F471277
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 635 | 362 | 578 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0002572|Ga0451577_0002572_4874_5707 |
| Length | 277 |
| Sequence | MKLAVIQMVSGSDVNANVRQARALLQEAALAGAEMAVLPEYFCLMGHKDDDKLAIQELFGSGPLQQFLAESAREFNLWVVGGTIPLTADEPDALVRSGRVFNSSLVFSPAGVCVARYDKIHLFKFDNGTESYDESKVLVAGDQLVTFDLDSRDGHTWRVGLSVCYDLRFAELYRAYADAGAHLLLAPSAFTYTTGQDHWEVLLRARAIENLSYVGAAAQGGLHDNRRKTWGHAMLVDPWGKMLGQLSQQAGVVTAELDFELLTGCRSRLPALEHRVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 5 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 6 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 7 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 8 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 9 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 10 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 11 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 12 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 13 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 14 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 15 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 16 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 17 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 18 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 19 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 20 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 21 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 22 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 23 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 24 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 25 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 26 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 27 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 28 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 29 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 30 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 31 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 32 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 33 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 34 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 35 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 36 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 37 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 38 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 39 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 40 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 41 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 42 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 43 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 44 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 45 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 46 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 47 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 48 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 49 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 50 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 51 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 52 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 53 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 54 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 55 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 56 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 57 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 58 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 59 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 60 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 61 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 62 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 63 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 64 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 65 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 66 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 67 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 68 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 69 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 70 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 71 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 72 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 73 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 74 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 75 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 76 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 77 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 79 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 80 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 81 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 82 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 83 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 84 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 85 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 86 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 87 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 88 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 89 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 92 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 99 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 103 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 106 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 108 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 109 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 110 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 111 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 114 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 115 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 116 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 117 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 118 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 119 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 120 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 121 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 123 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 124 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 125 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 205 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 206 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 207 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 208 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 209 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 210 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 211 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 212 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 215 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 224 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 225 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 230 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 231 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 233 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 234 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 235 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 238 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 239 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 240 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 241 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 242 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 243 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 244 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 245 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 246 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 247 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 248 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 249 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 250 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 251 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 252 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 253 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 254 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 255 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 256 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 257 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 258 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 259 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 260 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 261 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 262 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 263 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 264 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 265 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 266 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 267 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 268 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 269 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 270 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 271 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 272 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 273 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 274 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 275 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 276 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 277 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 278 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 312 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 315 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 316 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 317 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 318 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 319 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 320 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 321 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 322 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 323 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 324 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 329 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 330 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 331 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 332 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 335 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 336 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 338 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 339 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 340 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 344 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 345 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 346 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 348 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 349 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 350 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 351 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 352 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 353 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 355 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 356 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 357 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 358 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 359 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 360 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 362 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.71 |
| Metatranscriptomes | 0.31 |
| Isolates | 8.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 34.02 |
| Nodule | 0.79 |
| Rhizoplane | 2.52 |
| Rhizosphere | 50.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10009520 | 3300001979 | Bacteria | 3798 |
| 2 | JGI24739J22299_10007263 | 3300001989 | Bacteria | 4164 |
| 3 | JGI24739J22299_10033104 | 3300001989 | Bacteria | 1772 |
| 4 | JGI25156J39149_1000024 | 3300002705 | Bacteria | 141748 |
| 5 | JGI25154J39366_1000043 | 3300002738 | Bacteria | 142417 |
| 6 | JGI25158J39367_1005551 | 3300002739 | Bacteria | 1846 |
| 7 | JGI25158J39367_1007034 | 3300002739 | Bacteria | 1598 |
| 8 | JGI25157J39369_1000031 | 3300002741 | Bacteria | 141953 |
| 9 | JGI25152J39213_1004060 | 3300002773 | Bacteria | 4762 |
| 10 | JGI25152J39213_1013640 | 3300002773 | Bacteria | 1682 |
| 11 | JGI25150J39212_1005028 | 3300002774 | Bacteria | 2861 |
| 12 | JGI25159J45721_1000904 | 3300002987 | Bacteria | 12918 |
| 13 | JGI25159J45721_1001700 | 3300002987 | Bacteria | 8901 |
| 14 | JGI25159J45721_1008872 | 3300002987 | Bacteria | 2713 |
| 15 | JGI25159J45721_1009866 | 3300002987 | Bacteria | 2483 |
| 16 | JGI25151J46595_10001517 | 3300003187 | Bacteria | 15537 |
| 17 | JGI25151J46595_10004727 | 3300003187 | Bacteria | 7156 |
| 18 | JGI25151J46595_10006874 | 3300003187 | Bacteria | 5648 |
| 19 | JGI25151J46595_10007855 | 3300003187 | Bacteria | 5183 |
| 20 | JGI25151J46595_10013246 | 3300003187 | Bacteria | 3719 |
| 21 | JGI25151J46595_10023959 | 3300003187 | Bacteria | 2504 |
| 22 | JGI25153J46596_10020431 | 3300003215 | Bacteria | 2504 |
| 23 | rootH1_10012410 | 3300003316 | Bacteria | 5622 |
| 24 | rootH2_10008704 | 3300003320 | Bacteria | 2472 |
| 25 | rootH2_10008705 | 3300003320 | Bacteria | 1185 |
| 26 | rootL2_10089357 | 3300003322 | Bacteria | 2112 |
| 27 | JGI25160J50197_1000768 | 3300003354 | Bacteria | 17244 |
| 28 | JGI25160J50197_1026910 | 3300003354 | Bacteria | 1576 |
| 29 | JGI25160J50197_1030306 | 3300003354 | Bacteria | 1412 |
| 30 | JGI25161J50226_1000007 | 3300003374 | Bacteria | 256181 |
| 31 | JGI25161J50226_1001559 | 3300003374 | Bacteria | 6711 |
| 32 | JGI25161J50226_1012310 | 3300003374 | Bacteria | 1030 |
| 33 | Ga0006562J51391_1058358 | 3300003578 | Bacteria | 7110 |
| 34 | Ga0006562J51391_1058359 | 3300003578 | Bacteria | 8250 |
| 35 | Ga0055535_1000542 | 3300003761 | Bacteria | 32509 |
| 36 | Ga0055542_1000003 | 3300003762 | Bacteria | 582721 |
| 37 | Ga0055526_1000974 | 3300003771 | Bacteria | 21093 |
| 38 | Ga0055526_1009192 | 3300003771 | Bacteria | 4800 |
| 39 | Ga0055526_1030423 | 3300003771 | Bacteria | 1575 |
| 40 | Ga0055526_1033425 | 3300003771 | Bacteria | 1428 |
| 41 | Ga0055526_1041538 | 3300003771 | Bacteria | 1145 |
| 42 | Ga0055537_1000137 | 3300003773 | Bacteria | 54996 |
| 43 | Ga0055537_1000328 | 3300003773 | Bacteria | 32405 |
| 44 | Ga0055537_1013112 | 3300003773 | Bacteria | 1575 |
| 45 | Ga0055537_1014659 | 3300003773 | Bacteria | 1412 |
| 46 | Ga0055524_1000101 | 3300003775 | Bacteria | 106527 |
| 47 | Ga0055524_1019857 | 3300003775 | Bacteria | 2283 |
| 48 | Ga0055524_1021192 | 3300003775 | Bacteria | 2162 |
| 49 | Ga0055536_1001356 | 3300003781 | Bacteria | 14918 |
| 50 | Ga0055536_1002973 | 3300003781 | Bacteria | 9290 |
| 51 | Ga0055536_1012962 | 3300003781 | Bacteria | 3046 |
| 52 | Ga0055534_1000118 | 3300003784 | Bacteria | 58554 |
| 53 | Ga0055534_1001345 | 3300003784 | Bacteria | 9871 |
| 54 | Ga0055534_1002898 | 3300003784 | Bacteria | 5689 |
| 55 | Ga0055534_1004575 | 3300003784 | Bacteria | 3954 |
| 56 | Ga0055534_1005179 | 3300003784 | Bacteria | 3567 |
| 57 | Ga0055528_1000152 | 3300003790 | Bacteria | 57369 |
| 58 | Ga0055528_1002223 | 3300003790 | Bacteria | 10582 |
| 59 | Ga0055528_1011265 | 3300003790 | Bacteria | 3567 |
| 60 | Ga0055530_10000251 | 3300003791 | Bacteria | 48732 |
| 61 | Ga0055530_10001323 | 3300003791 | Bacteria | 18640 |
| 62 | Ga0055530_10011121 | 3300003791 | Bacteria | 3260 |
| 63 | Ga0055540_1000099 | 3300003792 | Bacteria | 96187 |
| 64 | Ga0055540_1001243 | 3300003792 | Bacteria | 15662 |
| 65 | Ga0055540_1001728 | 3300003792 | Bacteria | 12564 |
| 66 | Ga0055540_1001887 | 3300003792 | Bacteria | 11749 |
| 67 | Ga0055540_1009727 | 3300003792 | Bacteria | 3283 |
| 68 | Ga0055540_1025462 | 3300003792 | Bacteria | 1449 |
| 69 | Ga0055531_10000333 | 3300003794 | Bacteria | 46562 |
| 70 | Ga0055531_10000739 | 3300003794 | Bacteria | 27542 |
| 71 | Ga0055531_10007097 | 3300003794 | Bacteria | 6189 |
| 72 | Ga0055531_10007150 | 3300003794 | Bacteria | 6155 |
| 73 | Ga0055531_10036085 | 3300003794 | Bacteria | 1533 |
| 74 | Ga0055531_10039140 | 3300003794 | Bacteria | 1412 |
| 75 | Ga0055543_1000061 | 3300004625 | Bacteria | 98138 |
| 76 | Ga0055543_1003323 | 3300004625 | Bacteria | 4810 |
| 77 | Ga0065165_1008540 | 3300005262 | Bacteria | 4766 |
| 78 | Ga0065165_1009124 | 3300005262 | Bacteria | 4500 |
| 79 | Ga0065165_1009126 | 3300005262 | Bacteria | 4500 |
| 80 | Ga0065714_10020927 | 3300005288 | Bacteria | 1741 |
| 81 | Ga0070658_10071203 | 3300005327 | Bacteria | 2848 |
| 82 | Ga0070658_10094800 | 3300005327 | Bacteria | 2463 |
| 83 | Ga0070658_10189340 | 3300005327 | Bacteria | 1734 |
| 84 | Ga0070677_10022212 | 3300005333 | Bacteria | 2334 |
| 85 | Ga0068869_100035005 | 3300005334 | Bacteria | 3557 |
| 86 | Ga0070668_100094738 | 3300005347 | Bacteria | 2357 |
| 87 | Ga0070669_100036807 | 3300005353 | Bacteria | 3547 |
| 88 | Ga0070674_100216244 | 3300005356 | Bacteria | 1489 |
| 89 | Ga0070673_100035285 | 3300005364 | Bacteria | 3791 |
| 90 | Ga0070659_100148239 | 3300005366 | Bacteria | 1913 |
| 91 | Ga0070659_100353246 | 3300005366 | Bacteria | 1234 |
| 92 | Ga0070678_100043169 | 3300005456 | Bacteria | 3210 |
| 93 | Ga0070678_100086090 | 3300005456 | Bacteria | 2396 |
| 94 | Ga0068867_100077165 | 3300005459 | Bacteria | 2503 |
| 95 | Ga0070706_100142283 | 3300005467 | Bacteria | 2239 |
| 96 | Ga0070707_100077962 | 3300005468 | Bacteria | 3197 |
| 97 | Ga0070679_100017454 | 3300005530 | Bacteria | 6946 |
| 98 | Ga0068853_100012346 | 3300005539 | Bacteria | 6950 |
| 99 | Ga0068853_100080193 | 3300005539 | Bacteria | 2855 |
| 100 | Ga0068853_100109410 | 3300005539 | Bacteria | 2453 |
| 101 | Ga0070672_100062016 | 3300005543 | Bacteria | 2949 |
| 102 | Ga0070665_100256697 | 3300005548 | Bacteria | 1749 |
| 103 | Ga0070665_100486874 | 3300005548 | Bacteria | 1244 |
| 104 | Ga0068855_100004794 | 3300005563 | Bacteria | 16512 |
| 105 | Ga0068855_100015273 | 3300005563 | Bacteria | 9243 |
| 106 | Ga0068855_100149807 | 3300005563 | Bacteria | 2653 |
| 107 | Ga0068855_100853395 | 3300005563 | Bacteria | 965 |
| 108 | Ga0070664_100029916 | 3300005564 | Bacteria | 4540 |
| 109 | Ga0068857_100038245 | 3300005577 | Bacteria | 4249 |
| 110 | Ga0068857_100310948 | 3300005577 | Bacteria | 1454 |
| 111 | Ga0068857_100338808 | 3300005577 | Bacteria | 1391 |
| 112 | Ga0068854_100175185 | 3300005578 | Bacteria | 1671 |
| 113 | Ga0068864_100070701 | 3300005618 | Bacteria | 3037 |
| 114 | Ga0068851_10311800 | 3300005834 | Bacteria | 907 |
| 115 | Ga0068863_100055874 | 3300005841 | Bacteria | 3738 |
| 116 | Ga0068862_100024710 | 3300005844 | Bacteria | 5042 |
| 117 | Ga0075365_10035431 | 3300006038 | Bacteria | 3228 |
| 118 | Ga0075365_10040833 | 3300006038 | Bacteria | 3027 |
| 119 | Ga0075365_10088259 | 3300006038 | Bacteria | 2109 |
| 120 | Ga0075365_10180673 | 3300006038 | Bacteria | 1475 |
| 121 | Ga0075363_100002936 | 3300006048 | Bacteria | 7107 |
| 122 | Ga0075363_100009667 | 3300006048 | Bacteria | 4542 |
| 123 | Ga0075363_100131366 | 3300006048 | Bacteria | 1404 |
| 124 | Ga0075364_10007902 | 3300006051 | Bacteria | 6336 |
| 125 | Ga0075364_10010882 | 3300006051 | Bacteria | 5512 |
| 126 | Ga0075364_10020489 | 3300006051 | Bacteria | 4158 |
| 127 | Ga0075432_10044455 | 3300006058 | Bacteria | 1557 |
| 128 | Ga0075362_10010620 | 3300006177 | Bacteria | 3602 |
| 129 | Ga0075362_10034478 | 3300006177 | Bacteria | 2206 |
| 130 | Ga0075367_10105522 | 3300006178 | Bacteria | 1725 |
| 131 | Ga0075369_10062102 | 3300006186 | Bacteria | 1632 |
| 132 | Ga0075366_10023521 | 3300006195 | Bacteria | 3589 |
| 133 | Ga0075366_10153939 | 3300006195 | Bacteria | 1392 |
| 134 | Ga0075366_10276515 | 3300006195 | Bacteria | 1026 |
| 135 | Ga0097621_100175774 | 3300006237 | Bacteria | 1848 |
| 136 | Ga0075370_10001072 | 3300006353 | Bacteria | 11389 |
| 137 | Ga0075370_10004593 | 3300006353 | Bacteria | 6734 |
| 138 | Ga0075370_10052346 | 3300006353 | Bacteria | 2316 |
| 139 | Ga0075370_10068238 | 3300006353 | Bacteria | 2030 |
| 140 | Ga0075370_10078624 | 3300006353 | Bacteria | 1894 |
| 141 | Ga0075370_10187686 | 3300006353 | Bacteria | 1217 |
| 142 | Ga0075429_100463784 | 3300006880 | Bacteria | 1110 |
| 143 | Ga0079104_1007224 | 3300006946 | Bacteria | 4065 |
| 144 | Ga0099826_10000746 | 3300006948 | Bacteria | 17106 |
| 145 | Ga0105240_10016619 | 3300009093 | Bacteria | 9952 |
| 146 | Ga0105243_10000787 | 3300009148 | Bacteria | 30397 |
| 147 | Ga0105243_10006024 | 3300009148 | Bacteria | 9387 |
| 148 | Ga0105243_10239941 | 3300009148 | Bacteria | 1612 |
| 149 | Ga0105241_10033011 | 3300009174 | Bacteria | 3884 |
| 150 | Ga0105238_10401749 | 3300009551 | Bacteria | 1363 |
| 151 | Ga0105239_10087691 | 3300010375 | Bacteria | 3431 |
| 152 | Ga0105246_10033388 | 3300011119 | Bacteria | 3421 |
| 153 | Ga0157373_10008247 | 3300013100 | Bacteria | 7743 |
| 154 | Ga0157371_10019901 | 3300013102 | Bacteria | 4945 |
| 155 | Ga0157370_10005598 | 3300013104 | Bacteria | 14065 |
| 156 | Ga0157369_10042153 | 3300013105 | Bacteria | 4980 |
| 157 | Ga0163162_10039046 | 3300013306 | Bacteria | 4740 |
| 158 | Ga0157372_10036824 | 3300013307 | Bacteria | 5395 |
| 159 | Ga0182008_10000871 | 3300014497 | Bacteria | 20984 |
| 160 | Ga0182008_10004373 | 3300014497 | Bacteria | 8269 |
| 161 | Ga0182008_10006756 | 3300014497 | Bacteria | 6383 |
| 162 | Ga0182008_10087380 | 3300014497 | Bacteria | 1536 |
| 163 | Ga0157376_10022727 | 3300014969 | Bacteria | 4894 |
| 164 | Ga0182006_1004055 | 3300015261 | Bacteria | 7303 |
| 165 | Ga0182006_1039701 | 3300015261 | Bacteria | 1856 |
| 166 | Ga0182006_1048403 | 3300015261 | Bacteria | 1644 |
| 167 | Ga0182007_10000609 | 3300015262 | Bacteria | 20877 |
| 168 | Ga0182007_10002723 | 3300015262 | Bacteria | 8648 |
| 169 | Ga0182005_1048127 | 3300015265 | Bacteria | 1159 |
| 170 | Ga0183362_10004 | 3300015683 | Bacteria | 569303 |
| 171 | Ga0163161_10001481 | 3300017792 | Bacteria | 17336 |
| 172 | Ga0163161_10014836 | 3300017792 | Bacteria | 5429 |
| 173 | Ga0163161_10074193 | 3300017792 | Bacteria | 2494 |
| 174 | Ga0163161_10091821 | 3300017792 | Bacteria | 2248 |
| 175 | Ga0163161_10170412 | 3300017792 | Bacteria | 1664 |
| 176 | Ga0163161_10244870 | 3300017792 | Bacteria | 1396 |
| 177 | Ga0209435_100008 | 3300025206 | Bacteria | 503644 |
| 178 | Ga0209436_114069 | 3300025208 | Bacteria | 1287 |
| 179 | Ga0209436_116442 | 3300025208 | Bacteria | 1109 |
| 180 | Ga0209672_100365 | 3300025228 | Bacteria | 28274 |
| 181 | Ga0209147_102967 | 3300025229 | Bacteria | 3659 |
| 182 | Ga0209258_100015 | 3300025242 | Bacteria | 706310 |
| 183 | Ga0207425_1000309 | 3300025245 | Bacteria | 35186 |
| 184 | Ga0207425_1000418 | 3300025245 | Bacteria | 28631 |
| 185 | Ga0207425_1001693 | 3300025245 | Bacteria | 8769 |
| 186 | Ga0207425_1025074 | 3300025245 | Bacteria | 1233 |
| 187 | Ga0209646_1000079 | 3300025246 | Bacteria | 207677 |
| 188 | Ga0209026_1000067 | 3300025250 | Bacteria | 207677 |
| 189 | Ga0209148_1000028 | 3300025254 | Bacteria | 582773 |
| 190 | Ga0209759_1000056 | 3300025256 | Bacteria | 207677 |
| 191 | Ga0209129_1000160 | 3300025258 | Bacteria | 102457 |
| 192 | Ga0209129_1001108 | 3300025258 | Bacteria | 15687 |
| 193 | Ga0209565_1000041 | 3300025263 | Bacteria | 251081 |
| 194 | Ga0209565_1000227 | 3300025263 | Bacteria | 62284 |
| 195 | Ga0209565_1000262 | 3300025263 | Bacteria | 55325 |
| 196 | Ga0209565_1000538 | 3300025263 | Bacteria | 26449 |
| 197 | Ga0209565_1000653 | 3300025263 | Bacteria | 22263 |
| 198 | Ga0209673_1000286 | 3300025273 | Bacteria | 94581 |
| 199 | Ga0209673_1000364 | 3300025273 | Bacteria | 81319 |
| 200 | Ga0209673_1000524 | 3300025273 | Bacteria | 62744 |
| 201 | Ga0209673_1002001 | 3300025273 | Bacteria | 15763 |
| 202 | Ga0209673_1005197 | 3300025273 | Bacteria | 6644 |
| 203 | Ga0209130_1000245 | 3300025284 | Bacteria | 68668 |
| 204 | Ga0209130_1000965 | 3300025284 | Bacteria | 22670 |
| 205 | Ga0209130_1001381 | 3300025284 | Bacteria | 16326 |
| 206 | Ga0209130_1002421 | 3300025284 | Bacteria | 9397 |
| 207 | Ga0209130_1002607 | 3300025284 | Bacteria | 8730 |
| 208 | Ga0209675_1000164 | 3300025291 | Bacteria | 81617 |
| 209 | Ga0209675_1000316 | 3300025291 | Bacteria | 43181 |
| 210 | Ga0209675_1002522 | 3300025291 | Bacteria | 9334 |
| 211 | Ga0209675_1005415 | 3300025291 | Bacteria | 5350 |
| 212 | Ga0209675_1006018 | 3300025291 | Bacteria | 4961 |
| 213 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 214 | Ga0209676_1000074 | 3300025292 | Bacteria | 305770 |
| 215 | Ga0209676_1000303 | 3300025292 | Bacteria | 98589 |
| 216 | Ga0209676_1001391 | 3300025292 | Bacteria | 23407 |
| 217 | Ga0209676_1004083 | 3300025292 | Bacteria | 8358 |
| 218 | Ga0209676_1016100 | 3300025292 | Bacteria | 2720 |
| 219 | Ga0209676_1052484 | 3300025292 | Bacteria | 1063 |
| 220 | Ga0209025_1000269 | 3300025294 | Bacteria | 121642 |
| 221 | Ga0209025_1000637 | 3300025294 | Bacteria | 62014 |
| 222 | Ga0209025_1000656 | 3300025294 | Bacteria | 60251 |
| 223 | Ga0209025_1002942 | 3300025294 | Bacteria | 16940 |
| 224 | Ga0209025_1005362 | 3300025294 | Bacteria | 10503 |
| 225 | Ga0209025_1010723 | 3300025294 | Bacteria | 6164 |
| 226 | Ga0209025_1017822 | 3300025294 | Bacteria | 4071 |
| 227 | Ga0209564_1000346 | 3300025295 | Bacteria | 87680 |
| 228 | Ga0209564_1000363 | 3300025295 | Bacteria | 84210 |
| 229 | Ga0209564_1000764 | 3300025295 | Bacteria | 45093 |
| 230 | Ga0209564_1001188 | 3300025295 | Bacteria | 30004 |
| 231 | Ga0209564_1004998 | 3300025295 | Bacteria | 7793 |
| 232 | Ga0209758_1000039 | 3300025297 | Bacteria | 428951 |
| 233 | Ga0209758_1004890 | 3300025297 | Bacteria | 10777 |
| 234 | Ga0209758_1009469 | 3300025297 | Bacteria | 6046 |
| 235 | Ga0209758_1011662 | 3300025297 | Bacteria | 5053 |
| 236 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 237 | Ga0209050_1000015 | 3300025298 | Bacteria | 759102 |
| 238 | Ga0209050_1004313 | 3300025298 | Bacteria | 9716 |
| 239 | Ga0209050_1007985 | 3300025298 | Bacteria | 5777 |
| 240 | Ga0209050_1010818 | 3300025298 | Bacteria | 4432 |
| 241 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 242 | Ga0209256_1000136 | 3300025299 | Bacteria | 159047 |
| 243 | Ga0209256_1000382 | 3300025299 | Bacteria | 70823 |
| 244 | Ga0207426_1000091 | 3300025302 | Bacteria | 280561 |
| 245 | Ga0207426_1000108 | 3300025302 | Bacteria | 242257 |
| 246 | Ga0207426_1000130 | 3300025302 | Bacteria | 210271 |
| 247 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 248 | Ga0209051_1000010 | 3300025303 | Bacteria | 641298 |
| 249 | Ga0209051_1000214 | 3300025303 | Bacteria | 98444 |
| 250 | Ga0209051_1000277 | 3300025303 | Bacteria | 83774 |
| 251 | Ga0209051_1000361 | 3300025303 | Bacteria | 66865 |
| 252 | Ga0209051_1001386 | 3300025303 | Bacteria | 20876 |
| 253 | Ga0209051_1010675 | 3300025303 | Bacteria | 4608 |
| 254 | Ga0209051_1043190 | 3300025303 | Bacteria | 1584 |
| 255 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 256 | Ga0209257_1000026 | 3300025304 | Bacteria | 723225 |
| 257 | Ga0209257_1000048 | 3300025304 | Bacteria | 455536 |
| 258 | Ga0209257_1000172 | 3300025304 | Bacteria | 167434 |
| 259 | Ga0209257_1005996 | 3300025304 | Bacteria | 8131 |
| 260 | Ga0209257_1010352 | 3300025304 | Bacteria | 4741 |
| 261 | Ga0209257_1021322 | 3300025304 | Bacteria | 2357 |
| 262 | Ga0209257_1054820 | 3300025304 | Bacteria | 1108 |
| 263 | Ga0207656_10008178 | 3300025321 | Bacteria | 3839 |
| 264 | Ga0207655_1007709 | 3300025728 | Bacteria | 6947 |
| 265 | Ga0207647_10131714 | 3300025904 | Bacteria | 1469 |
| 266 | Ga0207705_10182000 | 3300025909 | Bacteria | 1586 |
| 267 | Ga0207654_10018323 | 3300025911 | Bacteria | 3672 |
| 268 | Ga0207707_10070703 | 3300025912 | Bacteria | 3041 |
| 269 | Ga0207671_10122083 | 3300025914 | Bacteria | 1992 |
| 270 | Ga0207657_10449915 | 3300025919 | Bacteria | 1011 |
| 271 | Ga0207681_10029912 | 3300025923 | Bacteria | 3545 |
| 272 | Ga0207694_10040683 | 3300025924 | Bacteria | 3580 |
| 273 | Ga0207650_10368350 | 3300025925 | Bacteria | 1185 |
| 274 | Ga0207664_10481326 | 3300025929 | Bacteria | 1110 |
| 275 | Ga0207706_10230012 | 3300025933 | Bacteria | 1622 |
| 276 | Ga0207709_10000290 | 3300025935 | Bacteria | 57108 |
| 277 | Ga0207709_10001845 | 3300025935 | Bacteria | 14110 |
| 278 | Ga0207709_10060259 | 3300025935 | Bacteria | 2365 |
| 279 | Ga0207669_10054975 | 3300025937 | Bacteria | 2408 |
| 280 | Ga0207669_10215503 | 3300025937 | Bacteria | 1405 |
| 281 | Ga0207691_10093259 | 3300025940 | Bacteria | 2696 |
| 282 | Ga0207679_10060724 | 3300025945 | Bacteria | 2810 |
| 283 | Ga0207667_10018493 | 3300025949 | Bacteria | 7812 |
| 284 | Ga0207667_10096535 | 3300025949 | Bacteria | 3051 |
| 285 | Ga0207651_10444212 | 3300025960 | Bacteria | 1112 |
| 286 | Ga0207668_10411515 | 3300025972 | Bacteria | 1146 |
| 287 | Ga0207677_10009193 | 3300026023 | Bacteria | 5550 |
| 288 | Ga0207639_10001749 | 3300026041 | Bacteria | 14618 |
| 289 | Ga0207639_10094172 | 3300026041 | Bacteria | 2404 |
| 290 | Ga0207678_10393781 | 3300026067 | Bacteria | 1199 |
| 291 | Ga0207641_10044213 | 3300026088 | Bacteria | 3745 |
| 292 | Ga0207648_10126649 | 3300026089 | Bacteria | 2247 |
| 293 | Ga0207676_10057590 | 3300026095 | Bacteria | 3061 |
| 294 | Ga0207674_10243233 | 3300026116 | Bacteria | 1746 |
| 295 | Ga0207683_10069612 | 3300026121 | Bacteria | 3108 |
| 296 | Ga0207683_10150711 | 3300026121 | Bacteria | 2098 |
| 297 | Ga0207683_10192686 | 3300026121 | Bacteria | 1851 |
| 298 | Ga0207698_10183671 | 3300026142 | Bacteria | 1855 |
| 299 | Ga0209281_1032670 | 3300027111 | Bacteria | 919 |
| 300 | Ga0209970_1000057 | 3300027614 | Bacteria | 15061 |
| 301 | Ga0209971_1003077 | 3300027682 | Bacteria | 3982 |
| 302 | Ga0209974_10002191 | 3300027876 | Bacteria | 7120 |
| 303 | Ga0209974_10039512 | 3300027876 | Bacteria | 1569 |
| 304 | Ga0268266_10122574 | 3300028379 | Bacteria | 2315 |
| 305 | Ga0268266_10191052 | 3300028379 | Bacteria | 1869 |
| 306 | Ga0268265_10068672 | 3300028380 | Bacteria | 2749 |
| 307 | Ga0268265_10437697 | 3300028380 | Bacteria | 1218 |
| 308 | Ga0307515_10000034 | 3300028794 | Bacteria | 344640 |
| 309 | Ga0307512_10146128 | 3300030522 | Bacteria | 1430 |
| 310 | Ga0316176_1044658 | 3300030732 | Bacteria | 4805 |
| 311 | Ga0314311_1015200 | 3300030733 | Bacteria | 7232 |
| 312 | Ga0316178_1092321 | 3300030735 | Bacteria | 5206 |
| 313 | Ga0316183_1032606 | 3300030742 | Bacteria | 1181 |
| 314 | Ga0316183_1047886 | 3300030742 | Bacteria | 4947 |
| 315 | Ga0316181_1039120 | 3300030744 | Bacteria | 3274 |
| 316 | Ga0316182_1038521 | 3300030745 | Bacteria | 5844 |
| 317 | Ga0265330_10000122 | 3300031235 | Bacteria | 63452 |
| 318 | Ga0265332_10000006 | 3300031238 | Bacteria | 327963 |
| 319 | Ga0265332_10000048 | 3300031238 | Bacteria | 113285 |
| 320 | Ga0265325_10001946 | 3300031241 | Bacteria | 14243 |
| 321 | Ga0265327_10001721 | 3300031251 | Bacteria | 25935 |
| 322 | Ga0307513_10000013 | 3300031456 | Bacteria | 325682 |
| 323 | Ga0307513_10066483 | 3300031456 | Bacteria | 3787 |
| 324 | Ga0307513_10120068 | 3300031456 | Bacteria | 2599 |
| 325 | Ga0307408_100000072 | 3300031548 | Bacteria | 115918 |
| 326 | Ga0307408_100026167 | 3300031548 | Bacteria | 4003 |
| 327 | Ga0307408_100059781 | 3300031548 | Bacteria | 2775 |
| 328 | Ga0307408_100088911 | 3300031548 | Bacteria | 2327 |
| 329 | Ga0307408_100175024 | 3300031548 | Bacteria | 1716 |
| 330 | Ga0307408_100645879 | 3300031548 | Bacteria | 945 |
| 331 | Ga0307514_10004659 | 3300031649 | Bacteria | 12552 |
| 332 | Ga0265314_10000132 | 3300031711 | Bacteria | 113285 |
| 333 | Ga0265314_10014961 | 3300031711 | Bacteria | 6179 |
| 334 | Ga0265342_10177995 | 3300031712 | Bacteria | 1166 |
| 335 | Ga0307516_10010885 | 3300031730 | Bacteria | 9951 |
| 336 | Ga0307405_10130148 | 3300031731 | Bacteria | 1737 |
| 337 | Ga0307405_10465904 | 3300031731 | Bacteria | 1005 |
| 338 | Ga0307413_10061201 | 3300031824 | Bacteria | 2322 |
| 339 | Ga0307413_10261958 | 3300031824 | Bacteria | 1289 |
| 340 | Ga0307413_10265743 | 3300031824 | Bacteria | 1282 |
| 341 | Ga0307406_10000249 | 3300031901 | Bacteria | 32642 |
| 342 | Ga0307406_10004096 | 3300031901 | Bacteria | 7935 |
| 343 | Ga0307406_10009252 | 3300031901 | Bacteria | 5520 |
| 344 | Ga0307407_10033951 | 3300031903 | Bacteria | 2788 |
| 345 | Ga0307412_10013623 | 3300031911 | Bacteria | 4774 |
| 346 | Ga0307412_10028145 | 3300031911 | Bacteria | 3512 |
| 347 | Ga0307412_10030084 | 3300031911 | Bacteria | 3414 |
| 348 | Ga0307412_10035052 | 3300031911 | Bacteria | 3203 |
| 349 | Ga0307412_10113179 | 3300031911 | Bacteria | 1941 |
| 350 | Ga0307412_10227283 | 3300031911 | Bacteria | 1434 |
| 351 | Ga0307412_10388260 | 3300031911 | Bacteria | 1133 |
| 352 | Ga0307409_100360714 | 3300031995 | Bacteria | 1375 |
| 353 | Ga0307416_100087871 | 3300032002 | Bacteria | 2656 |
| 354 | Ga0307414_10091968 | 3300032004 | Bacteria | 2256 |
| 355 | Ga0307414_10194778 | 3300032004 | Bacteria | 1643 |
| 356 | Ga0307411_10021542 | 3300032005 | Bacteria | 3774 |
| 357 | Ga0307411_10298610 | 3300032005 | Bacteria | 1291 |
| 358 | Ga0373939_0128683 | 3300035114 | Bacteria | 901 |
| 359 | Ga0395899_0004093 | 3300037312 | Bacteria | 11480 |
| 360 | Ga0395899_0005604 | 3300037312 | Bacteria | 9740 |
| 361 | Ga0395900_0009645 | 3300037418 | Bacteria | 9902 |
| 362 | Ga0395900_0029613 | 3300037418 | Bacteria | 5617 |
| 363 | Ga0395900_0295912 | 3300037418 | Bacteria | 1606 |
| 364 | Ga0395898_0008291 | 3300037466 | Bacteria | 10987 |
| 365 | Ga0395898_0011141 | 3300037466 | Bacteria | 9363 |
| 366 | Ga0395905_0000047 | 3300037471 | Bacteria | 237582 |
| 367 | Ga0395905_0003373 | 3300037471 | Bacteria | 17114 |
| 368 | Ga0395905_0021306 | 3300037471 | Bacteria | 6131 |
| 369 | Ga0395905_0025494 | 3300037471 | Bacteria | 5576 |
| 370 | Ga0395905_0047730 | 3300037471 | Bacteria | 4011 |
| 371 | Ga0395905_0069200 | 3300037471 | Bacteria | 3306 |
| 372 | Ga0395905_0268017 | 3300037471 | Bacteria | 1593 |
| 373 | Ga0395905_0644139 | 3300037471 | Bacteria | 961 |
| 374 | Ga0395901_0011214 | 3300038443 | Bacteria | 9081 |
| 375 | Ga0395901_0098912 | 3300038443 | Bacteria | 3058 |
| 376 | Ga0439436_0001605 | 3300041404 | Bacteria | 6581 |
| 377 | Ga0439436_0003996 | 3300041404 | Bacteria | 4520 |
| 378 | Ga0439436_0008597 | 3300041404 | Bacteria | 3139 |
| 379 | Ga0439438_024839 | 3300041405 | Bacteria | 1638 |
| 380 | Ga0439439_0000354 | 3300041406 | Bacteria | 7465 |
| 381 | Ga0439453_0007236 | 3300041408 | Bacteria | 1754 |
| 382 | Ga0439466_0007584 | 3300041411 | Bacteria | 4100 |
| 383 | Ga0439466_0014160 | 3300041411 | Bacteria | 2908 |
| 384 | Ga0439465_0013877 | 3300041413 | Bacteria | 2508 |
| 385 | Ga0439431_0006224 | 3300041997 | Bacteria | 2635 |
| 386 | Ga0439433_0001806 | 3300041999 | Bacteria | 4450 |
| 387 | Ga0439441_020509 | 3300042001 | Bacteria | 1212 |
| 388 | Ga0439442_001254 | 3300042002 | Bacteria | 5041 |
| 389 | Ga0439442_031362 | 3300042002 | Bacteria | 1110 |
| 390 | Ga0439445_0005434 | 3300042004 | Bacteria | 2904 |
| 391 | Ga0439445_0047283 | 3300042004 | Bacteria | 1155 |
| 392 | Ga0439432_003005 | 3300042006 | Bacteria | 6277 |
| 393 | Ga0439432_028055 | 3300042006 | Bacteria | 1835 |
| 394 | Ga0439449_0000821 | 3300042007 | Bacteria | 11998 |
| 395 | Ga0439449_0002256 | 3300042007 | Bacteria | 7575 |
| 396 | Ga0439449_0010517 | 3300042007 | Bacteria | 3496 |
| 397 | Ga0439449_0063635 | 3300042007 | Bacteria | 1361 |
| 398 | Ga0439452_010149 | 3300042010 | Bacteria | 2750 |
| 399 | Ga0439457_002860 | 3300042014 | Bacteria | 4819 |
| 400 | Ga0439457_020332 | 3300042014 | Bacteria | 1474 |
| 401 | Ga0439462_0015839 | 3300042015 | Bacteria | 1945 |
| 402 | Ga0439462_0018453 | 3300042015 | Bacteria | 1812 |
| 403 | Ga0450911_000378 | 3300042115 | Bacteria | 14820 |
| 404 | Ga0450919_003019 | 3300042121 | Bacteria | 2147 |
| 405 | Ga0450920_007022 | 3300042122 | Bacteria | 2035 |
| 406 | Ga0450921_005965 | 3300042123 | Bacteria | 935 |
| 407 | Ga0450923_000626 | 3300042125 | Bacteria | 4074 |
| 408 | Ga0450890_003534 | 3300042127 | Bacteria | 2076 |
| 409 | Ga0450890_018350 | 3300042127 | Bacteria | 936 |
| 410 | Ga0450894_005953 | 3300042131 | Bacteria | 1578 |
| 411 | Ga0450896_011176 | 3300042133 | Bacteria | 1263 |
| 412 | Ga0450905_027495 | 3300042142 | Bacteria | 864 |
| 413 | Ga0450910_000694 | 3300042147 | Bacteria | 4042 |
| 414 | Ga0450910_005575 | 3300042147 | Bacteria | 1721 |
| 415 | Ga0439446_0083243 | 3300042156 | Bacteria | 993 |
| 416 | Ga0439434_0001123 | 3300042435 | Bacteria | 7738 |
| 417 | Ga0439434_0001864 | 3300042435 | Bacteria | 6131 |
| 418 | Ga0439434_0025266 | 3300042435 | Bacteria | 1792 |
| 419 | Ga0439464_0007913 | 3300042439 | Bacteria | 2784 |
| 420 | Ga0451577_0000126 | 3300042876 | Bacteria | 168037 |
| 421 | Ga0451577_0002572 | 3300042876 | Bacteria | 21418 |
| 422 | Ga0451577_0025518 | 3300042876 | Bacteria | 5360 |
| 423 | Ga0451577_0083590 | 3300042876 | Bacteria | 2848 |
| 424 | Ga0466969_0029606 | 3300044656 | Bacteria | 2795 |
| 425 | Ga0453683_0013716 | 3300044673 | Bacteria | 5277 |
| 426 | Ga0453683_0017744 | 3300044673 | Bacteria | 4578 |
| 427 | Ga0466965_0091841 | 3300044683 | Bacteria | 1545 |
| 428 | Ga0466966_0114593 | 3300044684 | Bacteria | 1660 |
| 429 | Ga0466961_0074220 | 3300044693 | Bacteria | 2157 |
| 430 | Ga0453684_0000365 | 3300044712 | Bacteria | 186233 |
| 431 | Ga0453684_0037918 | 3300044712 | Bacteria | 6604 |
| 432 | Ga0453684_0125592 | 3300044712 | Bacteria | 3089 |
| 433 | Ga0466970_0037469 | 3300044765 | Bacteria | 2570 |
| 434 | Ga0466957_0073868 | 3300044842 | Bacteria | 2114 |
| 435 | Ga0466960_0032942 | 3300044901 | Bacteria | 2404 |
| 436 | Ga0466959_0205503 | 3300045049 | Bacteria | 1370 |
| 437 | Ga0451576_0000627 | 3300045051 | Bacteria | 73597 |
| 438 | Ga0451576_0003400 | 3300045051 | Bacteria | 21935 |
| 439 | Ga0451576_0005543 | 3300045051 | Bacteria | 15767 |
| 440 | Ga0451576_0071836 | 3300045051 | Bacteria | 3602 |
| 441 | Ga0451576_0397034 | 3300045051 | Bacteria | 1446 |
| 442 | Ga0495627_007976 | 3300046453 | Bacteria | 4004 |
| 443 | Ga0495627_013800 | 3300046453 | Bacteria | 2837 |
| 444 | Ga0495629_0177104 | 3300046459 | Bacteria | 1479 |
| 445 | Ga0495639_0007301 | 3300046475 | Bacteria | 4740 |
| 446 | Ga0495610_0032190 | 3300046512 | Bacteria | 2728 |
| 447 | Ga0495620_0072733 | 3300046515 | Bacteria | 1403 |
| 448 | Ga0495631_0000050 | 3300046518 | Bacteria | 71875 |
| 449 | Ga0495637_0004019 | 3300046520 | Bacteria | 7678 |
| 450 | Ga0495637_0038409 | 3300046520 | Bacteria | 2073 |
| 451 | Ga0495663_0011145 | 3300046525 | Bacteria | 2502 |
| 452 | Ga0495663_0029736 | 3300046525 | Bacteria | 1615 |
| 453 | Ga0495642_0049498 | 3300046528 | Bacteria | 1726 |
| 454 | Ga0495622_0102540 | 3300046557 | Bacteria | 1311 |
| 455 | Ga0495633_0003589 | 3300046558 | Bacteria | 10262 |
| 456 | Ga0495633_0041532 | 3300046558 | Bacteria | 2187 |
| 457 | Ga0495656_0003211 | 3300046615 | Bacteria | 5510 |
| 458 | Ga0495656_0023666 | 3300046615 | Bacteria | 2419 |
| 459 | Ga0495668_0066318 | 3300046616 | Bacteria | 1986 |
| 460 | Ga0495634_0279213 | 3300046642 | Bacteria | 1015 |
| 461 | Ga0495625_0000098 | 3300046660 | Bacteria | 140987 |
| 462 | Ga0495625_0060099 | 3300046660 | Bacteria | 2693 |
| 463 | Ga0495635_0087817 | 3300046663 | Bacteria | 2128 |
| 464 | Ga0495588_0014830 | 3300046674 | Bacteria | 3739 |
| 465 | Ga0495588_0023421 | 3300046674 | Bacteria | 3057 |
| 466 | Ga0495588_0144673 | 3300046674 | Bacteria | 1256 |
| 467 | Ga0495657_0226432 | 3300046675 | Bacteria | 1132 |
| 468 | Ga0495658_0026831 | 3300046683 | Bacteria | 3092 |
| 469 | Ga0495669_0133332 | 3300046684 | Bacteria | 1170 |
| 470 | Ga0495670_0110751 | 3300046691 | Bacteria | 1420 |
| 471 | Ga0495671_0003067 | 3300046692 | Bacteria | 10375 |
| 472 | Ga0495600_0150003 | 3300046809 | Bacteria | 1510 |
| 473 | Ga0495676_0013204 | 3300047321 | Bacteria | 7429 |
| 474 | Ga0495685_027928 | 3300047447 | Bacteria | 1941 |
| 475 | Ga0495593_0063152 | 3300047673 | Bacteria | 1934 |
| 476 | Ga0495614_0032377 | 3300048089 | Bacteria | 2250 |
| 477 | Ga0496100_0040858 | 3300048903 | Bacteria | 2954 |
| 478 | Ga0496101_0001604 | 3300048904 | Bacteria | 13600 |
| 479 | Ga0496101_0008375 | 3300048904 | Bacteria | 6756 |
| 480 | Ga0496102_0010166 | 3300048905 | Bacteria | 8091 |
| 481 | Ga0496102_0280418 | 3300048905 | Bacteria | 1571 |
| 482 | Ga0496103_0010808 | 3300048906 | Bacteria | 5403 |
| 483 | Ga0496104_0128117 | 3300048907 | Bacteria | 2437 |
| 484 | Ga0496105_0004183 | 3300048908 | Bacteria | 10840 |
| 485 | Ga0496107_0321526 | 3300048910 | Bacteria | 1151 |
| 486 | Ga0496108_0228012 | 3300048911 | Bacteria | 1619 |
| 487 | Ga0496108_0513274 | 3300048911 | Bacteria | 1046 |
| 488 | Ga0496109_0168290 | 3300048912 | Bacteria | 2055 |
| 489 | Ga0496111_0133149 | 3300048914 | Bacteria | 1840 |
| 490 | Ga0496116_0027955 | 3300048919 | Bacteria | 4096 |
| 491 | Ga0496117_0060149 | 3300048920 | Bacteria | 2620 |
| 492 | Ga0496117_0067736 | 3300048920 | Bacteria | 2414 |
| 493 | Ga0496117_0068280 | 3300048920 | Bacteria | 2400 |
| 494 | Ga0496118_0007408 | 3300048921 | Bacteria | 11643 |
| 495 | Ga0496118_0007776 | 3300048921 | Bacteria | 11255 |
| 496 | Ga0496118_0142832 | 3300048921 | Bacteria | 1514 |
| 497 | Ga0496121_0008557 | 3300048924 | Bacteria | 11999 |
| 498 | Ga0496121_0107927 | 3300048924 | Bacteria | 2130 |
| 499 | Ga0496121_0162201 | 3300048924 | Bacteria | 1633 |
| 500 | Ga0496121_0198218 | 3300048924 | Bacteria | 1433 |
| 501 | Ga0496122_0002306 | 3300048925 | Bacteria | 27531 |
| 502 | Ga0496122_0294146 | 3300048925 | Bacteria | 880 |
| 503 | Ga0496123_0000631 | 3300048926 | Bacteria | 58934 |
| 504 | Ga0496123_0051214 | 3300048926 | Bacteria | 2751 |
| 505 | Ga0496124_0019022 | 3300048927 | Bacteria | 6410 |
| 506 | Ga0496124_0054996 | 3300048927 | Bacteria | 3366 |
| 507 | Ga0496124_0070695 | 3300048927 | Bacteria | 2894 |
| 508 | Ga0496124_0088696 | 3300048927 | Bacteria | 2527 |
| 509 | Ga0496125_0003351 | 3300048928 | Bacteria | 19512 |
| 510 | Ga0496125_0005808 | 3300048928 | Bacteria | 13553 |
| 511 | Ga0496125_0014076 | 3300048928 | Bacteria | 7818 |
| 512 | Ga0496125_0027115 | 3300048928 | Bacteria | 5200 |
| 513 | Ga0496125_0088516 | 3300048928 | Bacteria | 2333 |
| 514 | Ga0496125_0091791 | 3300048928 | Bacteria | 2273 |
| 515 | Ga0496126_0209117 | 3300048929 | Bacteria | 1644 |
| 516 | Ga0496126_0290439 | 3300048929 | Bacteria | 1352 |
| 517 | Ga0501034_0079060 | 3300049571 | Bacteria | 3292 |
| 518 | Ga0501034_0113067 | 3300049571 | Bacteria | 2705 |
| 519 | Ga0501034_0210259 | 3300049571 | Bacteria | 1901 |
| 520 | Ga0501043_0171303 | 3300049579 | Bacteria | 1694 |
| 521 | Ga0501043_0400205 | 3300049579 | Bacteria | 1038 |
| 522 | Ga0501046_0059645 | 3300049580 | Bacteria | 2988 |
| 523 | Ga0501074_0092268 | 3300049590 | Bacteria | 2169 |
| 524 | Ga0501208_044482 | 3300049655 | Bacteria | 831 |
| 525 | Ga0501249_004029 | 3300049679 | Bacteria | 2971 |
| 526 | Ga0501249_024272 | 3300049679 | Bacteria | 1335 |
| 527 | Ga0501225_0002587 | 3300049705 | Bacteria | 5564 |
| 528 | Ga0501262_000223 | 3300049759 | Bacteria | 6989 |
| 529 | Ga0501035_0032989 | 3300049822 | Bacteria | 4709 |
| 530 | Ga0501035_0103879 | 3300049822 | Bacteria | 2492 |
| 531 | Ga0501044_0305459 | 3300049823 | Bacteria | 1519 |
| 532 | Ga0501044_0348673 | 3300049823 | Bacteria | 1400 |
| 533 | Ga0501044_0649749 | 3300049823 | Bacteria | 944 |
| 534 | nmdc:mga03683_22738_c1 | 3300050489 | Bacteria | 2433 |
| 535 | nmdc:mga03683_6049_c2 | 3300050489 | Bacteria | 3736 |
| 536 | nmdc:mga03683_6664_c1 | 3300050489 | Bacteria | 3967 |
| 537 | nmdc:mga03n38_10324_c1 | 3300050490 | Bacteria | 3429 |
| 538 | nmdc:mga03n38_41288_c1 | 3300050490 | Bacteria | 2010 |
| 539 | nmdc:mga00v17_6053_c1 | 3300050491 | Bacteria | 6402 |
| 540 | nmdc:mga00v17_78903_c1 | 3300050491 | Bacteria | 2052 |
| 541 | nmdc:mga0yw44_161451_c1 | 3300050492 | Bacteria | 1467 |
| 542 | nmdc:mga0yw44_36061_c1 | 3300050492 | Bacteria | 2912 |
| 543 | nmdc:mga0k408_144878_c1 | 3300050493 | Bacteria | 1414 |
| 544 | nmdc:mga0k408_78342_c1 | 3300050493 | Bacteria | 1933 |
| 545 | nmdc:mga06z11_125475_c1 | 3300050494 | Bacteria | 1436 |
| 546 | nmdc:mga06z11_19009_c1 | 3300050494 | Bacteria | 3150 |
| 547 | nmdc:mga07m45_2557_c1 | 3300050496 | Bacteria | 8555 |
| 548 | nmdc:mga07m45_4055_c1 | 3300050496 | Bacteria | 7139 |
| 549 | nmdc:mga07m45_47424_c1 | 3300050496 | Bacteria | 2415 |
| 550 | nmdc:mga07m45_69746_c1 | 3300050496 | Bacteria | 1999 |
| 551 | nmdc:mga09592_204946_c1 | 3300050508 | Bacteria | 1708 |
| 552 | Ga0500644_0016667 | 3300053088 | Bacteria | 2118 |
| 553 | Ga0500651_0000147 | 3300053093 | Bacteria | 44659 |
| 554 | Ga0500651_0027596 | 3300053093 | Bacteria | 3571 |
| 555 | Ga0500566_0080319 | 3300053094 | Bacteria | 1816 |
| 556 | Ga0500641_0037790 | 3300053096 | Bacteria | 1937 |
| 557 | Ga0500571_000101 | 3300053110 | Bacteria | 28130 |
| 558 | Ga0500593_000677 | 3300053117 | Bacteria | 12925 |
| 559 | Ga0500593_002115 | 3300053117 | Bacteria | 7215 |
| 560 | Ga0500594_0003665 | 3300053118 | Bacteria | 3386 |
| 561 | Ga0500607_002039 | 3300053121 | Bacteria | 17010 |
| 562 | Ga0500626_011707 | 3300053128 | Bacteria | 3732 |
| 563 | Ga0500628_004489 | 3300053129 | Bacteria | 2311 |
| 564 | Ga0500655_007262 | 3300053133 | Bacteria | 1992 |
| 565 | Ga0500658_0002085 | 3300053134 | Bacteria | 7778 |
| 566 | Ga0500658_0002814 | 3300053134 | Bacteria | 6672 |
| 567 | Ga0500559_0001099 | 3300053136 | Bacteria | 16348 |
| 568 | Ga0500568_0000929 | 3300053139 | Bacteria | 20199 |
| 569 | Ga0500573_0125717 | 3300053140 | Bacteria | 1424 |
| 570 | Ga0500574_003073 | 3300053141 | Bacteria | 2877 |
| 571 | Ga0500634_0052477 | 3300053161 | Bacteria | 2189 |
| 572 | Ga0500634_0070379 | 3300053161 | Bacteria | 1832 |
| 573 | Ga0500634_0104913 | 3300053161 | Bacteria | 1407 |
| 574 | Ga0500638_004507 | 3300053162 | Bacteria | 5382 |
| 575 | Ga0500636_0061311 | 3300053177 | Bacteria | 2195 |
| 576 | Ga0500645_001451 | 3300053730 | Bacteria | 11991 |
| 577 | Ga0500645_034727 | 3300053730 | Bacteria | 1505 |
| 578 | Ga0590077_017000 | 3300059426 | Bacteria | 1528 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042004 | Ga0439445_0047283 | Ga0439445_0047283_454_1140 | 228 |
| 2 | 3300042123 | Ga0450921_005965 | Ga0450921_005965_18_704 | 228 |
| 3 | 3300046557 | Ga0495622_0102540 | Ga0495622_0102540_18_704 | 228 |
| 4 | 3300049655 | Ga0501208_044482 | Ga0501208_044482_24_710 | 228 |
| 5 | 3300042142 | Ga0450905_027495 | Ga0450905_027495_18_767 | 248 |
| 6 | 3300046674 | Ga0495588_0144673 | Ga0495588_0144673_472_1242 | 255 |
| 7 | 3300046684 | Ga0495669_0133332 | Ga0495669_0133332_10_780 | 255 |
| 8 | 3300042115 | Ga0450911_000378 | Ga0450911_000378_4883_5698 | 259 |
| 9 | 3300042127 | Ga0450890_018350 | Ga0450890_018350_20_835 | 259 |
| 10 | 3300031731 | Ga0307405_10465904 | Ga0307405_104659041 | 260 |
| 11 | 3300002987 | JGI25159J45721_1000904 | JGI25159J45721_10009045 | 261 |
| 12 | 3300003354 | JGI25160J50197_1000768 | JGI25160J50197_10007684 | 261 |
| 13 | 3300003374 | JGI25161J50226_1000007 | JGI25161J50226_1000007132 | 261 |
| 14 | 3300005262 | Ga0065165_1009126 | Ga0065165_10091262 | 261 |
| 15 | 3300050489 | nmdc:mga03683_6049_c2 | nmdc:mga03683_6049_c2_1136_1921 | 261 |
| 16 | 3300050496 | nmdc:mga07m45_47424_c1 | nmdc:mga07m45_47424_c1_1370_2155 | 261 |
| 17 | 3300053088 | Ga0500644_0016667 | Ga0500644_0016667_745_1530 | 261 |
| 18 | 3300053093 | Ga0500651_0027596 | Ga0500651_0027596_385_1170 | 261 |
| 19 | 3300053094 | Ga0500566_0080319 | Ga0500566_0080319_293_1078 | 261 |
| 20 | 3300053117 | Ga0500593_000677 | Ga0500593_000677_11866_12651 | 261 |
| 21 | 3300053129 | Ga0500628_004489 | Ga0500628_004489_1149_1934 | 261 |
| 22 | 3300053730 | Ga0500645_001451 | Ga0500645_001451_5898_6683 | 261 |
| 23 | 3300053730 | Ga0500645_034727 | Ga0500645_034727_607_1392 | 261 |
| 24 | 3300049571 | Ga0501034_0113067 | Ga0501034_0113067_1157_1945 | 262 |
| 25 | 3300049579 | Ga0501043_0400205 | Ga0501043_0400205_209_997 | 262 |
| 26 | 3300046525 | Ga0495663_0011145 | Ga0495663_0011145_737_1531 | 264 |
| 27 | 3300046558 | Ga0495633_0003589 | Ga0495633_0003589_7864_8658 | 264 |
| 28 | 3300048905 | Ga0496102_0280418 | Ga0496102_0280418_577_1374 | 264 |
| 29 | iso_pu_bacteria | 2511231002 | 2511245372 | 264 |
| 30 | iso_pu_bacteria | 2919704043 | 2919706029 | 264 |
| 31 | iso_pu_bacteria | 2513020051 | 2513226921 | 267 |
| 32 | iso_pu_bacteria | 2599185214 | 2599621725 | 267 |
| 33 | iso_pu_bacteria | 2599185226 | 2599670591 | 267 |
| 34 | iso_pu_bacteria | 2599185227 | 2599679081 | 267 |
| 35 | iso_pu_bacteria | 2599185229 | 2599691236 | 267 |
| 36 | iso_pu_bacteria | 2643221570 | 2643864566 | 267 |
| 37 | iso_pu_bacteria | 2643221596 | 2643992822 | 267 |
| 38 | iso_pu_bacteria | 2643221628 | 2644163658 | 267 |
| 39 | iso_pu_bacteria | 2643221652 | 2644296360 | 267 |
| 40 | iso_pu_bacteria | 2643221658 | 2644327112 | 267 |
| 41 | iso_pu_bacteria | 2643221672 | 2644398912 | 267 |
| 42 | iso_pu_bacteria | 2643221683 | 2644465863 | 267 |
| 43 | iso_pu_bacteria | 2738541277 | 2738721792 | 267 |
| 44 | iso_pu_bacteria | 2738541307 | 2738881964 | 267 |
| 45 | iso_pu_bacteria | 2738543012 | 2739244401 | 267 |
| 46 | iso_pu_bacteria | 2738543013 | 2739247758 | 267 |
| 47 | iso_pu_bacteria | 2738543019 | 2739282156 | 267 |
| 48 | iso_pu_bacteria | 2816332133 | 2816469832 | 267 |
| 49 | iso_pu_bacteria | 2818991446 | 2819597897 | 267 |
| 50 | iso_pu_bacteria | 2831265667 | 2831268873 | 267 |
| 51 | iso_pu_bacteria | 2838054893 | 2838058311 | 267 |
| 52 | iso_pu_bacteria | 2842677519 | 2842678230 | 267 |
| 53 | iso_pu_bacteria | 2842718218 | 2842720830 | 267 |
| 54 | iso_pu_bacteria | 2842733646 | 2842738660 | 267 |
| 55 | iso_pu_bacteria | 2842747753 | 2842750161 | 267 |
| 56 | iso_pu_bacteria | 2885192300 | 2885194426 | 267 |
| 57 | iso_pu_bacteria | 2885198086 | 2885203960 | 267 |
| 58 | iso_pu_bacteria | 2885211737 | 2885217705 | 267 |
| 59 | iso_pu_bacteria | 2887375801 | 2887379597 | 267 |
| 60 | iso_pu_bacteria | 2894023352 | 2894027784 | 267 |
| 61 | iso_pu_bacteria | 2899924645 | 2899929316 | 267 |
| 62 | iso_pu_bacteria | 2904449895 | 2904451191 | 267 |
| 63 | iso_pu_bacteria | 2904456579 | 2904458045 | 267 |
| 64 | iso_pu_bacteria | 2904541872 | 2904542820 | 267 |
| 65 | iso_pu_bacteria | 2919462493 | 2919465609 | 267 |
| 66 | iso_pu_bacteria | 2928037797 | 2928040242 | 267 |
| 67 | iso_pu_bacteria | 2928044640 | 2928047009 | 267 |
| 68 | iso_pu_bacteria | 2928051484 | 2928057785 | 267 |
| 69 | iso_pu_bacteria | 2928064002 | 2928067832 | 267 |
| 70 | iso_pu_bacteria | 2928070936 | 2928072392 | 267 |
| 71 | iso_pu_bacteria | 2928084124 | 2928085594 | 267 |
| 72 | iso_pu_bacteria | 2928115317 | 2928116705 | 267 |
| 73 | iso_pu_bacteria | 2929160207 | 2929166240 | 267 |
| 74 | iso_pu_bacteria | 2929520902 | 2929526342 | 267 |
| 75 | iso_pu_bacteria | 2932422444 | 2932422519 | 267 |
| 76 | iso_pu_bacteria | 2939631187 | 2939634565 | 267 |
| 77 | iso_pu_bacteria | 2945909444 | 2945915081 | 267 |
| 78 | iso_pu_bacteria | 2945945610 | 2945950895 | 267 |
| 79 | iso_pu_bacteria | 2945972063 | 2945974468 | 267 |
| 80 | iso_pu_bacteria | 2945984333 | 2945989509 | 267 |
| 81 | iso_pu_bacteria | 2954767861 | 2954769705 | 267 |
| 82 | iso_pu_bacteria | 2974320154 | 2974321699 | 267 |
| 83 | iso_pu_bacteria | 2990710928 | 2990715146 | 267 |
| 84 | 3300002705 | JGI25156J39149_1000024 | JGI25156J39149_100002442 | 268 |
| 85 | 3300002738 | JGI25154J39366_1000043 | JGI25154J39366_100004343 | 268 |
| 86 | 3300002741 | JGI25157J39369_1000031 | JGI25157J39369_100003186 | 268 |
| 87 | 3300002987 | JGI25159J45721_1001700 | JGI25159J45721_10017003 | 268 |
| 88 | 3300003187 | JGI25151J46595_10006874 | JGI25151J46595_100068743 | 268 |
| 89 | 3300003187 | JGI25151J46595_10007855 | JGI25151J46595_100078552 | 268 |
| 90 | 3300003771 | Ga0055526_1000974 | Ga0055526_100097413 | 268 |
| 91 | 3300003771 | Ga0055526_1009192 | Ga0055526_10091923 | 268 |
| 92 | 3300003771 | Ga0055526_1041538 | Ga0055526_10415381 | 268 |
| 93 | 3300003773 | Ga0055537_1000328 | Ga0055537_100032818 | 268 |
| 94 | 3300003775 | Ga0055524_1000101 | Ga0055524_100010165 | 268 |
| 95 | 3300003781 | Ga0055536_1001356 | Ga0055536_10013564 | 268 |
| 96 | 3300003784 | Ga0055534_1002898 | Ga0055534_10028982 | 268 |
| 97 | 3300003790 | Ga0055528_1002223 | Ga0055528_10022236 | 268 |
| 98 | 3300003791 | Ga0055530_10000251 | Ga0055530_1000025111 | 268 |
| 99 | 3300003792 | Ga0055540_1000099 | Ga0055540_100009922 | 268 |
| 100 | 3300003794 | Ga0055531_10000333 | Ga0055531_100003339 | 268 |
| 101 | 3300003794 | Ga0055531_10000739 | Ga0055531_1000073912 | 268 |
| 102 | 3300004625 | Ga0055543_1000061 | Ga0055543_100006134 | 268 |
| 103 | 3300005262 | Ga0065165_1009124 | Ga0065165_10091242 | 268 |
| 104 | 3300005327 | Ga0070658_10189340 | Ga0070658_101893402 | 268 |
| 105 | 3300005334 | Ga0068869_100035005 | Ga0068869_1000350051 | 268 |
| 106 | 3300005467 | Ga0070706_100142283 | Ga0070706_1001422832 | 268 |
| 107 | 3300005468 | Ga0070707_100077962 | Ga0070707_1000779622 | 268 |
| 108 | 3300005530 | Ga0070679_100017454 | Ga0070679_1000174542 | 268 |
| 109 | 3300005539 | Ga0068853_100080193 | Ga0068853_1000801932 | 268 |
| 110 | 3300005563 | Ga0068855_100004794 | Ga0068855_1000047943 | 268 |
| 111 | 3300005563 | Ga0068855_100149807 | Ga0068855_1001498072 | 268 |
| 112 | 3300005563 | Ga0068855_100853395 | Ga0068855_1008533951 | 268 |
| 113 | 3300005577 | Ga0068857_100338808 | Ga0068857_1003388082 | 268 |
| 114 | 3300005618 | Ga0068864_100070701 | Ga0068864_1000707012 | 268 |
| 115 | 3300005834 | Ga0068851_10311800 | Ga0068851_103118002 | 268 |
| 116 | 3300005841 | Ga0068863_100055874 | Ga0068863_1000558742 | 268 |
| 117 | 3300006038 | Ga0075365_10035431 | Ga0075365_100354312 | 268 |
| 118 | 3300006038 | Ga0075365_10088259 | Ga0075365_100882592 | 268 |
| 119 | 3300006051 | Ga0075364_10010882 | Ga0075364_100108824 | 268 |
| 120 | 3300006353 | Ga0075370_10068238 | Ga0075370_100682382 | 268 |
| 121 | 3300006880 | Ga0075429_100463784 | Ga0075429_1004637842 | 268 |
| 122 | 3300009093 | Ga0105240_10016619 | Ga0105240_100166196 | 268 |
| 123 | 3300009174 | Ga0105241_10033011 | Ga0105241_100330112 | 268 |
| 124 | 3300010375 | Ga0105239_10087691 | Ga0105239_100876912 | 268 |
| 125 | 3300014969 | Ga0157376_10022727 | Ga0157376_100227272 | 268 |
| 126 | 3300025206 | Ga0209435_100008 | Ga0209435_100008371 | 268 |
| 127 | 3300025245 | Ga0207425_1000418 | Ga0207425_100041817 | 268 |
| 128 | 3300025245 | Ga0207425_1001693 | Ga0207425_10016937 | 268 |
| 129 | 3300025246 | Ga0209646_1000079 | Ga0209646_100007994 | 268 |
| 130 | 3300025250 | Ga0209026_1000067 | Ga0209026_100006794 | 268 |
| 131 | 3300025256 | Ga0209759_1000056 | Ga0209759_100005694 | 268 |
| 132 | 3300025263 | Ga0209565_1000041 | Ga0209565_100004173 | 268 |
| 133 | 3300025263 | Ga0209565_1000538 | Ga0209565_10005382 | 268 |
| 134 | 3300025273 | Ga0209673_1000364 | Ga0209673_100036464 | 268 |
| 135 | 3300025284 | Ga0209130_1000245 | Ga0209130_100024553 | 268 |
| 136 | 3300025284 | Ga0209130_1001381 | Ga0209130_10013812 | 268 |
| 137 | 3300025291 | Ga0209675_1000316 | Ga0209675_10003163 | 268 |
| 138 | 3300025292 | Ga0209676_1000013 | Ga0209676_1000013308 | 268 |
| 139 | 3300025292 | Ga0209676_1004083 | Ga0209676_10040832 | 268 |
| 140 | 3300025294 | Ga0209025_1002942 | Ga0209025_10029426 | 268 |
| 141 | 3300025294 | Ga0209025_1005362 | Ga0209025_10053622 | 268 |
| 142 | 3300025294 | Ga0209025_1010723 | Ga0209025_10107232 | 268 |
| 143 | 3300025294 | Ga0209025_1017822 | Ga0209025_10178222 | 268 |
| 144 | 3300025295 | Ga0209564_1000363 | Ga0209564_100036338 | 268 |
| 145 | 3300025295 | Ga0209564_1001188 | Ga0209564_100118816 | 268 |
| 146 | 3300025295 | Ga0209564_1004998 | Ga0209564_10049982 | 268 |
| 147 | 3300025297 | Ga0209758_1011662 | Ga0209758_10116625 | 268 |
| 148 | 3300025298 | Ga0209050_1000008 | Ga0209050_1000008308 | 268 |
| 149 | 3300025298 | Ga0209050_1007985 | Ga0209050_10079852 | 268 |
| 150 | 3300025298 | Ga0209050_1010818 | Ga0209050_10108182 | 268 |
| 151 | 3300025299 | Ga0209256_1000003 | Ga0209256_100000393 | 268 |
| 152 | 3300025302 | Ga0207426_1000091 | Ga0207426_100009187 | 268 |
| 153 | 3300025303 | Ga0209051_1000005 | Ga0209051_1000005308 | 268 |
| 154 | 3300025303 | Ga0209051_1000214 | Ga0209051_100021434 | 268 |
| 155 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015359 | 268 |
| 156 | 3300025304 | Ga0209257_1000048 | Ga0209257_1000048308 | 268 |
| 157 | 3300025304 | Ga0209257_1005996 | Ga0209257_10059962 | 268 |
| 158 | 3300025911 | Ga0207654_10018323 | Ga0207654_100183232 | 268 |
| 159 | 3300025912 | Ga0207707_10070703 | Ga0207707_100707032 | 268 |
| 160 | 3300025925 | Ga0207650_10368350 | Ga0207650_103683502 | 268 |
| 161 | 3300025929 | Ga0207664_10481326 | Ga0207664_104813262 | 268 |
| 162 | 3300025949 | Ga0207667_10018493 | Ga0207667_100184933 | 268 |
| 163 | 3300025949 | Ga0207667_10096535 | Ga0207667_100965352 | 268 |
| 164 | 3300026023 | Ga0207677_10009193 | Ga0207677_100091932 | 268 |
| 165 | 3300026088 | Ga0207641_10044213 | Ga0207641_100442132 | 268 |
| 166 | 3300026095 | Ga0207676_10057590 | Ga0207676_100575902 | 268 |
| 167 | 3300026116 | Ga0207674_10243233 | Ga0207674_102432332 | 268 |
| 168 | 3300027614 | Ga0209970_1000057 | Ga0209970_10000572 | 268 |
| 169 | 3300027876 | Ga0209974_10039512 | Ga0209974_100395122 | 268 |
| 170 | 3300028380 | Ga0268265_10437697 | Ga0268265_104376971 | 268 |
| 171 | 3300031456 | Ga0307513_10000013 | Ga0307513_10000013148 | 268 |
| 172 | 3300031548 | Ga0307408_100059781 | Ga0307408_1000597812 | 268 |
| 173 | 3300031711 | Ga0265314_10014961 | Ga0265314_100149613 | 268 |
| 174 | 3300031712 | Ga0265342_10177995 | Ga0265342_101779952 | 268 |
| 175 | 3300031730 | Ga0307516_10010885 | Ga0307516_100108852 | 268 |
| 176 | 3300031901 | Ga0307406_10009252 | Ga0307406_100092522 | 268 |
| 177 | 3300031911 | Ga0307412_10113179 | Ga0307412_101131792 | 268 |
| 178 | 3300032005 | Ga0307411_10298610 | Ga0307411_102986102 | 268 |
| 179 | 3300037312 | Ga0395899_0004093 | Ga0395899_0004093_6967_7773 | 268 |
| 180 | 3300037312 | Ga0395899_0005604 | Ga0395899_0005604_966_1775 | 268 |
| 181 | 3300037418 | Ga0395900_0009645 | Ga0395900_0009645_1617_2423 | 268 |
| 182 | 3300037418 | Ga0395900_0029613 | Ga0395900_0029613_1933_2745 | 268 |
| 183 | 3300037418 | Ga0395900_0295912 | Ga0395900_0295912_349_1155 | 268 |
| 184 | 3300037466 | Ga0395898_0008291 | Ga0395898_0008291_8073_8882 | 268 |
| 185 | 3300037466 | Ga0395898_0011141 | Ga0395898_0011141_3118_3924 | 268 |
| 186 | 3300037471 | Ga0395905_0000047 | Ga0395905_0000047_210260_211066 | 268 |
| 187 | 3300037471 | Ga0395905_0003373 | Ga0395905_0003373_1829_2635 | 268 |
| 188 | 3300037471 | Ga0395905_0021306 | Ga0395905_0021306_3262_4068 | 268 |
| 189 | 3300037471 | Ga0395905_0025494 | Ga0395905_0025494_4498_5304 | 268 |
| 190 | 3300037471 | Ga0395905_0047730 | Ga0395905_0047730_2598_3404 | 268 |
| 191 | 3300037471 | Ga0395905_0069200 | Ga0395905_0069200_1569_2378 | 268 |
| 192 | 3300037471 | Ga0395905_0268017 | Ga0395905_0268017_431_1243 | 268 |
| 193 | 3300037471 | Ga0395905_0644139 | Ga0395905_0644139_133_939 | 268 |
| 194 | 3300038443 | Ga0395901_0011214 | Ga0395901_0011214_4793_5599 | 268 |
| 195 | 3300038443 | Ga0395901_0098912 | Ga0395901_0098912_691_1500 | 268 |
| 196 | 3300041408 | Ga0439453_0007236 | Ga0439453_0007236_906_1715 | 268 |
| 197 | 3300042001 | Ga0439441_020509 | Ga0439441_020509_301_1110 | 268 |
| 198 | 3300042007 | Ga0439449_0002256 | Ga0439449_0002256_3231_4040 | 268 |
| 199 | 3300042014 | Ga0439457_020332 | Ga0439457_020332_330_1139 | 268 |
| 200 | 3300042015 | Ga0439462_0015839 | Ga0439462_0015839_684_1493 | 268 |
| 201 | 3300042156 | Ga0439446_0083243 | Ga0439446_0083243_132_941 | 268 |
| 202 | 3300042439 | Ga0439464_0007913 | Ga0439464_0007913_377_1186 | 268 |
| 203 | 3300042876 | Ga0451577_0000126 | Ga0451577_0000126_62664_63479 | 268 |
| 204 | 3300042876 | Ga0451577_0025518 | Ga0451577_0025518_594_1400 | 268 |
| 205 | 3300044656 | Ga0466969_0029606 | Ga0466969_0029606_1312_2118 | 268 |
| 206 | 3300044673 | Ga0453683_0013716 | Ga0453683_0013716_3719_4528 | 268 |
| 207 | 3300044684 | Ga0466966_0114593 | Ga0466966_0114593_662_1468 | 268 |
| 208 | 3300044693 | Ga0466961_0074220 | Ga0466961_0074220_1182_1988 | 268 |
| 209 | 3300044712 | Ga0453684_0000365 | Ga0453684_0000365_69989_70804 | 268 |
| 210 | 3300044712 | Ga0453684_0125592 | Ga0453684_0125592_1209_2015 | 268 |
| 211 | 3300044765 | Ga0466970_0037469 | Ga0466970_0037469_1754_2560 | 268 |
| 212 | 3300044842 | Ga0466957_0073868 | Ga0466957_0073868_362_1171 | 268 |
| 213 | 3300045049 | Ga0466959_0205503 | Ga0466959_0205503_71_880 | 268 |
| 214 | 3300045051 | Ga0451576_0000627 | Ga0451576_0000627_63664_64479 | 268 |
| 215 | 3300045051 | Ga0451576_0005543 | Ga0451576_0005543_8574_9383 | 268 |
| 216 | 3300045051 | Ga0451576_0071836 | Ga0451576_0071836_2295_3101 | 268 |
| 217 | 3300046558 | Ga0495633_0041532 | Ga0495633_0041532_724_1533 | 268 |
| 218 | 3300046615 | Ga0495656_0023666 | Ga0495656_0023666_217_1026 | 268 |
| 219 | 3300047447 | Ga0495685_027928 | Ga0495685_027928_1089_1898 | 268 |
| 220 | 3300048911 | Ga0496108_0228012 | Ga0496108_0228012_389_1195 | 268 |
| 221 | 3300049571 | Ga0501034_0079060 | Ga0501034_0079060_1639_2445 | 268 |
| 222 | 3300049579 | Ga0501043_0171303 | Ga0501043_0171303_349_1155 | 268 |
| 223 | 3300049580 | Ga0501046_0059645 | Ga0501046_0059645_1724_2530 | 268 |
| 224 | 3300049590 | Ga0501074_0092268 | Ga0501074_0092268_1146_1952 | 268 |
| 225 | 3300049679 | Ga0501249_024272 | Ga0501249_024272_360_1169 | 268 |
| 226 | 3300049822 | Ga0501035_0032989 | Ga0501035_0032989_1968_2774 | 268 |
| 227 | 3300049822 | Ga0501035_0103879 | Ga0501035_0103879_272_1081 | 268 |
| 228 | 3300049823 | Ga0501044_0348673 | Ga0501044_0348673_529_1338 | 268 |
| 229 | 3300049823 | Ga0501044_0649749 | Ga0501044_0649749_42_851 | 268 |
| 230 | 3300050492 | nmdc:mga0yw44_161451_c1 | nmdc:mga0yw44_161451_c1_260_1069 | 268 |
| 231 | 3300050508 | nmdc:mga09592_204946_c1 | nmdc:mga09592_204946_c1_261_1070 | 268 |
| 232 | 3300059426 | Ga0590077_017000 | Ga0590077_017000_314_1123 | 268 |
| 233 | iso_pu_bacteria | 2547132374 | 2548500461 | 268 |
| 234 | iso_pu_bacteria | 2643221717 | 2644646992 | 268 |
| 235 | 3300048924 | Ga0496121_0008557 | Ga0496121_0008557_10275_11087 | 270 |
| 236 | 3300048925 | Ga0496122_0294146 | Ga0496122_0294146_49_861 | 270 |
| 237 | 3300048928 | Ga0496125_0027115 | Ga0496125_0027115_142_954 | 270 |
| 238 | 3300001979 | JGI24740J21852_10009520 | JGI24740J21852_100095202 | 271 |
| 239 | 3300001989 | JGI24739J22299_10007263 | JGI24739J22299_100072632 | 271 |
| 240 | 3300001989 | JGI24739J22299_10033104 | JGI24739J22299_100331042 | 271 |
| 241 | 3300002739 | JGI25158J39367_1005551 | JGI25158J39367_10055511 | 271 |
| 242 | 3300002739 | JGI25158J39367_1007034 | JGI25158J39367_10070342 | 271 |
| 243 | 3300002773 | JGI25152J39213_1004060 | JGI25152J39213_10040602 | 271 |
| 244 | 3300002773 | JGI25152J39213_1013640 | JGI25152J39213_10136402 | 271 |
| 245 | 3300002774 | JGI25150J39212_1005028 | JGI25150J39212_10050282 | 271 |
| 246 | 3300002987 | JGI25159J45721_1008872 | JGI25159J45721_10088722 | 271 |
| 247 | 3300002987 | JGI25159J45721_1009866 | JGI25159J45721_10098662 | 271 |
| 248 | 3300003187 | JGI25151J46595_10001517 | JGI25151J46595_1000151710 | 271 |
| 249 | 3300003187 | JGI25151J46595_10004727 | JGI25151J46595_100047272 | 271 |
| 250 | 3300003187 | JGI25151J46595_10013246 | JGI25151J46595_100132463 | 271 |
| 251 | 3300003187 | JGI25151J46595_10023959 | JGI25151J46595_100239592 | 271 |
| 252 | 3300003215 | JGI25153J46596_10020431 | JGI25153J46596_100204312 | 271 |
| 253 | 3300003316 | rootH1_10012410 | rootH1_100124108 | 271 |
| 254 | 3300003320 | rootH2_10008704 | rootH2_100087042 | 271 |
| 255 | 3300003320 | rootH2_10008705 | rootH2_100087052 | 271 |
| 256 | 3300003322 | rootL2_10089357 | rootL2_100893572 | 271 |
| 257 | 3300003354 | JGI25160J50197_1026910 | JGI25160J50197_10269102 | 271 |
| 258 | 3300003354 | JGI25160J50197_1030306 | JGI25160J50197_10303062 | 271 |
| 259 | 3300003374 | JGI25161J50226_1001559 | JGI25161J50226_10015593 | 271 |
| 260 | 3300003374 | JGI25161J50226_1012310 | JGI25161J50226_10123101 | 271 |
| 261 | 3300003578 | Ga0006562J51391_1058358 | Ga0006562J51391_10583585 | 271 |
| 262 | 3300003578 | Ga0006562J51391_1058359 | Ga0006562J51391_10583592 | 271 |
| 263 | 3300003761 | Ga0055535_1000542 | Ga0055535_100054229 | 271 |
| 264 | 3300003762 | Ga0055542_1000003 | Ga0055542_1000003178 | 271 |
| 265 | 3300003771 | Ga0055526_1030423 | Ga0055526_10304232 | 271 |
| 266 | 3300003771 | Ga0055526_1033425 | Ga0055526_10334252 | 271 |
| 267 | 3300003773 | Ga0055537_1000137 | Ga0055537_100013737 | 271 |
| 268 | 3300003773 | Ga0055537_1013112 | Ga0055537_10131122 | 271 |
| 269 | 3300003773 | Ga0055537_1014659 | Ga0055537_10146592 | 271 |
| 270 | 3300003775 | Ga0055524_1019857 | Ga0055524_10198572 | 271 |
| 271 | 3300003775 | Ga0055524_1021192 | Ga0055524_10211922 | 271 |
| 272 | 3300003781 | Ga0055536_1002973 | Ga0055536_10029734 | 271 |
| 273 | 3300003781 | Ga0055536_1012962 | Ga0055536_10129622 | 271 |
| 274 | 3300003784 | Ga0055534_1000118 | Ga0055534_100011837 | 271 |
| 275 | 3300003784 | Ga0055534_1001345 | Ga0055534_10013455 | 271 |
| 276 | 3300003784 | Ga0055534_1004575 | Ga0055534_10045752 | 271 |
| 277 | 3300003784 | Ga0055534_1005179 | Ga0055534_10051792 | 271 |
| 278 | 3300003790 | Ga0055528_1000152 | Ga0055528_100015235 | 271 |
| 279 | 3300003790 | Ga0055528_1011265 | Ga0055528_10112652 | 271 |
| 280 | 3300003791 | Ga0055530_10001323 | Ga0055530_100013236 | 271 |
| 281 | 3300003791 | Ga0055530_10011121 | Ga0055530_100111212 | 271 |
| 282 | 3300003792 | Ga0055540_1001243 | Ga0055540_10012436 | 271 |
| 283 | 3300003792 | Ga0055540_1001728 | Ga0055540_10017282 | 271 |
| 284 | 3300003792 | Ga0055540_1001887 | Ga0055540_10018874 | 271 |
| 285 | 3300003792 | Ga0055540_1009727 | Ga0055540_10097272 | 271 |
| 286 | 3300003792 | Ga0055540_1025462 | Ga0055540_10254622 | 271 |
| 287 | 3300003794 | Ga0055531_10007097 | Ga0055531_100070972 | 271 |
| 288 | 3300003794 | Ga0055531_10007150 | Ga0055531_100071502 | 271 |
| 289 | 3300003794 | Ga0055531_10036085 | Ga0055531_100360852 | 271 |
| 290 | 3300003794 | Ga0055531_10039140 | Ga0055531_100391402 | 271 |
| 291 | 3300004625 | Ga0055543_1003323 | Ga0055543_10033234 | 271 |
| 292 | 3300005262 | Ga0065165_1008540 | Ga0065165_10085404 | 271 |
| 293 | 3300005288 | Ga0065714_10020927 | Ga0065714_100209272 | 271 |
| 294 | 3300005327 | Ga0070658_10071203 | Ga0070658_100712032 | 271 |
| 295 | 3300005327 | Ga0070658_10094800 | Ga0070658_100948002 | 271 |
| 296 | 3300005333 | Ga0070677_10022212 | Ga0070677_100222122 | 271 |
| 297 | 3300005347 | Ga0070668_100094738 | Ga0070668_1000947382 | 271 |
| 298 | 3300005353 | Ga0070669_100036807 | Ga0070669_1000368072 | 271 |
| 299 | 3300005356 | Ga0070674_100216244 | Ga0070674_1002162442 | 271 |
| 300 | 3300005364 | Ga0070673_100035285 | Ga0070673_1000352852 | 271 |
| 301 | 3300005366 | Ga0070659_100148239 | Ga0070659_1001482392 | 271 |
| 302 | 3300005366 | Ga0070659_100353246 | Ga0070659_1003532462 | 271 |
| 303 | 3300005456 | Ga0070678_100043169 | Ga0070678_1000431692 | 271 |
| 304 | 3300005456 | Ga0070678_100086090 | Ga0070678_1000860902 | 271 |
| 305 | 3300005459 | Ga0068867_100077165 | Ga0068867_1000771652 | 271 |
| 306 | 3300005539 | Ga0068853_100012346 | Ga0068853_1000123462 | 271 |
| 307 | 3300005539 | Ga0068853_100109410 | Ga0068853_1001094102 | 271 |
| 308 | 3300005543 | Ga0070672_100062016 | Ga0070672_1000620162 | 271 |
| 309 | 3300005548 | Ga0070665_100256697 | Ga0070665_1002566972 | 271 |
| 310 | 3300005548 | Ga0070665_100486874 | Ga0070665_1004868742 | 271 |
| 311 | 3300005563 | Ga0068855_100015273 | Ga0068855_1000152739 | 271 |
| 312 | 3300005564 | Ga0070664_100029916 | Ga0070664_1000299162 | 271 |
| 313 | 3300005577 | Ga0068857_100038245 | Ga0068857_1000382451 | 271 |
| 314 | 3300005577 | Ga0068857_100310948 | Ga0068857_1003109482 | 271 |
| 315 | 3300005578 | Ga0068854_100175185 | Ga0068854_1001751852 | 271 |
| 316 | 3300005844 | Ga0068862_100024710 | Ga0068862_1000247103 | 271 |
| 317 | 3300006038 | Ga0075365_10040833 | Ga0075365_100408332 | 271 |
| 318 | 3300006038 | Ga0075365_10180673 | Ga0075365_101806732 | 271 |
| 319 | 3300006048 | Ga0075363_100002936 | Ga0075363_1000029362 | 271 |
| 320 | 3300006048 | Ga0075363_100009667 | Ga0075363_1000096672 | 271 |
| 321 | 3300006048 | Ga0075363_100131366 | Ga0075363_1001313662 | 271 |
| 322 | 3300006051 | Ga0075364_10007902 | Ga0075364_100079023 | 271 |
| 323 | 3300006051 | Ga0075364_10020489 | Ga0075364_100204892 | 271 |
| 324 | 3300006058 | Ga0075432_10044455 | Ga0075432_100444552 | 271 |
| 325 | 3300006177 | Ga0075362_10010620 | Ga0075362_100106202 | 271 |
| 326 | 3300006177 | Ga0075362_10034478 | Ga0075362_100344782 | 271 |
| 327 | 3300006178 | Ga0075367_10105522 | Ga0075367_101055222 | 271 |
| 328 | 3300006186 | Ga0075369_10062102 | Ga0075369_100621021 | 271 |
| 329 | 3300006195 | Ga0075366_10023521 | Ga0075366_100235212 | 271 |
| 330 | 3300006195 | Ga0075366_10153939 | Ga0075366_101539392 | 271 |
| 331 | 3300006195 | Ga0075366_10276515 | Ga0075366_102765152 | 271 |
| 332 | 3300006237 | Ga0097621_100175774 | Ga0097621_1001757742 | 271 |
| 333 | 3300006353 | Ga0075370_10001072 | Ga0075370_100010725 | 271 |
| 334 | 3300006353 | Ga0075370_10004593 | Ga0075370_100045932 | 271 |
| 335 | 3300006353 | Ga0075370_10052346 | Ga0075370_100523462 | 271 |
| 336 | 3300006353 | Ga0075370_10078624 | Ga0075370_100786242 | 271 |
| 337 | 3300006353 | Ga0075370_10187686 | Ga0075370_101876862 | 271 |
| 338 | 3300006946 | Ga0079104_1007224 | Ga0079104_10072242 | 271 |
| 339 | 3300006948 | Ga0099826_10000746 | Ga0099826_1000074610 | 271 |
| 340 | 3300009148 | Ga0105243_10000787 | Ga0105243_1000078711 | 271 |
| 341 | 3300009148 | Ga0105243_10006024 | Ga0105243_100060242 | 271 |
| 342 | 3300009148 | Ga0105243_10239941 | Ga0105243_102399411 | 271 |
| 343 | 3300009551 | Ga0105238_10401749 | Ga0105238_104017492 | 271 |
| 344 | 3300011119 | Ga0105246_10033388 | Ga0105246_100333882 | 271 |
| 345 | 3300013100 | Ga0157373_10008247 | Ga0157373_100082473 | 271 |
| 346 | 3300013102 | Ga0157371_10019901 | Ga0157371_100199012 | 271 |
| 347 | 3300013104 | Ga0157370_10005598 | Ga0157370_100055983 | 271 |
| 348 | 3300013105 | Ga0157369_10042153 | Ga0157369_100421532 | 271 |
| 349 | 3300013306 | Ga0163162_10039046 | Ga0163162_100390462 | 271 |
| 350 | 3300013307 | Ga0157372_10036824 | Ga0157372_100368242 | 271 |
| 351 | 3300014497 | Ga0182008_10000871 | Ga0182008_100008717 | 271 |
| 352 | 3300014497 | Ga0182008_10004373 | Ga0182008_100043734 | 271 |
| 353 | 3300014497 | Ga0182008_10006756 | Ga0182008_100067562 | 271 |
| 354 | 3300014497 | Ga0182008_10087380 | Ga0182008_100873802 | 271 |
| 355 | 3300015261 | Ga0182006_1004055 | Ga0182006_10040558 | 271 |
| 356 | 3300015261 | Ga0182006_1039701 | Ga0182006_10397012 | 271 |
| 357 | 3300015261 | Ga0182006_1048403 | Ga0182006_10484032 | 271 |
| 358 | 3300015262 | Ga0182007_10000609 | Ga0182007_1000060910 | 271 |
| 359 | 3300015262 | Ga0182007_10002723 | Ga0182007_100027232 | 271 |
| 360 | 3300015265 | Ga0182005_1048127 | Ga0182005_10481271 | 271 |
| 361 | 3300015683 | Ga0183362_10004 | Ga0183362_1000499 | 271 |
| 362 | 3300017792 | Ga0163161_10001481 | Ga0163161_1000148110 | 271 |
| 363 | 3300017792 | Ga0163161_10014836 | Ga0163161_100148362 | 271 |
| 364 | 3300017792 | Ga0163161_10074193 | Ga0163161_100741932 | 271 |
| 365 | 3300017792 | Ga0163161_10091821 | Ga0163161_100918212 | 271 |
| 366 | 3300017792 | Ga0163161_10170412 | Ga0163161_101704122 | 271 |
| 367 | 3300017792 | Ga0163161_10244870 | Ga0163161_102448702 | 271 |
| 368 | 3300025208 | Ga0209436_114069 | Ga0209436_1140691 | 271 |
| 369 | 3300025208 | Ga0209436_116442 | Ga0209436_1164421 | 271 |
| 370 | 3300025228 | Ga0209672_100365 | Ga0209672_1003656 | 271 |
| 371 | 3300025229 | Ga0209147_102967 | Ga0209147_1029672 | 271 |
| 372 | 3300025242 | Ga0209258_100015 | Ga0209258_100015297 | 271 |
| 373 | 3300025245 | Ga0207425_1000309 | Ga0207425_100030924 | 271 |
| 374 | 3300025245 | Ga0207425_1025074 | Ga0207425_10250742 | 271 |
| 375 | 3300025254 | Ga0209148_1000028 | Ga0209148_1000028372 | 271 |
| 376 | 3300025258 | Ga0209129_1000160 | Ga0209129_100016033 | 271 |
| 377 | 3300025258 | Ga0209129_1001108 | Ga0209129_10011082 | 271 |
| 378 | 3300025263 | Ga0209565_1000227 | Ga0209565_100022716 | 271 |
| 379 | 3300025263 | Ga0209565_1000262 | Ga0209565_100026210 | 271 |
| 380 | 3300025263 | Ga0209565_1000653 | Ga0209565_10006535 | 271 |
| 381 | 3300025273 | Ga0209673_1000286 | Ga0209673_100028634 | 271 |
| 382 | 3300025273 | Ga0209673_1000524 | Ga0209673_100052436 | 271 |
| 383 | 3300025273 | Ga0209673_1002001 | Ga0209673_100200110 | 271 |
| 384 | 3300025273 | Ga0209673_1005197 | Ga0209673_10051972 | 271 |
| 385 | 3300025284 | Ga0209130_1000965 | Ga0209130_10009652 | 271 |
| 386 | 3300025284 | Ga0209130_1002421 | Ga0209130_10024214 | 271 |
| 387 | 3300025284 | Ga0209130_1002607 | Ga0209130_10026073 | 271 |
| 388 | 3300025291 | Ga0209675_1000164 | Ga0209675_100016434 | 271 |
| 389 | 3300025291 | Ga0209675_1002522 | Ga0209675_10025223 | 271 |
| 390 | 3300025291 | Ga0209675_1005415 | Ga0209675_10054152 | 271 |
| 391 | 3300025291 | Ga0209675_1006018 | Ga0209675_10060182 | 271 |
| 392 | 3300025292 | Ga0209676_1000074 | Ga0209676_1000074161 | 271 |
| 393 | 3300025292 | Ga0209676_1000303 | Ga0209676_100030354 | 271 |
| 394 | 3300025292 | Ga0209676_1001391 | Ga0209676_100139110 | 271 |
| 395 | 3300025292 | Ga0209676_1016100 | Ga0209676_10161002 | 271 |
| 396 | 3300025292 | Ga0209676_1052484 | Ga0209676_10524842 | 271 |
| 397 | 3300025294 | Ga0209025_1000269 | Ga0209025_100026987 | 271 |
| 398 | 3300025294 | Ga0209025_1000637 | Ga0209025_100063711 | 271 |
| 399 | 3300025294 | Ga0209025_1000656 | Ga0209025_100065610 | 271 |
| 400 | 3300025295 | Ga0209564_1000346 | Ga0209564_100034634 | 271 |
| 401 | 3300025295 | Ga0209564_1000764 | Ga0209564_100076429 | 271 |
| 402 | 3300025297 | Ga0209758_1000039 | Ga0209758_1000039377 | 271 |
| 403 | 3300025297 | Ga0209758_1004890 | Ga0209758_10048903 | 271 |
| 404 | 3300025297 | Ga0209758_1009469 | Ga0209758_10094692 | 271 |
| 405 | 3300025298 | Ga0209050_1000015 | Ga0209050_1000015309 | 271 |
| 406 | 3300025298 | Ga0209050_1004313 | Ga0209050_10043132 | 271 |
| 407 | 3300025299 | Ga0209256_1000136 | Ga0209256_1000136131 | 271 |
| 408 | 3300025299 | Ga0209256_1000382 | Ga0209256_100038219 | 271 |
| 409 | 3300025302 | Ga0207426_1000108 | Ga0207426_1000108115 | 271 |
| 410 | 3300025302 | Ga0207426_1000130 | Ga0207426_100013092 | 271 |
| 411 | 3300025303 | Ga0209051_1000010 | Ga0209051_1000010309 | 271 |
| 412 | 3300025303 | Ga0209051_1000277 | Ga0209051_100027734 | 271 |
| 413 | 3300025303 | Ga0209051_1000361 | Ga0209051_100036114 | 271 |
| 414 | 3300025303 | Ga0209051_1001386 | Ga0209051_10013867 | 271 |
| 415 | 3300025303 | Ga0209051_1010675 | Ga0209051_10106753 | 271 |
| 416 | 3300025303 | Ga0209051_1043190 | Ga0209051_10431902 | 271 |
| 417 | 3300025304 | Ga0209257_1000026 | Ga0209257_1000026368 | 271 |
| 418 | 3300025304 | Ga0209257_1000172 | Ga0209257_1000172114 | 271 |
| 419 | 3300025304 | Ga0209257_1010352 | Ga0209257_10103522 | 271 |
| 420 | 3300025304 | Ga0209257_1021322 | Ga0209257_10213222 | 271 |
| 421 | 3300025304 | Ga0209257_1054820 | Ga0209257_10548201 | 271 |
| 422 | 3300025321 | Ga0207656_10008178 | Ga0207656_100081781 | 271 |
| 423 | 3300025728 | Ga0207655_1007709 | Ga0207655_10077094 | 271 |
| 424 | 3300025904 | Ga0207647_10131714 | Ga0207647_101317142 | 271 |
| 425 | 3300025909 | Ga0207705_10182000 | Ga0207705_101820001 | 271 |
| 426 | 3300025914 | Ga0207671_10122083 | Ga0207671_101220831 | 271 |
| 427 | 3300025919 | Ga0207657_10449915 | Ga0207657_104499152 | 271 |
| 428 | 3300025923 | Ga0207681_10029912 | Ga0207681_100299122 | 271 |
| 429 | 3300025924 | Ga0207694_10040683 | Ga0207694_100406832 | 271 |
| 430 | 3300025933 | Ga0207706_10230012 | Ga0207706_102300122 | 271 |
| 431 | 3300025935 | Ga0207709_10000290 | Ga0207709_1000029016 | 271 |
| 432 | 3300025935 | Ga0207709_10001845 | Ga0207709_100018453 | 271 |
| 433 | 3300025935 | Ga0207709_10060259 | Ga0207709_100602592 | 271 |
| 434 | 3300025937 | Ga0207669_10054975 | Ga0207669_100549752 | 271 |
| 435 | 3300025937 | Ga0207669_10215503 | Ga0207669_102155032 | 271 |
| 436 | 3300025940 | Ga0207691_10093259 | Ga0207691_100932592 | 271 |
| 437 | 3300025945 | Ga0207679_10060724 | Ga0207679_100607242 | 271 |
| 438 | 3300025960 | Ga0207651_10444212 | Ga0207651_104442121 | 271 |
| 439 | 3300025972 | Ga0207668_10411515 | Ga0207668_104115151 | 271 |
| 440 | 3300026041 | Ga0207639_10001749 | Ga0207639_100017492 | 271 |
| 441 | 3300026041 | Ga0207639_10094172 | Ga0207639_100941722 | 271 |
| 442 | 3300026067 | Ga0207678_10393781 | Ga0207678_103937811 | 271 |
| 443 | 3300026089 | Ga0207648_10126649 | Ga0207648_101266492 | 271 |
| 444 | 3300026121 | Ga0207683_10069612 | Ga0207683_100696122 | 271 |
| 445 | 3300026121 | Ga0207683_10150711 | Ga0207683_101507112 | 271 |
| 446 | 3300026121 | Ga0207683_10192686 | Ga0207683_101926862 | 271 |
| 447 | 3300026142 | Ga0207698_10183671 | Ga0207698_101836712 | 271 |
| 448 | 3300027111 | Ga0209281_1032670 | Ga0209281_10326701 | 271 |
| 449 | 3300027682 | Ga0209971_1003077 | Ga0209971_10030772 | 271 |
| 450 | 3300027876 | Ga0209974_10002191 | Ga0209974_100021914 | 271 |
| 451 | 3300028379 | Ga0268266_10122574 | Ga0268266_101225742 | 271 |
| 452 | 3300028379 | Ga0268266_10191052 | Ga0268266_101910522 | 271 |
| 453 | 3300028380 | Ga0268265_10068672 | Ga0268265_100686722 | 271 |
| 454 | 3300028794 | Ga0307515_10000034 | Ga0307515_10000034222 | 271 |
| 455 | 3300030522 | Ga0307512_10146128 | Ga0307512_101461281 | 271 |
| 456 | 3300030732 | Ga0316176_1044658 | Ga0316176_10446582 | 271 |
| 457 | 3300030733 | Ga0314311_1015200 | Ga0314311_10152002 | 271 |
| 458 | 3300030735 | Ga0316178_1092321 | Ga0316178_10923212 | 271 |
| 459 | 3300030742 | Ga0316183_1032606 | Ga0316183_10326062 | 271 |
| 460 | 3300030742 | Ga0316183_1047886 | Ga0316183_10478862 | 271 |
| 461 | 3300030744 | Ga0316181_1039120 | Ga0316181_10391202 | 271 |
| 462 | 3300030745 | Ga0316182_1038521 | Ga0316182_10385212 | 271 |
| 463 | 3300031235 | Ga0265330_10000122 | Ga0265330_1000012210 | 271 |
| 464 | 3300031238 | Ga0265332_10000006 | Ga0265332_1000000691 | 271 |
| 465 | 3300031238 | Ga0265332_10000048 | Ga0265332_1000004857 | 271 |
| 466 | 3300031241 | Ga0265325_10001946 | Ga0265325_100019464 | 271 |
| 467 | 3300031251 | Ga0265327_10001721 | Ga0265327_1000172115 | 271 |
| 468 | 3300031456 | Ga0307513_10066483 | Ga0307513_100664832 | 271 |
| 469 | 3300031456 | Ga0307513_10120068 | Ga0307513_101200682 | 271 |
| 470 | 3300031548 | Ga0307408_100000072 | Ga0307408_10000007244 | 271 |
| 471 | 3300031548 | Ga0307408_100026167 | Ga0307408_1000261672 | 271 |
| 472 | 3300031548 | Ga0307408_100088911 | Ga0307408_1000889112 | 271 |
| 473 | 3300031548 | Ga0307408_100175024 | Ga0307408_1001750242 | 271 |
| 474 | 3300031548 | Ga0307408_100645879 | Ga0307408_1006458791 | 271 |
| 475 | 3300031649 | Ga0307514_10004659 | Ga0307514_100046598 | 271 |
| 476 | 3300031711 | Ga0265314_10000132 | Ga0265314_1000013248 | 271 |
| 477 | 3300031731 | Ga0307405_10130148 | Ga0307405_101301482 | 271 |
| 478 | 3300031824 | Ga0307413_10061201 | Ga0307413_100612012 | 271 |
| 479 | 3300031824 | Ga0307413_10261958 | Ga0307413_102619582 | 271 |
| 480 | 3300031824 | Ga0307413_10265743 | Ga0307413_102657431 | 271 |
| 481 | 3300031901 | Ga0307406_10000249 | Ga0307406_1000024910 | 271 |
| 482 | 3300031901 | Ga0307406_10004096 | Ga0307406_100040963 | 271 |
| 483 | 3300031903 | Ga0307407_10033951 | Ga0307407_100339512 | 271 |
| 484 | 3300031911 | Ga0307412_10013623 | Ga0307412_100136234 | 271 |
| 485 | 3300031911 | Ga0307412_10028145 | Ga0307412_100281452 | 271 |
| 486 | 3300031911 | Ga0307412_10030084 | Ga0307412_100300842 | 271 |
| 487 | 3300031911 | Ga0307412_10035052 | Ga0307412_100350522 | 271 |
| 488 | 3300031911 | Ga0307412_10227283 | Ga0307412_102272832 | 271 |
| 489 | 3300031911 | Ga0307412_10388260 | Ga0307412_103882601 | 271 |
| 490 | 3300031995 | Ga0307409_100360714 | Ga0307409_1003607142 | 271 |
| 491 | 3300032002 | Ga0307416_100087871 | Ga0307416_1000878712 | 271 |
| 492 | 3300032004 | Ga0307414_10091968 | Ga0307414_100919682 | 271 |
| 493 | 3300032004 | Ga0307414_10194778 | Ga0307414_101947781 | 271 |
| 494 | 3300032005 | Ga0307411_10021542 | Ga0307411_100215422 | 271 |
| 495 | 3300035114 | Ga0373939_0128683 | Ga0373939_0128683_23_838 | 271 |
| 496 | 3300041404 | Ga0439436_0001605 | Ga0439436_0001605_3342_4157 | 271 |
| 497 | 3300041404 | Ga0439436_0003996 | Ga0439436_0003996_2848_3663 | 271 |
| 498 | 3300041404 | Ga0439436_0008597 | Ga0439436_0008597_1133_1948 | 271 |
| 499 | 3300041405 | Ga0439438_024839 | Ga0439438_024839_703_1518 | 271 |
| 500 | 3300041406 | Ga0439439_0000354 | Ga0439439_0000354_2839_3654 | 271 |
| 501 | 3300041411 | Ga0439466_0007584 | Ga0439466_0007584_2293_3108 | 271 |
| 502 | 3300041411 | Ga0439466_0014160 | Ga0439466_0014160_406_1221 | 271 |
| 503 | 3300041413 | Ga0439465_0013877 | Ga0439465_0013877_1086_1901 | 271 |
| 504 | 3300041997 | Ga0439431_0006224 | Ga0439431_0006224_1189_2004 | 271 |
| 505 | 3300041999 | Ga0439433_0001806 | Ga0439433_0001806_386_1201 | 271 |
| 506 | 3300042002 | Ga0439442_001254 | Ga0439442_001254_2763_3578 | 271 |
| 507 | 3300042002 | Ga0439442_031362 | Ga0439442_031362_259_1074 | 271 |
| 508 | 3300042004 | Ga0439445_0005434 | Ga0439445_0005434_1827_2642 | 271 |
| 509 | 3300042006 | Ga0439432_003005 | Ga0439432_003005_2741_3556 | 271 |
| 510 | 3300042006 | Ga0439432_028055 | Ga0439432_028055_633_1448 | 271 |
| 511 | 3300042007 | Ga0439449_0000821 | Ga0439449_0000821_5578_6393 | 271 |
| 512 | 3300042007 | Ga0439449_0010517 | Ga0439449_0010517_2557_3372 | 271 |
| 513 | 3300042007 | Ga0439449_0063635 | Ga0439449_0063635_110_925 | 271 |
| 514 | 3300042010 | Ga0439452_010149 | Ga0439452_010149_1911_2726 | 271 |
| 515 | 3300042014 | Ga0439457_002860 | Ga0439457_002860_1552_2367 | 271 |
| 516 | 3300042015 | Ga0439462_0018453 | Ga0439462_0018453_80_895 | 271 |
| 517 | 3300042121 | Ga0450919_003019 | Ga0450919_003019_465_1280 | 271 |
| 518 | 3300042122 | Ga0450920_007022 | Ga0450920_007022_1085_1900 | 271 |
| 519 | 3300042125 | Ga0450923_000626 | Ga0450923_000626_2482_3300 | 271 |
| 520 | 3300042127 | Ga0450890_003534 | Ga0450890_003534_476_1291 | 271 |
| 521 | 3300042131 | Ga0450894_005953 | Ga0450894_005953_94_909 | 271 |
| 522 | 3300042133 | Ga0450896_011176 | Ga0450896_011176_408_1223 | 271 |
| 523 | 3300042147 | Ga0450910_000694 | Ga0450910_000694_2782_3597 | 271 |
| 524 | 3300042147 | Ga0450910_005575 | Ga0450910_005575_853_1668 | 271 |
| 525 | 3300042435 | Ga0439434_0001123 | Ga0439434_0001123_4385_5200 | 271 |
| 526 | 3300042435 | Ga0439434_0001864 | Ga0439434_0001864_893_1708 | 271 |
| 527 | 3300042435 | Ga0439434_0025266 | Ga0439434_0025266_536_1351 | 271 |
| 528 | 3300042876 | Ga0451577_0002572 | Ga0451577_0002572_4874_5707 | 271 |
| 529 | 3300042876 | Ga0451577_0083590 | Ga0451577_0083590_665_1480 | 271 |
| 530 | 3300044673 | Ga0453683_0017744 | Ga0453683_0017744_2911_3744 | 271 |
| 531 | 3300044683 | Ga0466965_0091841 | Ga0466965_0091841_610_1425 | 271 |
| 532 | 3300044712 | Ga0453684_0037918 | Ga0453684_0037918_644_1477 | 271 |
| 533 | 3300044901 | Ga0466960_0032942 | Ga0466960_0032942_1320_2135 | 271 |
| 534 | 3300045051 | Ga0451576_0003400 | Ga0451576_0003400_16229_17062 | 271 |
| 535 | 3300045051 | Ga0451576_0397034 | Ga0451576_0397034_232_1047 | 271 |
| 536 | 3300046453 | Ga0495627_007976 | Ga0495627_007976_796_1611 | 271 |
| 537 | 3300046453 | Ga0495627_013800 | Ga0495627_013800_681_1496 | 271 |
| 538 | 3300046459 | Ga0495629_0177104 | Ga0495629_0177104_538_1353 | 271 |
| 539 | 3300046475 | Ga0495639_0007301 | Ga0495639_0007301_458_1273 | 271 |
| 540 | 3300046512 | Ga0495610_0032190 | Ga0495610_0032190_943_1758 | 271 |
| 541 | 3300046515 | Ga0495620_0072733 | Ga0495620_0072733_207_1022 | 271 |
| 542 | 3300046518 | Ga0495631_0000050 | Ga0495631_0000050_39234_40049 | 271 |
| 543 | 3300046520 | Ga0495637_0004019 | Ga0495637_0004019_3214_4029 | 271 |
| 544 | 3300046520 | Ga0495637_0038409 | Ga0495637_0038409_334_1149 | 271 |
| 545 | 3300046525 | Ga0495663_0029736 | Ga0495663_0029736_369_1184 | 271 |
| 546 | 3300046528 | Ga0495642_0049498 | Ga0495642_0049498_258_1073 | 271 |
| 547 | 3300046615 | Ga0495656_0003211 | Ga0495656_0003211_192_1007 | 271 |
| 548 | 3300046616 | Ga0495668_0066318 | Ga0495668_0066318_83_898 | 271 |
| 549 | 3300046642 | Ga0495634_0279213 | Ga0495634_0279213_178_993 | 271 |
| 550 | 3300046660 | Ga0495625_0000098 | Ga0495625_0000098_93400_94215 | 271 |
| 551 | 3300046660 | Ga0495625_0060099 | Ga0495625_0060099_1507_2322 | 271 |
| 552 | 3300046663 | Ga0495635_0087817 | Ga0495635_0087817_971_1786 | 271 |
| 553 | 3300046674 | Ga0495588_0014830 | Ga0495588_0014830_2006_2821 | 271 |
| 554 | 3300046674 | Ga0495588_0023421 | Ga0495588_0023421_278_1093 | 271 |
| 555 | 3300046675 | Ga0495657_0226432 | Ga0495657_0226432_114_929 | 271 |
| 556 | 3300046683 | Ga0495658_0026831 | Ga0495658_0026831_1714_2529 | 271 |
| 557 | 3300046691 | Ga0495670_0110751 | Ga0495670_0110751_335_1150 | 271 |
| 558 | 3300046692 | Ga0495671_0003067 | Ga0495671_0003067_9048_9863 | 271 |
| 559 | 3300046809 | Ga0495600_0150003 | Ga0495600_0150003_360_1175 | 271 |
| 560 | 3300047321 | Ga0495676_0013204 | Ga0495676_0013204_1213_2028 | 271 |
| 561 | 3300047673 | Ga0495593_0063152 | Ga0495593_0063152_382_1197 | 271 |
| 562 | 3300048089 | Ga0495614_0032377 | Ga0495614_0032377_1163_1978 | 271 |
| 563 | 3300048903 | Ga0496100_0040858 | Ga0496100_0040858_520_1335 | 271 |
| 564 | 3300048904 | Ga0496101_0001604 | Ga0496101_0001604_7687_8502 | 271 |
| 565 | 3300048904 | Ga0496101_0008375 | Ga0496101_0008375_4961_5776 | 271 |
| 566 | 3300048905 | Ga0496102_0010166 | Ga0496102_0010166_4561_5376 | 271 |
| 567 | 3300048906 | Ga0496103_0010808 | Ga0496103_0010808_921_1736 | 271 |
| 568 | 3300048907 | Ga0496104_0128117 | Ga0496104_0128117_1005_1820 | 271 |
| 569 | 3300048908 | Ga0496105_0004183 | Ga0496105_0004183_4164_4979 | 271 |
| 570 | 3300048910 | Ga0496107_0321526 | Ga0496107_0321526_150_965 | 271 |
| 571 | 3300048911 | Ga0496108_0513274 | Ga0496108_0513274_76_891 | 271 |
| 572 | 3300048912 | Ga0496109_0168290 | Ga0496109_0168290_458_1273 | 271 |
| 573 | 3300048914 | Ga0496111_0133149 | Ga0496111_0133149_636_1451 | 271 |
| 574 | 3300048919 | Ga0496116_0027955 | Ga0496116_0027955_232_1047 | 271 |
| 575 | 3300048920 | Ga0496117_0060149 | Ga0496117_0060149_1402_2217 | 271 |
| 576 | 3300048920 | Ga0496117_0067736 | Ga0496117_0067736_95_910 | 271 |
| 577 | 3300048920 | Ga0496117_0068280 | Ga0496117_0068280_1305_2120 | 271 |
| 578 | 3300048921 | Ga0496118_0007408 | Ga0496118_0007408_7053_7868 | 271 |
| 579 | 3300048921 | Ga0496118_0007776 | Ga0496118_0007776_6584_7399 | 271 |
| 580 | 3300048921 | Ga0496118_0142832 | Ga0496118_0142832_603_1418 | 271 |
| 581 | 3300048924 | Ga0496121_0107927 | Ga0496121_0107927_636_1451 | 271 |
| 582 | 3300048924 | Ga0496121_0162201 | Ga0496121_0162201_363_1178 | 271 |
| 583 | 3300048924 | Ga0496121_0198218 | Ga0496121_0198218_328_1143 | 271 |
| 584 | 3300048925 | Ga0496122_0002306 | Ga0496122_0002306_14391_15206 | 271 |
| 585 | 3300048926 | Ga0496123_0000631 | Ga0496123_0000631_26065_26880 | 271 |
| 586 | 3300048926 | Ga0496123_0051214 | Ga0496123_0051214_1612_2427 | 271 |
| 587 | 3300048927 | Ga0496124_0019022 | Ga0496124_0019022_740_1555 | 271 |
| 588 | 3300048927 | Ga0496124_0054996 | Ga0496124_0054996_1260_2075 | 271 |
| 589 | 3300048927 | Ga0496124_0070695 | Ga0496124_0070695_872_1687 | 271 |
| 590 | 3300048927 | Ga0496124_0088696 | Ga0496124_0088696_508_1323 | 271 |
| 591 | 3300048928 | Ga0496125_0003351 | Ga0496125_0003351_4308_5123 | 271 |
| 592 | 3300048928 | Ga0496125_0005808 | Ga0496125_0005808_11021_11836 | 271 |
| 593 | 3300048928 | Ga0496125_0014076 | Ga0496125_0014076_4316_5131 | 271 |
| 594 | 3300048928 | Ga0496125_0088516 | Ga0496125_0088516_708_1523 | 271 |
| 595 | 3300048928 | Ga0496125_0091791 | Ga0496125_0091791_335_1150 | 271 |
| 596 | 3300048929 | Ga0496126_0209117 | Ga0496126_0209117_540_1355 | 271 |
| 597 | 3300048929 | Ga0496126_0290439 | Ga0496126_0290439_489_1304 | 271 |
| 598 | 3300049571 | Ga0501034_0210259 | Ga0501034_0210259_348_1166 | 271 |
| 599 | 3300049679 | Ga0501249_004029 | Ga0501249_004029_609_1424 | 271 |
| 600 | 3300049705 | Ga0501225_0002587 | Ga0501225_0002587_2034_2849 | 271 |
| 601 | 3300049759 | Ga0501262_000223 | Ga0501262_000223_289_1104 | 271 |
| 602 | 3300049823 | Ga0501044_0305459 | Ga0501044_0305459_398_1213 | 271 |
| 603 | 3300050489 | nmdc:mga03683_22738_c1 | nmdc:mga03683_22738_c1_840_1655 | 271 |
| 604 | 3300050489 | nmdc:mga03683_6664_c1 | nmdc:mga03683_6664_c1_2260_3075 | 271 |
| 605 | 3300050490 | nmdc:mga03n38_10324_c1 | nmdc:mga03n38_10324_c1_743_1558 | 271 |
| 606 | 3300050490 | nmdc:mga03n38_41288_c1 | nmdc:mga03n38_41288_c1_604_1419 | 271 |
| 607 | 3300050491 | nmdc:mga00v17_6053_c1 | nmdc:mga00v17_6053_c1_511_1326 | 271 |
| 608 | 3300050491 | nmdc:mga00v17_78903_c1 | nmdc:mga00v17_78903_c1_1018_1833 | 271 |
| 609 | 3300050492 | nmdc:mga0yw44_36061_c1 | nmdc:mga0yw44_36061_c1_586_1401 | 271 |
| 610 | 3300050493 | nmdc:mga0k408_144878_c1 | nmdc:mga0k408_144878_c1_588_1403 | 271 |
| 611 | 3300050493 | nmdc:mga0k408_78342_c1 | nmdc:mga0k408_78342_c1_974_1789 | 271 |
| 612 | 3300050494 | nmdc:mga06z11_125475_c1 | nmdc:mga06z11_125475_c1_353_1168 | 271 |
| 613 | 3300050494 | nmdc:mga06z11_19009_c1 | nmdc:mga06z11_19009_c1_717_1532 | 271 |
| 614 | 3300050496 | nmdc:mga07m45_2557_c1 | nmdc:mga07m45_2557_c1_892_1707 | 271 |
| 615 | 3300050496 | nmdc:mga07m45_4055_c1 | nmdc:mga07m45_4055_c1_3528_4343 | 271 |
| 616 | 3300050496 | nmdc:mga07m45_69746_c1 | nmdc:mga07m45_69746_c1_1023_1838 | 271 |
| 617 | 3300053093 | Ga0500651_0000147 | Ga0500651_0000147_2188_3003 | 271 |
| 618 | 3300053096 | Ga0500641_0037790 | Ga0500641_0037790_1020_1850 | 271 |
| 619 | 3300053110 | Ga0500571_000101 | Ga0500571_000101_18064_18879 | 271 |
| 620 | 3300053117 | Ga0500593_002115 | Ga0500593_002115_1191_2006 | 271 |
| 621 | 3300053118 | Ga0500594_0003665 | Ga0500594_0003665_930_1745 | 271 |
| 622 | 3300053121 | Ga0500607_002039 | Ga0500607_002039_6428_7243 | 271 |
| 623 | 3300053128 | Ga0500626_011707 | Ga0500626_011707_2006_2821 | 271 |
| 624 | 3300053133 | Ga0500655_007262 | Ga0500655_007262_23_838 | 271 |
| 625 | 3300053134 | Ga0500658_0002085 | Ga0500658_0002085_2877_3692 | 271 |
| 626 | 3300053134 | Ga0500658_0002814 | Ga0500658_0002814_2676_3491 | 271 |
| 627 | 3300053136 | Ga0500559_0001099 | Ga0500559_0001099_5568_6383 | 271 |
| 628 | 3300053139 | Ga0500568_0000929 | Ga0500568_0000929_17957_18772 | 271 |
| 629 | 3300053140 | Ga0500573_0125717 | Ga0500573_0125717_226_1041 | 271 |
| 630 | 3300053141 | Ga0500574_003073 | Ga0500574_003073_2025_2840 | 271 |
| 631 | 3300053161 | Ga0500634_0052477 | Ga0500634_0052477_361_1176 | 271 |
| 632 | 3300053161 | Ga0500634_0070379 | Ga0500634_0070379_983_1810 | 271 |
| 633 | 3300053161 | Ga0500634_0104913 | Ga0500634_0104913_20_835 | 271 |
| 634 | 3300053162 | Ga0500638_004507 | Ga0500638_004507_4132_4947 | 271 |
| 635 | 3300053177 | Ga0500636_0061311 | Ga0500636_0061311_342_1157 | 271 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2w1v-assembly1.cif.gz_B | crystal structure of mouse nitrilase-2 at 1.4a resolution | 0.9258 | 2 | 263 |
| 3iw3-assembly1.cif.gz_B | crystal structure of hyperthermophilic nitrilase | 0.9101 | 1 | 253 |
| 7ovg-assembly1.cif.gz_B | the c146a variant of an amidase from pyrococcus horikoshii with bound acetamide | 0.9091 | 1 | 254 |
| 1j31-assembly2.cif.gz_D | crystal structure of hypothetical protein ph0642 from pyrococcus horikoshii | 0.9046 | 1 | 254 |
| 1f89-assembly1.cif.gz_B | crystal structure of saccharomyces cerevisiae nit3, a member of branch 10 of the nitrilase superfamily | 0.8933 | 1 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O76463_1_291_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9337 | 2 | 266 | 3.60.110.10 |
| af_Q8VDK1_45_315_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9313 | 4 | 267 | 3.60.110.10 |
| af_O94660_4_273_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9297 | 4 | 262 | 3.60.110.10 |
| af_A4I2F5_5_278_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9261 | 1 | 263 | 3.60.110.10 |
| af_O76463_1_291_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9202 | 2 | 266 | 3.60.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K2DXD4-F1-model_v4 | Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase | 0.9939 | 36 | 182 |
GO:0016746
|
| AF-A0A7V9E099-F1-model_v4 | Carbon-nitrogen hydrolase family protein | 0.9814 | 131 | 268 |
GO:0016787
|
| AF-A0A6G0XMK9-F1-model_v4 | CN hydrolase domain-containing protein | 0.9812 | 172 | 268 |
|
| AF-A0A2N6BAK1-F1-model_v4 | Amidohydrolase | 0.9757 | 152 | 268 |
GO:0016787
|
| AF-A0A2M8WXI3-F1-model_v4 | Nitrilase | 0.9755 | 43 | 268 |
GO:0016811
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar