
544 3300025917 Ga0207660_10005291 Ga0207660_100052916 202
545 3300025917 Ga0207660_10216966 Ga0207660_102169663 202
546 3300025919 Ga0207657_10002228 Ga0207657_1000222824 202
547 3300025919 Ga0207657_10022253 Ga0207657_100222534 202
548 3300025919 Ga0207657_10205299 Ga0207657_102052991 202
549 3300025919 Ga0207657_10318583 Ga0207657_103185832 202
550 3300025920 Ga0207649_10018692 Ga0207649_100186923 202
551 3300025921 Ga0207652_10000038 Ga0207652_1000003871 202
552 3300025921 Ga0207652_10000129 Ga0207652_1000012911 202
553 3300025921 Ga0207652_10000257 Ga0207652_1000025751 202
554 3300025921 Ga0207652_10000910 Ga0207652_100009108 202
555 3300025924 Ga0207694_10200223 Ga0207694_102002232 202
556 3300025928 Ga0207700_10024162 Ga0207700_100241622 202
557 3300025929 Ga0207664_10031080 Ga0207664_100310803 202
558 3300025932 Ga0207690_10000782 Ga0207690_100007826 202
559 3300025932 Ga0207690_10176935 Ga0207690_101769351 202
560 3300025933 Ga0207706_10068915 Ga0207706_100689153 202
561 3300025944 Ga0207661_10004323 Ga0207661_100043232 202
562 3300025944 Ga0207661_10023756 Ga0207661_100237563 202
563 3300025944 Ga0207661_10491988 Ga0207661_104919881 202
564 3300025945 Ga0207679_10036141 Ga0207679_100361415 202
565 3300025949 Ga0207667_10003257 Ga0207667_1000325713 202
566 3300025949 Ga0207667_10003401 Ga0207667_100034018 202
567 3300025949 Ga0207667_10102061 Ga0207667_101020612 202
568 3300025949 Ga0207667_10551145 Ga0207667_105511451 202
569 3300025981 Ga0207640_10011511 Ga0207640_100115116 202
570 3300025981 Ga0207640_10039617 Ga0207640_100396173 202
571 3300025981 Ga0207640_10688267 Ga0207640_106882672 202
572 3300026041 Ga0207639_10000833 Ga0207639_1000083312 202
573 3300026041 Ga0207639_10020629 Ga0207639_100206296 202
574 3300026067 Ga0207678_10001110 Ga0207678_1000111016 202
575 3300026067 Ga0207678_10001566 Ga0207678_100015662 202
576 3300026067 Ga0207678_10002045 Ga0207678_100020454 202
577 3300026067 Ga0207678_10129621 Ga0207678_101296212 202
578 3300026067 Ga0207678_10242320 Ga0207678_102423202 202
579 3300026078 Ga0207702_10000321 Ga0207702_1000032116 202
580 3300026078 Ga0207702_10000719 Ga0207702_1000071926 202
581 3300026078 Ga0207702_10001824 Ga0207702_1000182415 202
582 3300026078 Ga0207702_10004954 Ga0207702_100049545 202
583 3300026078 Ga0207702_10005157 Ga0207702_100051573 202
584 3300026116 Ga0207674_10002170 Ga0207674_100021707 202
585 3300026116 Ga0207674_10158725 Ga0207674_101587252 202
586 3300026142 Ga0207698_10000707 Ga0207698_1000070717 202
587 3300026142 Ga0207698_10001030 Ga0207698_100010303 202
588 3300026142 Ga0207698_10028714 Ga0207698_100287145 202
589 3300037312 Ga0395899_0005509 Ga0395899_0005509_4295_4906 202
590 3300037312 Ga0395899_0025605 Ga0395899_0025605_1163_1771 202
591 3300037312 Ga0395899_0214774 Ga0395899_0214774_115_723 202
592 3300037418 Ga0395900_0000092 Ga0395900_0000092_7762_8373 202
593 3300037418 Ga0395900_0045052 Ga0395900_0045052_3479_4129 202
594 3300037418 Ga0395900_0701582 Ga0395900_0701582_84_692 202
595 3300037466 Ga0395898_0000069 Ga0395898_0000069_43062_43673 202
596 3300037466 Ga0395898_0055944 Ga0395898_0055944_1260_1868 202
597 3300037466 Ga0395898_0324121 Ga0395898_0324121_441_1049 202
598 3300037466 Ga0395898_0488521 Ga0395898_0488521_166_777 202
599 3300038443 Ga0395901_0062401 Ga0395901_0062401_1410_2018 202
600 3300044693 Ga0466961_0000786 Ga0466961_0000786_10812_11423 202
601 3300046674 Ga0495588_0135606 Ga0495588_0135606_432_1043 202
602 3300049569 Ga0501032_0052169 Ga0501032_0052169_503_1117 202
603 3300049569 Ga0501032_0208339 Ga0501032_0208339_123_806 202
604 3300049570 Ga0501033_0027183 Ga0501033_0027183_231_839 202
605 3300049570 Ga0501033_0035819 Ga0501033_0035819_200_814 202
606 3300049572 Ga0501036_0613073 Ga0501036_0613073_145_828 202
607 3300049573 Ga0501037_0028898 Ga0501037_0028898_72_680 202
608 3300049581 Ga0501047_0005476 Ga0501047_0005476_32_640 202
609 3300049581 Ga0501047_0055919 Ga0501047_0055919_1198_1812 202
610 3300049582 Ga0501048_0082907 Ga0501048_0082907_1435_2049 202
611 3300049585 Ga0501069_0001687 Ga0501069_0001687_6689_7312 202
612 3300049585 Ga0501069_0004932 Ga0501069_0004932_337_1020 202
613 3300049585 Ga0501069_0077447 Ga0501069_0077447_356_964 202
614 3300049586 Ga0501070_0059254 Ga0501070_0059254_2191_2799 202
615 3300049586 Ga0501070_0061962 Ga0501070_0061962_2053_2661 202
616 3300049586 Ga0501070_0116223 Ga0501070_0116223_311_919 202
617 3300049586 Ga0501070_0204292 Ga0501070_0204292_996_1607 202
618 3300049586 Ga0501070_0329838 Ga0501070_0329838_388_1011 202
619 3300049586 Ga0501070_0663122 Ga0501070_0663122_19_627 202
620 3300049587 Ga0501071_0042894 Ga0501071_0042894_1342_1950 202
621 3300049589 Ga0501073_0014628 Ga0501073_0014628_3904_4512 202
622 3300049589 Ga0501073_0048509 Ga0501073_0048509_258_941 202
623 3300049590 Ga0501074_0004621 Ga0501074_0004621_6140_6748 202
624 3300049590 Ga0501074_0047977 Ga0501074_0047977_1858_2466 202
625 3300049590 Ga0501074_0105274 Ga0501074_0105274_183_866 202
626 3300049590 Ga0501074_0220560 Ga0501074_0220560_298_906 202
627 3300049593 Ga0501077_0027216 Ga0501077_0027216_2553_3299 202
628 3300049742 Ga0501080_0005199 Ga0501080_0005199_3034_3642 202
629 3300049742 Ga0501080_0014472 Ga0501080_0014472_989_1597 202
630 3300049742 Ga0501080_0511586 Ga0501080_0511586_397_1011 202
631 3300049822 Ga0501035_0001381 Ga0501035_0001381_15961_16569 202
632 3300049822 Ga0501035_0054175 Ga0501035_0054175_438_1046 202
633 3300049822 Ga0501035_0086364 Ga0501035_0086364_206_820 202
634 3300049822 Ga0501035_0136804 Ga0501035_0136804_17_625 202
635 3300049823 Ga0501044_0006414 Ga0501044_0006414_3573_4181 202
636 3300049823 Ga0501044_0112192 Ga0501044_0112192_884_1492 202
637 3300049823 Ga0501044_0161093 Ga0501044_0161093_1348_1962 202
638 3300049823 Ga0501044_0167515 Ga0501044_0167515_1282_1965 202
639 3300049823 Ga0501044_0378156 Ga0501044_0378156_72_686 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

36

180

0.95

PF08534

Redoxin

Redoxin

35

194

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5epf-assembly1.cif.gz_A crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis 0.8958 26 196
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.8779 26 199
5epf-assembly1.cif.gz_A crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis 0.8737 26 196
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.8669 26 199
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.8618 26 198
ID Description Score Start End Superfamily
af_Q55E48_3_135_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9032 26 173 3.40.30.10
5epfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8958 26 196 3.40.30.10
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8819 26 198 3.40.30.10
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8779 26 199 3.40.30.10
af_Q559T9_1_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8742 26 198 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7X0J0U8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9674 26 194 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A317IDL9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9654 23 195 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A370X6L9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9507 18 202 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A7X0J0U8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9455 26 194 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A418RQD4-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9441 51 198 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454

Feature Viewer

pLDDT pTM Quality
86.67 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map