F471277

General Info

Members Datasets Scaffolds Average Seq Length
635 362 578 269

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0002572|Ga0451577_0002572_4874_5707
Length 277
Sequence MKLAVIQMVSGSDVNANVRQARALLQEAALAGAEMAVLPEYFCLMGHKDDDKLAIQELFGSGPLQQFLAESAREFNLWVVGGTIPLTADEPDALVRSGRVFNSSLVFSPAGVCVARYDKIHLFKFDNGTESYDESKVLVAGDQLVTFDLDSRDGHTWRVGLSVCYDLRFAELYRAYADAGAHLLLAPSAFTYTTGQDHWEVLLRARAIENLSYVGAAAQGGLHDNRRKTWGHAMLVDPWGKMLGQLSQQAGVVTAELDFELLTGCRSRLPALEHRVL

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221570 Acidovorax sp. Root568 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
11 2643221652 Acidovorax sp. Root402 Isolate Unclassified
12 2643221658 Variovorax sp. Root411 Isolate Unclassified
13 2643221672 Variovorax sp. Root434 Isolate Unclassified
14 2643221683 Variovorax sp. Root473 Isolate Unclassified
15 2643221717 Acidovorax sp. Root267 Isolate Unclassified
16 2738541277 Variovorax sp. GV051 Isolate Unclassified
17 2738541307 Variovorax sp. GV008 Isolate Unclassified
18 2738543012 Acidovorax sp. CF301 Isolate Unclassified
19 2738543013 Variovorax sp. BT01 Isolate Unclassified
20 2738543019 Variovorax sp. GV040 Isolate Unclassified
21 2816332133 Acidovorax radicis 2721A Isolate Unclassified
22 2818991446 Variovorax sp. 1180 Isolate Unclassified
23 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
24 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
25 2842677519 Variovorax sp. R-72495 Isolate Unclassified
26 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
27 2842733646 Variovorax sp. R-72446 Isolate Unclassified
28 2842747753 Variovorax sp. R-72060 Isolate Unclassified
29 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
30 2885198086 Variovorax sp. 679 Isolate Unclassified
31 2885211737 Variovorax sp. 553 Isolate Unclassified
32 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
33 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
34 2899924645 Variovorax sp. 369 Isolate Unclassified
35 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
36 2904456579 Variovorax sp. 2002 Isolate Unclassified
37 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
38 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
39 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
40 2928037797 Variovorax sp. 1126 Isolate Unclassified
41 2928044640 Variovorax sp. 1128 Isolate Unclassified
42 2928051484 Variovorax sp. 1133 Isolate Unclassified
43 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
44 2928070936 Variovorax gossypii 1167 Isolate Unclassified
45 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
46 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
47 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
48 2929520902 Variovorax beijingensis 502 Isolate Unclassified
49 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
50 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
51 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
52 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
53 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
54 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
55 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
56 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
57 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
58 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
59 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
60 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
61 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
62 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
63 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
64 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
65 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
66 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
67 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
68 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
69 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
70 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
71 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
72 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
73 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
74 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
75 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
76 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
77 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
78 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
79 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
80 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
81 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
82 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
83 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
84 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
85 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
86 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
87 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
88 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
89 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
90 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
91 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
92 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
93 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
94 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
95 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
96 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
97 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
98 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
99 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
100 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
101 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
102 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
103 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
109 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
110 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
114 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
115 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
116 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
117 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
125 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
143 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
146 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
147 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
151 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
152 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
155 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
156 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
199 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
206 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
207 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
208 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
209 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
210 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
211 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
212 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
213 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
214 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
219 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
220 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
221 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
224 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
225 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
230 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
231 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
232 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
238 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
239 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
240 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
241 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
242 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
243 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
244 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
245 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
246 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
247 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
248 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
249 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
250 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
251 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
252 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
253 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
254 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
255 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
256 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
257 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
258 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
259 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
260 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
261 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
262 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
263 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
264 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
265 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
266 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
267 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
268 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
269 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
270 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
271 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
272 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
273 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
274 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
275 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
276 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
277 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
278 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
281 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
282 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
283 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
284 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
285 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
286 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
287 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
288 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
316 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
317 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
318 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
319 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
320 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
321 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
322 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
328 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
329 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
330 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
331 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
335 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
336 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
337 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
338 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
339 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
340 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
341 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
342 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
343 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
344 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
345 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
346 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
347 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
348 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
349 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
350 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
351 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
352 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
353 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
354 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
355 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
356 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
357 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
358 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
359 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
360 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
361 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
362 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.71
Metatranscriptomes 0.31
Isolates 8.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 34.02
Nodule 0.79
Rhizoplane 2.52
Rhizosphere 50.08
Stem 0
Stem Tuber 0
Unclassified 12.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009520 3300001979 Bacteria 3798
2 JGI24739J22299_10007263 3300001989 Bacteria 4164
3 JGI24739J22299_10033104 3300001989 Bacteria 1772
4 JGI25156J39149_1000024 3300002705 Bacteria 141748
5 JGI25154J39366_1000043 3300002738 Bacteria 142417
6 JGI25158J39367_1005551 3300002739 Bacteria 1846
7 JGI25158J39367_1007034 3300002739 Bacteria 1598
8 JGI25157J39369_1000031 3300002741 Bacteria 141953
9 JGI25152J39213_1004060 3300002773 Bacteria 4762
10 JGI25152J39213_1013640 3300002773 Bacteria 1682
11 JGI25150J39212_1005028 3300002774 Bacteria 2861
12 JGI25159J45721_1000904 3300002987 Bacteria 12918
13 JGI25159J45721_1001700 3300002987 Bacteria 8901
14 JGI25159J45721_1008872 3300002987 Bacteria 2713
15 JGI25159J45721_1009866 3300002987 Bacteria 2483
16 JGI25151J46595_10001517 3300003187 Bacteria 15537
17 JGI25151J46595_10004727 3300003187 Bacteria 7156
18 JGI25151J46595_10006874 3300003187 Bacteria 5648
19 JGI25151J46595_10007855 3300003187 Bacteria 5183
20 JGI25151J46595_10013246 3300003187 Bacteria 3719
21 JGI25151J46595_10023959 3300003187 Bacteria 2504
22 JGI25153J46596_10020431 3300003215 Bacteria 2504
23 rootH1_10012410 3300003316 Bacteria 5622
24 rootH2_10008704 3300003320 Bacteria 2472
25 rootH2_10008705 3300003320 Bacteria 1185
26 rootL2_10089357 3300003322 Bacteria 2112
27 JGI25160J50197_1000768 3300003354 Bacteria 17244
28 JGI25160J50197_1026910 3300003354 Bacteria 1576
29 JGI25160J50197_1030306 3300003354 Bacteria 1412
30 JGI25161J50226_1000007 3300003374 Bacteria 256181
31 JGI25161J50226_1001559 3300003374 Bacteria 6711
32 JGI25161J50226_1012310 3300003374 Bacteria 1030
33 Ga0006562J51391_1058358 3300003578 Bacteria 7110
34 Ga0006562J51391_1058359 3300003578 Bacteria 8250
35 Ga0055535_1000542 3300003761 Bacteria 32509
36 Ga0055542_1000003 3300003762 Bacteria 582721
37 Ga0055526_1000974 3300003771 Bacteria 21093
38 Ga0055526_1009192 3300003771 Bacteria 4800
39 Ga0055526_1030423 3300003771 Bacteria 1575
40 Ga0055526_1033425 3300003771 Bacteria 1428
41 Ga0055526_1041538 3300003771 Bacteria 1145
42 Ga0055537_1000137 3300003773 Bacteria 54996
43 Ga0055537_1000328 3300003773 Bacteria 32405
44 Ga0055537_1013112 3300003773 Bacteria 1575
45 Ga0055537_1014659 3300003773 Bacteria 1412
46 Ga0055524_1000101 3300003775 Bacteria 106527
47 Ga0055524_1019857 3300003775 Bacteria 2283
48 Ga0055524_1021192 3300003775 Bacteria 2162
49 Ga0055536_1001356 3300003781 Bacteria 14918
50 Ga0055536_1002973 3300003781 Bacteria 9290
51 Ga0055536_1012962 3300003781 Bacteria 3046
52 Ga0055534_1000118 3300003784 Bacteria 58554
53 Ga0055534_1001345 3300003784 Bacteria 9871
54 Ga0055534_1002898 3300003784 Bacteria 5689
55 Ga0055534_1004575 3300003784 Bacteria 3954
56 Ga0055534_1005179 3300003784 Bacteria 3567
57 Ga0055528_1000152 3300003790 Bacteria 57369
58 Ga0055528_1002223 3300003790 Bacteria 10582
59 Ga0055528_1011265 3300003790 Bacteria 3567
60 Ga0055530_10000251 3300003791 Bacteria 48732
61 Ga0055530_10001323 3300003791 Bacteria 18640
62 Ga0055530_10011121 3300003791 Bacteria 3260
63 Ga0055540_1000099 3300003792 Bacteria 96187
64 Ga0055540_1001243 3300003792 Bacteria 15662
65 Ga0055540_1001728 3300003792 Bacteria 12564
66 Ga0055540_1001887 3300003792 Bacteria 11749
67 Ga0055540_1009727 3300003792 Bacteria 3283
68 Ga0055540_1025462 3300003792 Bacteria 1449
69 Ga0055531_10000333 3300003794 Bacteria 46562
70 Ga0055531_10000739 3300003794 Bacteria 27542
71 Ga0055531_10007097 3300003794 Bacteria 6189
72 Ga0055531_10007150 3300003794 Bacteria 6155
73 Ga0055531_10036085 3300003794 Bacteria 1533
74 Ga0055531_10039140 3300003794 Bacteria 1412
75 Ga0055543_1000061 3300004625 Bacteria 98138
76 Ga0055543_1003323 3300004625 Bacteria 4810
77 Ga0065165_1008540 3300005262 Bacteria 4766
78 Ga0065165_1009124 3300005262 Bacteria 4500
79 Ga0065165_1009126 3300005262 Bacteria 4500
80 Ga0065714_10020927 3300005288 Bacteria 1741
81 Ga0070658_10071203 3300005327 Bacteria 2848
82 Ga0070658_10094800 3300005327 Bacteria 2463
83 Ga0070658_10189340 3300005327 Bacteria 1734
84 Ga0070677_10022212 3300005333 Bacteria 2334
85 Ga0068869_100035005 3300005334 Bacteria 3557
86 Ga0070668_100094738 3300005347 Bacteria 2357
87 Ga0070669_100036807 3300005353 Bacteria 3547
88 Ga0070674_100216244 3300005356 Bacteria 1489
89 Ga0070673_100035285 3300005364 Bacteria 3791
90 Ga0070659_100148239 3300005366 Bacteria 1913
91 Ga0070659_100353246 3300005366 Bacteria 1234
92 Ga0070678_100043169 3300005456 Bacteria 3210
93 Ga0070678_100086090 3300005456 Bacteria 2396
94 Ga0068867_100077165 3300005459 Bacteria 2503
95 Ga0070706_100142283 3300005467 Bacteria 2239
96 Ga0070707_100077962 3300005468 Bacteria 3197
97 Ga0070679_100017454 3300005530 Bacteria 6946
98 Ga0068853_100012346 3300005539 Bacteria 6950
99 Ga0068853_100080193 3300005539 Bacteria 2855
100 Ga0068853_100109410 3300005539 Bacteria 2453
101 Ga0070672_100062016 3300005543 Bacteria 2949
102 Ga0070665_100256697 3300005548 Bacteria 1749
103 Ga0070665_100486874 3300005548 Bacteria 1244
104 Ga0068855_100004794 3300005563 Bacteria 16512
105 Ga0068855_100015273 3300005563 Bacteria 9243
106 Ga0068855_100149807 3300005563 Bacteria 2653
107 Ga0068855_100853395 3300005563 Bacteria 965
108 Ga0070664_100029916 3300005564 Bacteria 4540
109 Ga0068857_100038245 3300005577 Bacteria 4249
110 Ga0068857_100310948 3300005577 Bacteria 1454
111 Ga0068857_100338808 3300005577 Bacteria 1391
112 Ga0068854_100175185 3300005578 Bacteria 1671
113 Ga0068864_100070701 3300005618 Bacteria 3037
114 Ga0068851_10311800 3300005834 Bacteria 907
115 Ga0068863_100055874 3300005841 Bacteria 3738
116 Ga0068862_100024710 3300005844 Bacteria 5042
117 Ga0075365_10035431 3300006038 Bacteria 3228
118 Ga0075365_10040833 3300006038 Bacteria 3027
119 Ga0075365_10088259 3300006038 Bacteria 2109
120 Ga0075365_10180673 3300006038 Bacteria 1475
121 Ga0075363_100002936 3300006048 Bacteria 7107
122 Ga0075363_100009667 3300006048 Bacteria 4542
123 Ga0075363_100131366 3300006048 Bacteria 1404
124 Ga0075364_10007902 3300006051 Bacteria 6336
125 Ga0075364_10010882 3300006051 Bacteria 5512
126 Ga0075364_10020489 3300006051 Bacteria 4158
127 Ga0075432_10044455 3300006058 Bacteria 1557
128 Ga0075362_10010620 3300006177 Bacteria 3602
129 Ga0075362_10034478 3300006177 Bacteria 2206
130 Ga0075367_10105522 3300006178 Bacteria 1725
131 Ga0075369_10062102 3300006186 Bacteria 1632
132 Ga0075366_10023521 3300006195 Bacteria 3589
133 Ga0075366_10153939 3300006195 Bacteria 1392
134 Ga0075366_10276515 3300006195 Bacteria 1026
135 Ga0097621_100175774 3300006237 Bacteria 1848
136 Ga0075370_10001072 3300006353 Bacteria 11389
137 Ga0075370_10004593 3300006353 Bacteria 6734
138 Ga0075370_10052346 3300006353 Bacteria 2316
139 Ga0075370_10068238 3300006353 Bacteria 2030
140 Ga0075370_10078624 3300006353 Bacteria 1894
141 Ga0075370_10187686 3300006353 Bacteria 1217
142 Ga0075429_100463784 3300006880 Bacteria 1110
143 Ga0079104_1007224 3300006946 Bacteria 4065
144 Ga0099826_10000746 3300006948 Bacteria 17106
145 Ga0105240_10016619 3300009093 Bacteria 9952
146 Ga0105243_10000787 3300009148 Bacteria 30397
147 Ga0105243_10006024 3300009148 Bacteria 9387
148 Ga0105243_10239941 3300009148 Bacteria 1612
149 Ga0105241_10033011 3300009174 Bacteria 3884
150 Ga0105238_10401749 3300009551 Bacteria 1363
151 Ga0105239_10087691 3300010375 Bacteria 3431
152 Ga0105246_10033388 3300011119 Bacteria 3421
153 Ga0157373_10008247 3300013100 Bacteria 7743
154 Ga0157371_10019901 3300013102 Bacteria 4945
155 Ga0157370_10005598 3300013104 Bacteria 14065
156 Ga0157369_10042153 3300013105 Bacteria 4980
157 Ga0163162_10039046 3300013306 Bacteria 4740
158 Ga0157372_10036824 3300013307 Bacteria 5395
159 Ga0182008_10000871 3300014497 Bacteria 20984
160 Ga0182008_10004373 3300014497 Bacteria 8269
161 Ga0182008_10006756 3300014497 Bacteria 6383
162 Ga0182008_10087380 3300014497 Bacteria 1536
163 Ga0157376_10022727 3300014969 Bacteria 4894
164 Ga0182006_1004055 3300015261 Bacteria 7303
165 Ga0182006_1039701 3300015261 Bacteria 1856
166 Ga0182006_1048403 3300015261 Bacteria 1644
167 Ga0182007_10000609 3300015262 Bacteria 20877
168 Ga0182007_10002723 3300015262 Bacteria 8648
169 Ga0182005_1048127 3300015265 Bacteria 1159
170 Ga0183362_10004 3300015683 Bacteria 569303
171 Ga0163161_10001481 3300017792 Bacteria 17336
172 Ga0163161_10014836 3300017792 Bacteria 5429
173 Ga0163161_10074193 3300017792 Bacteria 2494
174 Ga0163161_10091821 3300017792 Bacteria 2248
175 Ga0163161_10170412 3300017792 Bacteria 1664
176 Ga0163161_10244870 3300017792 Bacteria 1396
177 Ga0209435_100008 3300025206 Bacteria 503644
178 Ga0209436_114069 3300025208 Bacteria 1287
179 Ga0209436_116442 3300025208 Bacteria 1109
180 Ga0209672_100365 3300025228 Bacteria 28274
181 Ga0209147_102967 3300025229 Bacteria 3659
182 Ga0209258_100015 3300025242 Bacteria 706310
183 Ga0207425_1000309 3300025245 Bacteria 35186
184 Ga0207425_1000418 3300025245 Bacteria 28631
185 Ga0207425_1001693 3300025245 Bacteria 8769
186 Ga0207425_1025074 3300025245 Bacteria 1233
187 Ga0209646_1000079 3300025246 Bacteria 207677
188 Ga0209026_1000067 3300025250 Bacteria 207677
189 Ga0209148_1000028 3300025254 Bacteria 582773
190 Ga0209759_1000056 3300025256 Bacteria 207677
191 Ga0209129_1000160 3300025258 Bacteria 102457
192 Ga0209129_1001108 3300025258 Bacteria 15687
193 Ga0209565_1000041 3300025263 Bacteria 251081
194 Ga0209565_1000227 3300025263 Bacteria 62284
195 Ga0209565_1000262 3300025263 Bacteria 55325
196 Ga0209565_1000538 3300025263 Bacteria 26449
197 Ga0209565_1000653 3300025263 Bacteria 22263
198 Ga0209673_1000286 3300025273 Bacteria 94581
199 Ga0209673_1000364 3300025273 Bacteria 81319
200 Ga0209673_1000524 3300025273 Bacteria 62744
201 Ga0209673_1002001 3300025273 Bacteria 15763
202 Ga0209673_1005197 3300025273 Bacteria 6644
203 Ga0209130_1000245 3300025284 Bacteria 68668
204 Ga0209130_1000965 3300025284 Bacteria 22670
205 Ga0209130_1001381 3300025284 Bacteria 16326
206 Ga0209130_1002421 3300025284 Bacteria 9397
207 Ga0209130_1002607 3300025284 Bacteria 8730
208 Ga0209675_1000164 3300025291 Bacteria 81617
209 Ga0209675_1000316 3300025291 Bacteria 43181
210 Ga0209675_1002522 3300025291 Bacteria 9334
211 Ga0209675_1005415 3300025291 Bacteria 5350
212 Ga0209675_1006018 3300025291 Bacteria 4961
213 Ga0209676_1000013 3300025292 Bacteria 816080
214 Ga0209676_1000074 3300025292 Bacteria 305770
215 Ga0209676_1000303 3300025292 Bacteria 98589
216 Ga0209676_1001391 3300025292 Bacteria 23407
217 Ga0209676_1004083 3300025292 Bacteria 8358
218 Ga0209676_1016100 3300025292 Bacteria 2720
219 Ga0209676_1052484 3300025292 Bacteria 1063
220 Ga0209025_1000269 3300025294 Bacteria 121642
221 Ga0209025_1000637 3300025294 Bacteria 62014
222 Ga0209025_1000656 3300025294 Bacteria 60251
223 Ga0209025_1002942 3300025294 Bacteria 16940
224 Ga0209025_1005362 3300025294 Bacteria 10503
225 Ga0209025_1010723 3300025294 Bacteria 6164
226 Ga0209025_1017822 3300025294 Bacteria 4071
227 Ga0209564_1000346 3300025295 Bacteria 87680
228 Ga0209564_1000363 3300025295 Bacteria 84210
229 Ga0209564_1000764 3300025295 Bacteria 45093
230 Ga0209564_1001188 3300025295 Bacteria 30004
231 Ga0209564_1004998 3300025295 Bacteria 7793
232 Ga0209758_1000039 3300025297 Bacteria 428951
233 Ga0209758_1004890 3300025297 Bacteria 10777
234 Ga0209758_1009469 3300025297 Bacteria 6046
235 Ga0209758_1011662 3300025297 Bacteria 5053
236 Ga0209050_1000008 3300025298 Bacteria 1144179
237 Ga0209050_1000015 3300025298 Bacteria 759102
238 Ga0209050_1004313 3300025298 Bacteria 9716
239 Ga0209050_1007985 3300025298 Bacteria 5777
240 Ga0209050_1010818 3300025298 Bacteria 4432
241 Ga0209256_1000003 3300025299 Bacteria 1661127
242 Ga0209256_1000136 3300025299 Bacteria 159047
243 Ga0209256_1000382 3300025299 Bacteria 70823
244 Ga0207426_1000091 3300025302 Bacteria 280561
245 Ga0207426_1000108 3300025302 Bacteria 242257
246 Ga0207426_1000130 3300025302 Bacteria 210271
247 Ga0209051_1000005 3300025303 Bacteria 1142353
248 Ga0209051_1000010 3300025303 Bacteria 641298
249 Ga0209051_1000214 3300025303 Bacteria 98444
250 Ga0209051_1000277 3300025303 Bacteria 83774
251 Ga0209051_1000361 3300025303 Bacteria 66865
252 Ga0209051_1001386 3300025303 Bacteria 20876
253 Ga0209051_1010675 3300025303 Bacteria 4608
254 Ga0209051_1043190 3300025303 Bacteria 1584
255 Ga0209257_1000015 3300025304 Bacteria 908141
256 Ga0209257_1000026 3300025304 Bacteria 723225
257 Ga0209257_1000048 3300025304 Bacteria 455536
258 Ga0209257_1000172 3300025304 Bacteria 167434
259 Ga0209257_1005996 3300025304 Bacteria 8131
260 Ga0209257_1010352 3300025304 Bacteria 4741
261 Ga0209257_1021322 3300025304 Bacteria 2357
262 Ga0209257_1054820 3300025304 Bacteria 1108
263 Ga0207656_10008178 3300025321 Bacteria 3839
264 Ga0207655_1007709 3300025728 Bacteria 6947
265 Ga0207647_10131714 3300025904 Bacteria 1469
266 Ga0207705_10182000 3300025909 Bacteria 1586
267 Ga0207654_10018323 3300025911 Bacteria 3672
268 Ga0207707_10070703 3300025912 Bacteria 3041
269 Ga0207671_10122083 3300025914 Bacteria 1992
270 Ga0207657_10449915 3300025919 Bacteria 1011
271 Ga0207681_10029912 3300025923 Bacteria 3545
272 Ga0207694_10040683 3300025924 Bacteria 3580
273 Ga0207650_10368350 3300025925 Bacteria 1185
274 Ga0207664_10481326 3300025929 Bacteria 1110
275 Ga0207706_10230012 3300025933 Bacteria 1622
276 Ga0207709_10000290 3300025935 Bacteria 57108
277 Ga0207709_10001845 3300025935 Bacteria 14110
278 Ga0207709_10060259 3300025935 Bacteria 2365
279 Ga0207669_10054975 3300025937 Bacteria 2408
280 Ga0207669_10215503 3300025937 Bacteria 1405
281 Ga0207691_10093259 3300025940 Bacteria 2696
282 Ga0207679_10060724 3300025945 Bacteria 2810
283 Ga0207667_10018493 3300025949 Bacteria 7812
284 Ga0207667_10096535 3300025949 Bacteria 3051
285 Ga0207651_10444212 3300025960 Bacteria 1112
286 Ga0207668_10411515 3300025972 Bacteria 1146
287 Ga0207677_10009193 3300026023 Bacteria 5550
288 Ga0207639_10001749 3300026041 Bacteria 14618
289 Ga0207639_10094172 3300026041 Bacteria 2404
290 Ga0207678_10393781 3300026067 Bacteria 1199
291 Ga0207641_10044213 3300026088 Bacteria 3745
292 Ga0207648_10126649 3300026089 Bacteria 2247
293 Ga0207676_10057590 3300026095 Bacteria 3061
294 Ga0207674_10243233 3300026116 Bacteria 1746
295 Ga0207683_10069612 3300026121 Bacteria 3108
296 Ga0207683_10150711 3300026121 Bacteria 2098
297 Ga0207683_10192686 3300026121 Bacteria 1851
298 Ga0207698_10183671 3300026142 Bacteria 1855
299 Ga0209281_1032670 3300027111 Bacteria 919
300 Ga0209970_1000057 3300027614 Bacteria 15061
301 Ga0209971_1003077 3300027682 Bacteria 3982
302 Ga0209974_10002191 3300027876 Bacteria 7120
303 Ga0209974_10039512 3300027876 Bacteria 1569
304 Ga0268266_10122574 3300028379 Bacteria 2315
305 Ga0268266_10191052 3300028379 Bacteria 1869
306 Ga0268265_10068672 3300028380 Bacteria 2749
307 Ga0268265_10437697 3300028380 Bacteria 1218
308 Ga0307515_10000034 3300028794 Bacteria 344640
309 Ga0307512_10146128 3300030522 Bacteria 1430
310 Ga0316176_1044658 3300030732 Bacteria 4805
311 Ga0314311_1015200 3300030733 Bacteria 7232
312 Ga0316178_1092321 3300030735 Bacteria 5206
313 Ga0316183_1032606 3300030742 Bacteria 1181
314 Ga0316183_1047886 3300030742 Bacteria 4947
315 Ga0316181_1039120 3300030744 Bacteria 3274
316 Ga0316182_1038521 3300030745 Bacteria 5844
317 Ga0265330_10000122 3300031235 Bacteria 63452
318 Ga0265332_10000006 3300031238 Bacteria 327963
319 Ga0265332_10000048 3300031238 Bacteria 113285
320 Ga0265325_10001946 3300031241 Bacteria 14243
321 Ga0265327_10001721 3300031251 Bacteria 25935
322 Ga0307513_10000013 3300031456 Bacteria 325682
323 Ga0307513_10066483 3300031456 Bacteria 3787
324 Ga0307513_10120068 3300031456 Bacteria 2599
325 Ga0307408_100000072 3300031548 Bacteria 115918
326 Ga0307408_100026167 3300031548 Bacteria 4003
327 Ga0307408_100059781 3300031548 Bacteria 2775
328 Ga0307408_100088911 3300031548 Bacteria 2327
329 Ga0307408_100175024 3300031548 Bacteria 1716
330 Ga0307408_100645879 3300031548 Bacteria 945
331 Ga0307514_10004659 3300031649 Bacteria 12552
332 Ga0265314_10000132 3300031711 Bacteria 113285
333 Ga0265314_10014961 3300031711 Bacteria 6179
334 Ga0265342_10177995 3300031712 Bacteria 1166
335 Ga0307516_10010885 3300031730 Bacteria 9951
336 Ga0307405_10130148 3300031731 Bacteria 1737
337 Ga0307405_10465904 3300031731 Bacteria 1005
338 Ga0307413_10061201 3300031824 Bacteria 2322
339 Ga0307413_10261958 3300031824 Bacteria 1289
340 Ga0307413_10265743 3300031824 Bacteria 1282
341 Ga0307406_10000249 3300031901 Bacteria 32642
342 Ga0307406_10004096 3300031901 Bacteria 7935
343 Ga0307406_10009252 3300031901 Bacteria 5520
344 Ga0307407_10033951 3300031903 Bacteria 2788
345 Ga0307412_10013623 3300031911 Bacteria 4774
346 Ga0307412_10028145 3300031911 Bacteria 3512
347 Ga0307412_10030084 3300031911 Bacteria 3414
348 Ga0307412_10035052 3300031911 Bacteria 3203
349 Ga0307412_10113179 3300031911 Bacteria 1941
350 Ga0307412_10227283 3300031911 Bacteria 1434
351 Ga0307412_10388260 3300031911 Bacteria 1133
352 Ga0307409_100360714 3300031995 Bacteria 1375
353 Ga0307416_100087871 3300032002 Bacteria 2656
354 Ga0307414_10091968 3300032004 Bacteria 2256
355 Ga0307414_10194778 3300032004 Bacteria 1643
356 Ga0307411_10021542 3300032005 Bacteria 3774
357 Ga0307411_10298610 3300032005 Bacteria 1291
358 Ga0373939_0128683 3300035114 Bacteria 901
359 Ga0395899_0004093 3300037312 Bacteria 11480
360 Ga0395899_0005604 3300037312 Bacteria 9740
361 Ga0395900_0009645 3300037418 Bacteria 9902
362 Ga0395900_0029613 3300037418 Bacteria 5617
363 Ga0395900_0295912 3300037418 Bacteria 1606
364 Ga0395898_0008291 3300037466 Bacteria 10987
365 Ga0395898_0011141 3300037466 Bacteria 9363
366 Ga0395905_0000047 3300037471 Bacteria 237582
367 Ga0395905_0003373 3300037471 Bacteria 17114
368 Ga0395905_0021306 3300037471 Bacteria 6131
369 Ga0395905_0025494 3300037471 Bacteria 5576
370 Ga0395905_0047730 3300037471 Bacteria 4011
371 Ga0395905_0069200 3300037471 Bacteria 3306
372 Ga0395905_0268017 3300037471 Bacteria 1593
373 Ga0395905_0644139 3300037471 Bacteria 961
374 Ga0395901_0011214 3300038443 Bacteria 9081
375 Ga0395901_0098912 3300038443 Bacteria 3058
376 Ga0439436_0001605 3300041404 Bacteria 6581
377 Ga0439436_0003996 3300041404 Bacteria 4520
378 Ga0439436_0008597 3300041404 Bacteria 3139
379 Ga0439438_024839 3300041405 Bacteria 1638
380 Ga0439439_0000354 3300041406 Bacteria 7465
381 Ga0439453_0007236 3300041408 Bacteria 1754
382 Ga0439466_0007584 3300041411 Bacteria 4100
383 Ga0439466_0014160 3300041411 Bacteria 2908
384 Ga0439465_0013877 3300041413 Bacteria 2508
385 Ga0439431_0006224 3300041997 Bacteria 2635
386 Ga0439433_0001806 3300041999 Bacteria 4450
387 Ga0439441_020509 3300042001 Bacteria 1212
388 Ga0439442_001254 3300042002 Bacteria 5041
389 Ga0439442_031362 3300042002 Bacteria 1110
390 Ga0439445_0005434 3300042004 Bacteria 2904
391 Ga0439445_0047283 3300042004 Bacteria 1155
392 Ga0439432_003005 3300042006 Bacteria 6277
393 Ga0439432_028055 3300042006 Bacteria 1835
394 Ga0439449_0000821 3300042007 Bacteria 11998
395 Ga0439449_0002256 3300042007 Bacteria 7575
396 Ga0439449_0010517 3300042007 Bacteria 3496
397 Ga0439449_0063635 3300042007 Bacteria 1361
398 Ga0439452_010149 3300042010 Bacteria 2750
399 Ga0439457_002860 3300042014 Bacteria 4819
400 Ga0439457_020332 3300042014 Bacteria 1474
401 Ga0439462_0015839 3300042015 Bacteria 1945
402 Ga0439462_0018453 3300042015 Bacteria 1812
403 Ga0450911_000378 3300042115 Bacteria 14820
404 Ga0450919_003019 3300042121 Bacteria 2147
405 Ga0450920_007022 3300042122 Bacteria 2035
406 Ga0450921_005965 3300042123 Bacteria 935
407 Ga0450923_000626 3300042125 Bacteria 4074
408 Ga0450890_003534 3300042127 Bacteria 2076
409 Ga0450890_018350 3300042127 Bacteria 936
410 Ga0450894_005953 3300042131 Bacteria 1578
411 Ga0450896_011176 3300042133 Bacteria 1263
412 Ga0450905_027495 3300042142 Bacteria 864
413 Ga0450910_000694 3300042147 Bacteria 4042
414 Ga0450910_005575 3300042147 Bacteria 1721
415 Ga0439446_0083243 3300042156 Bacteria 993
416 Ga0439434_0001123 3300042435 Bacteria 7738
417 Ga0439434_0001864 3300042435 Bacteria 6131
418 Ga0439434_0025266 3300042435 Bacteria 1792
419 Ga0439464_0007913 3300042439 Bacteria 2784
420 Ga0451577_0000126 3300042876 Bacteria 168037
421 Ga0451577_0002572 3300042876 Bacteria 21418
422 Ga0451577_0025518 3300042876 Bacteria 5360
423 Ga0451577_0083590 3300042876 Bacteria 2848
424 Ga0466969_0029606 3300044656 Bacteria 2795
425 Ga0453683_0013716 3300044673 Bacteria 5277
426 Ga0453683_0017744 3300044673 Bacteria 4578
427 Ga0466965_0091841 3300044683 Bacteria 1545
428 Ga0466966_0114593 3300044684 Bacteria 1660
429 Ga0466961_0074220 3300044693 Bacteria 2157
430 Ga0453684_0000365 3300044712 Bacteria 186233
431 Ga0453684_0037918 3300044712 Bacteria 6604
432 Ga0453684_0125592 3300044712 Bacteria 3089
433 Ga0466970_0037469 3300044765 Bacteria 2570
434 Ga0466957_0073868 3300044842 Bacteria 2114
435 Ga0466960_0032942 3300044901 Bacteria 2404
436 Ga0466959_0205503 3300045049 Bacteria 1370
437 Ga0451576_0000627 3300045051 Bacteria 73597
438 Ga0451576_0003400 3300045051 Bacteria 21935
439 Ga0451576_0005543 3300045051 Bacteria 15767
440 Ga0451576_0071836 3300045051 Bacteria 3602
441 Ga0451576_0397034 3300045051 Bacteria 1446
442 Ga0495627_007976 3300046453 Bacteria 4004
443 Ga0495627_013800 3300046453 Bacteria 2837
444 Ga0495629_0177104 3300046459 Bacteria 1479
445 Ga0495639_0007301 3300046475 Bacteria 4740
446 Ga0495610_0032190 3300046512 Bacteria 2728
447 Ga0495620_0072733 3300046515 Bacteria 1403
448 Ga0495631_0000050 3300046518 Bacteria 71875
449 Ga0495637_0004019 3300046520 Bacteria 7678
450 Ga0495637_0038409 3300046520 Bacteria 2073
451 Ga0495663_0011145 3300046525 Bacteria 2502
452 Ga0495663_0029736 3300046525 Bacteria 1615
453 Ga0495642_0049498 3300046528 Bacteria 1726
454 Ga0495622_0102540 3300046557 Bacteria 1311
455 Ga0495633_0003589 3300046558 Bacteria 10262
456 Ga0495633_0041532 3300046558 Bacteria 2187
457 Ga0495656_0003211 3300046615 Bacteria 5510
458 Ga0495656_0023666 3300046615 Bacteria 2419
459 Ga0495668_0066318 3300046616 Bacteria 1986
460 Ga0495634_0279213 3300046642 Bacteria 1015
461 Ga0495625_0000098 3300046660 Bacteria 140987
462 Ga0495625_0060099 3300046660 Bacteria 2693
463 Ga0495635_0087817 3300046663 Bacteria 2128
464 Ga0495588_0014830 3300046674 Bacteria 3739
465 Ga0495588_0023421 3300046674 Bacteria 3057
466 Ga0495588_0144673 3300046674 Bacteria 1256
467 Ga0495657_0226432 3300046675 Bacteria 1132
468 Ga0495658_0026831 3300046683 Bacteria 3092
469 Ga0495669_0133332 3300046684 Bacteria 1170
470 Ga0495670_0110751 3300046691 Bacteria 1420
471 Ga0495671_0003067 3300046692 Bacteria 10375
472 Ga0495600_0150003 3300046809 Bacteria 1510
473 Ga0495676_0013204 3300047321 Bacteria 7429
474 Ga0495685_027928 3300047447 Bacteria 1941
475 Ga0495593_0063152 3300047673 Bacteria 1934
476 Ga0495614_0032377 3300048089 Bacteria 2250
477 Ga0496100_0040858 3300048903 Bacteria 2954
478 Ga0496101_0001604 3300048904 Bacteria 13600
479 Ga0496101_0008375 3300048904 Bacteria 6756
480 Ga0496102_0010166 3300048905 Bacteria 8091
481 Ga0496102_0280418 3300048905 Bacteria 1571
482 Ga0496103_0010808 3300048906 Bacteria 5403
483 Ga0496104_0128117 3300048907 Bacteria 2437
484 Ga0496105_0004183 3300048908 Bacteria 10840
485 Ga0496107_0321526 3300048910 Bacteria 1151
486 Ga0496108_0228012 3300048911 Bacteria 1619
487 Ga0496108_0513274 3300048911 Bacteria 1046
488 Ga0496109_0168290 3300048912 Bacteria 2055
489 Ga0496111_0133149 3300048914 Bacteria 1840
490 Ga0496116_0027955 3300048919 Bacteria 4096
491 Ga0496117_0060149 3300048920 Bacteria 2620
492 Ga0496117_0067736 3300048920 Bacteria 2414
493 Ga0496117_0068280 3300048920 Bacteria 2400
494 Ga0496118_0007408 3300048921 Bacteria 11643
495 Ga0496118_0007776 3300048921 Bacteria 11255
496 Ga0496118_0142832 3300048921 Bacteria 1514
497 Ga0496121_0008557 3300048924 Bacteria 11999
498 Ga0496121_0107927 3300048924 Bacteria 2130
499 Ga0496121_0162201 3300048924 Bacteria 1633
500 Ga0496121_0198218 3300048924 Bacteria 1433
501 Ga0496122_0002306 3300048925 Bacteria 27531
502 Ga0496122_0294146 3300048925 Bacteria 880
503 Ga0496123_0000631 3300048926 Bacteria 58934
504 Ga0496123_0051214 3300048926 Bacteria 2751
505 Ga0496124_0019022 3300048927 Bacteria 6410
506 Ga0496124_0054996 3300048927 Bacteria 3366
507 Ga0496124_0070695 3300048927 Bacteria 2894
508 Ga0496124_0088696 3300048927 Bacteria 2527
509 Ga0496125_0003351 3300048928 Bacteria 19512
510 Ga0496125_0005808 3300048928 Bacteria 13553
511 Ga0496125_0014076 3300048928 Bacteria 7818
512 Ga0496125_0027115 3300048928 Bacteria 5200
513 Ga0496125_0088516 3300048928 Bacteria 2333
514 Ga0496125_0091791 3300048928 Bacteria 2273
515 Ga0496126_0209117 3300048929 Bacteria 1644
516 Ga0496126_0290439 3300048929 Bacteria 1352
517 Ga0501034_0079060 3300049571 Bacteria 3292
518 Ga0501034_0113067 3300049571 Bacteria 2705
519 Ga0501034_0210259 3300049571 Bacteria 1901
520 Ga0501043_0171303 3300049579 Bacteria 1694
521 Ga0501043_0400205 3300049579 Bacteria 1038
522 Ga0501046_0059645 3300049580 Bacteria 2988
523 Ga0501074_0092268 3300049590 Bacteria 2169
524 Ga0501208_044482 3300049655 Bacteria 831
525 Ga0501249_004029 3300049679 Bacteria 2971
526 Ga0501249_024272 3300049679 Bacteria 1335
527 Ga0501225_0002587 3300049705 Bacteria 5564
528 Ga0501262_000223 3300049759 Bacteria 6989
529 Ga0501035_0032989 3300049822 Bacteria 4709
530 Ga0501035_0103879 3300049822 Bacteria 2492
531 Ga0501044_0305459 3300049823 Bacteria 1519
532 Ga0501044_0348673 3300049823 Bacteria 1400
533 Ga0501044_0649749 3300049823 Bacteria 944
534 nmdc:mga03683_22738_c1 3300050489 Bacteria 2433
535 nmdc:mga03683_6049_c2 3300050489 Bacteria 3736
536 nmdc:mga03683_6664_c1 3300050489 Bacteria 3967
537 nmdc:mga03n38_10324_c1 3300050490 Bacteria 3429
538 nmdc:mga03n38_41288_c1 3300050490 Bacteria 2010
539 nmdc:mga00v17_6053_c1 3300050491 Bacteria 6402
540 nmdc:mga00v17_78903_c1 3300050491 Bacteria 2052
541 nmdc:mga0yw44_161451_c1 3300050492 Bacteria 1467
542 nmdc:mga0yw44_36061_c1 3300050492 Bacteria 2912
543 nmdc:mga0k408_144878_c1 3300050493 Bacteria 1414
544 nmdc:mga0k408_78342_c1 3300050493 Bacteria 1933
545 nmdc:mga06z11_125475_c1 3300050494 Bacteria 1436
546 nmdc:mga06z11_19009_c1 3300050494 Bacteria 3150
547 nmdc:mga07m45_2557_c1 3300050496 Bacteria 8555
548 nmdc:mga07m45_4055_c1 3300050496 Bacteria 7139
549 nmdc:mga07m45_47424_c1 3300050496 Bacteria 2415
550 nmdc:mga07m45_69746_c1 3300050496 Bacteria 1999
551 nmdc:mga09592_204946_c1 3300050508 Bacteria 1708
552 Ga0500644_0016667 3300053088 Bacteria 2118
553 Ga0500651_0000147 3300053093 Bacteria 44659
554 Ga0500651_0027596 3300053093 Bacteria 3571
555 Ga0500566_0080319 3300053094 Bacteria 1816
556 Ga0500641_0037790 3300053096 Bacteria 1937
557 Ga0500571_000101 3300053110 Bacteria 28130
558 Ga0500593_000677 3300053117 Bacteria 12925
559 Ga0500593_002115 3300053117 Bacteria 7215
560 Ga0500594_0003665 3300053118 Bacteria 3386
561 Ga0500607_002039 3300053121 Bacteria 17010
562 Ga0500626_011707 3300053128 Bacteria 3732
563 Ga0500628_004489 3300053129 Bacteria 2311
564 Ga0500655_007262 3300053133 Bacteria 1992
565 Ga0500658_0002085 3300053134 Bacteria 7778
566 Ga0500658_0002814 3300053134 Bacteria 6672
567 Ga0500559_0001099 3300053136 Bacteria 16348
568 Ga0500568_0000929 3300053139 Bacteria 20199
569 Ga0500573_0125717 3300053140 Bacteria 1424
570 Ga0500574_003073 3300053141 Bacteria 2877
571 Ga0500634_0052477 3300053161 Bacteria 2189
572 Ga0500634_0070379 3300053161 Bacteria 1832
573 Ga0500634_0104913 3300053161 Bacteria 1407
574 Ga0500638_004507 3300053162 Bacteria 5382
575 Ga0500636_0061311 3300053177 Bacteria 2195
576 Ga0500645_001451 3300053730 Bacteria 11991
577 Ga0500645_034727 3300053730 Bacteria 1505
578 Ga0590077_017000 3300059426 Bacteria 1528

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042004 Ga0439445_0047283 Ga0439445_0047283_454_1140 228
2 3300042123 Ga0450921_005965 Ga0450921_005965_18_704 228
3 3300046557 Ga0495622_0102540 Ga0495622_0102540_18_704 228
4 3300049655 Ga0501208_044482 Ga0501208_044482_24_710 228
5 3300042142 Ga0450905_027495 Ga0450905_027495_18_767 248
6 3300046674 Ga0495588_0144673 Ga0495588_0144673_472_1242 255
7 3300046684 Ga0495669_0133332 Ga0495669_0133332_10_780 255
8 3300042115 Ga0450911_000378 Ga0450911_000378_4883_5698 259
9 3300042127 Ga0450890_018350 Ga0450890_018350_20_835 259
10 3300031731 Ga0307405_10465904 Ga0307405_104659041 260
11 3300002987 JGI25159J45721_1000904 JGI25159J45721_10009045 261
12 3300003354 JGI25160J50197_1000768 JGI25160J50197_10007684 261
13 3300003374 JGI25161J50226_1000007 JGI25161J50226_1000007132 261
14 3300005262 Ga0065165_1009126 Ga0065165_10091262 261
15 3300050489 nmdc:mga03683_6049_c2 nmdc:mga03683_6049_c2_1136_1921 261
16 3300050496 nmdc:mga07m45_47424_c1 nmdc:mga07m45_47424_c1_1370_2155 261
17 3300053088 Ga0500644_0016667 Ga0500644_0016667_745_1530 261
18 3300053093 Ga0500651_0027596 Ga0500651_0027596_385_1170 261
19 3300053094 Ga0500566_0080319 Ga0500566_0080319_293_1078 261
20 3300053117 Ga0500593_000677 Ga0500593_000677_11866_12651 261
21 3300053129 Ga0500628_004489 Ga0500628_004489_1149_1934 261
22 3300053730 Ga0500645_001451 Ga0500645_001451_5898_6683 261
23 3300053730 Ga0500645_034727 Ga0500645_034727_607_1392 261
24 3300049571 Ga0501034_0113067 Ga0501034_0113067_1157_1945 262
25 3300049579 Ga0501043_0400205 Ga0501043_0400205_209_997 262
26 3300046525 Ga0495663_0011145 Ga0495663_0011145_737_1531 264
27 3300046558 Ga0495633_0003589 Ga0495633_0003589_7864_8658 264
28 3300048905 Ga0496102_0280418 Ga0496102_0280418_577_1374 264
29 iso_pu_bacteria 2511231002 2511245372 264
30 iso_pu_bacteria 2919704043 2919706029 264
31 iso_pu_bacteria 2513020051 2513226921 267
32 iso_pu_bacteria 2599185214 2599621725 267
33 iso_pu_bacteria 2599185226 2599670591 267
34 iso_pu_bacteria 2599185227 2599679081 267
35 iso_pu_bacteria 2599185229 2599691236 267
36 iso_pu_bacteria 2643221570 2643864566 267
37 iso_pu_bacteria 2643221596 2643992822 267
38 iso_pu_bacteria 2643221628 2644163658 267
39 iso_pu_bacteria 2643221652 2644296360 267
40 iso_pu_bacteria 2643221658 2644327112 267
41 iso_pu_bacteria 2643221672 2644398912 267
42 iso_pu_bacteria 2643221683 2644465863 267
43 iso_pu_bacteria 2738541277 2738721792 267
44 iso_pu_bacteria 2738541307 2738881964 267
45 iso_pu_bacteria 2738543012 2739244401 267
46 iso_pu_bacteria 2738543013 2739247758 267
47 iso_pu_bacteria 2738543019 2739282156 267
48 iso_pu_bacteria 2816332133 2816469832 267
49 iso_pu_bacteria 2818991446 2819597897 267
50 iso_pu_bacteria 2831265667 2831268873 267
51 iso_pu_bacteria 2838054893 2838058311 267
52 iso_pu_bacteria 2842677519 2842678230 267
53 iso_pu_bacteria 2842718218 2842720830 267
54 iso_pu_bacteria 2842733646 2842738660 267
55 iso_pu_bacteria 2842747753 2842750161 267
56 iso_pu_bacteria 2885192300 2885194426 267
57 iso_pu_bacteria 2885198086 2885203960 267
58 iso_pu_bacteria 2885211737 2885217705 267
59 iso_pu_bacteria 2887375801 2887379597 267
60 iso_pu_bacteria 2894023352 2894027784 267
61 iso_pu_bacteria 2899924645 2899929316 267
62 iso_pu_bacteria 2904449895 2904451191 267
63 iso_pu_bacteria 2904456579 2904458045 267
64 iso_pu_bacteria 2904541872 2904542820 267
65 iso_pu_bacteria 2919462493 2919465609 267
66 iso_pu_bacteria 2928037797 2928040242 267
67 iso_pu_bacteria 2928044640 2928047009 267
68 iso_pu_bacteria 2928051484 2928057785 267
69 iso_pu_bacteria 2928064002 2928067832 267
70 iso_pu_bacteria 2928070936 2928072392 267
71 iso_pu_bacteria 2928084124 2928085594 267
72 iso_pu_bacteria 2928115317 2928116705 267
73 iso_pu_bacteria 2929160207 2929166240 267
74 iso_pu_bacteria 2929520902 2929526342 267
75 iso_pu_bacteria 2932422444 2932422519 267
76 iso_pu_bacteria 2939631187 2939634565 267
77 iso_pu_bacteria 2945909444 2945915081 267
78 iso_pu_bacteria 2945945610 2945950895 267
79 iso_pu_bacteria 2945972063 2945974468 267
80 iso_pu_bacteria 2945984333 2945989509 267
81 iso_pu_bacteria 2954767861 2954769705 267
82 iso_pu_bacteria 2974320154 2974321699 267
83 iso_pu_bacteria 2990710928 2990715146 267
84 3300002705 JGI25156J39149_1000024 JGI25156J39149_100002442 268
85 3300002738 JGI25154J39366_1000043 JGI25154J39366_100004343 268
86 3300002741 JGI25157J39369_1000031 JGI25157J39369_100003186 268
87 3300002987 JGI25159J45721_1001700 JGI25159J45721_10017003 268
88 3300003187 JGI25151J46595_10006874 JGI25151J46595_100068743 268
89 3300003187 JGI25151J46595_10007855 JGI25151J46595_100078552 268
90 3300003771 Ga0055526_1000974 Ga0055526_100097413 268
91 3300003771 Ga0055526_1009192 Ga0055526_10091923 268
92 3300003771 Ga0055526_1041538 Ga0055526_10415381 268
93 3300003773 Ga0055537_1000328 Ga0055537_100032818 268
94 3300003775 Ga0055524_1000101 Ga0055524_100010165 268
95 3300003781 Ga0055536_1001356 Ga0055536_10013564 268
96 3300003784 Ga0055534_1002898 Ga0055534_10028982 268
97 3300003790 Ga0055528_1002223 Ga0055528_10022236 268
98 3300003791 Ga0055530_10000251 Ga0055530_1000025111 268
99 3300003792 Ga0055540_1000099 Ga0055540_100009922 268
100 3300003794 Ga0055531_10000333 Ga0055531_100003339 268
101 3300003794 Ga0055531_10000739 Ga0055531_1000073912 268
102 3300004625 Ga0055543_1000061 Ga0055543_100006134 268
103 3300005262 Ga0065165_1009124 Ga0065165_10091242 268
104 3300005327 Ga0070658_10189340 Ga0070658_101893402 268
105 3300005334 Ga0068869_100035005 Ga0068869_1000350051 268
106 3300005467 Ga0070706_100142283 Ga0070706_1001422832 268
107 3300005468 Ga0070707_100077962 Ga0070707_1000779622 268
108 3300005530 Ga0070679_100017454 Ga0070679_1000174542 268
109 3300005539 Ga0068853_100080193 Ga0068853_1000801932 268
110 3300005563 Ga0068855_100004794 Ga0068855_1000047943 268
111 3300005563 Ga0068855_100149807 Ga0068855_1001498072 268
112 3300005563 Ga0068855_100853395 Ga0068855_1008533951 268
113 3300005577 Ga0068857_100338808 Ga0068857_1003388082 268
114 3300005618 Ga0068864_100070701 Ga0068864_1000707012 268
115 3300005834 Ga0068851_10311800 Ga0068851_103118002 268
116 3300005841 Ga0068863_100055874 Ga0068863_1000558742 268
117 3300006038 Ga0075365_10035431 Ga0075365_100354312 268
118 3300006038 Ga0075365_10088259 Ga0075365_100882592 268
119 3300006051 Ga0075364_10010882 Ga0075364_100108824 268
120 3300006353 Ga0075370_10068238 Ga0075370_100682382 268
121 3300006880 Ga0075429_100463784 Ga0075429_1004637842 268
122 3300009093 Ga0105240_10016619 Ga0105240_100166196 268
123 3300009174 Ga0105241_10033011 Ga0105241_100330112 268
124 3300010375 Ga0105239_10087691 Ga0105239_100876912 268
125 3300014969 Ga0157376_10022727 Ga0157376_100227272 268
126 3300025206 Ga0209435_100008 Ga0209435_100008371 268
127 3300025245 Ga0207425_1000418 Ga0207425_100041817 268
128 3300025245 Ga0207425_1001693 Ga0207425_10016937 268
129 3300025246 Ga0209646_1000079 Ga0209646_100007994 268
130 3300025250 Ga0209026_1000067 Ga0209026_100006794 268
131 3300025256 Ga0209759_1000056 Ga0209759_100005694 268
132 3300025263 Ga0209565_1000041 Ga0209565_100004173 268
133 3300025263 Ga0209565_1000538 Ga0209565_10005382 268
134 3300025273 Ga0209673_1000364 Ga0209673_100036464 268
135 3300025284 Ga0209130_1000245 Ga0209130_100024553 268
136 3300025284 Ga0209130_1001381 Ga0209130_10013812 268
137 3300025291 Ga0209675_1000316 Ga0209675_10003163 268
138 3300025292 Ga0209676_1000013 Ga0209676_1000013308 268
139 3300025292 Ga0209676_1004083 Ga0209676_10040832 268
140 3300025294 Ga0209025_1002942 Ga0209025_10029426 268
141 3300025294 Ga0209025_1005362 Ga0209025_10053622 268
142 3300025294 Ga0209025_1010723 Ga0209025_10107232 268
143 3300025294 Ga0209025_1017822 Ga0209025_10178222 268
144 3300025295 Ga0209564_1000363 Ga0209564_100036338 268
145 3300025295 Ga0209564_1001188 Ga0209564_100118816 268
146 3300025295 Ga0209564_1004998 Ga0209564_10049982 268
147 3300025297 Ga0209758_1011662 Ga0209758_10116625 268
148 3300025298 Ga0209050_1000008 Ga0209050_1000008308 268
149 3300025298 Ga0209050_1007985 Ga0209050_10079852 268
150 3300025298 Ga0209050_1010818 Ga0209050_10108182 268
151 3300025299 Ga0209256_1000003 Ga0209256_100000393 268
152 3300025302 Ga0207426_1000091 Ga0207426_100009187 268
153 3300025303 Ga0209051_1000005 Ga0209051_1000005308 268
154 3300025303 Ga0209051_1000214 Ga0209051_100021434 268
155 3300025304 Ga0209257_1000015 Ga0209257_1000015359 268
156 3300025304 Ga0209257_1000048 Ga0209257_1000048308 268
157 3300025304 Ga0209257_1005996 Ga0209257_10059962 268
158 3300025911 Ga0207654_10018323 Ga0207654_100183232 268
159 3300025912 Ga0207707_10070703 Ga0207707_100707032 268
160 3300025925 Ga0207650_10368350 Ga0207650_103683502 268
161 3300025929 Ga0207664_10481326 Ga0207664_104813262 268
162 3300025949 Ga0207667_10018493 Ga0207667_100184933 268
163 3300025949 Ga0207667_10096535 Ga0207667_100965352 268
164 3300026023 Ga0207677_10009193 Ga0207677_100091932 268
165 3300026088 Ga0207641_10044213 Ga0207641_100442132 268
166 3300026095 Ga0207676_10057590 Ga0207676_100575902 268
167 3300026116 Ga0207674_10243233 Ga0207674_102432332 268
168 3300027614 Ga0209970_1000057 Ga0209970_10000572 268
169 3300027876 Ga0209974_10039512 Ga0209974_100395122 268
170 3300028380 Ga0268265_10437697 Ga0268265_104376971 268
171 3300031456 Ga0307513_10000013 Ga0307513_10000013148 268
172 3300031548 Ga0307408_100059781 Ga0307408_1000597812 268
173 3300031711 Ga0265314_10014961 Ga0265314_100149613 268
174 3300031712 Ga0265342_10177995 Ga0265342_101779952 268
175 3300031730 Ga0307516_10010885 Ga0307516_100108852 268
176 3300031901 Ga0307406_10009252 Ga0307406_100092522 268
177 3300031911 Ga0307412_10113179 Ga0307412_101131792 268
178 3300032005 Ga0307411_10298610 Ga0307411_102986102 268
179 3300037312 Ga0395899_0004093 Ga0395899_0004093_6967_7773 268
180 3300037312 Ga0395899_0005604 Ga0395899_0005604_966_1775 268
181 3300037418 Ga0395900_0009645 Ga0395900_0009645_1617_2423 268
182 3300037418 Ga0395900_0029613 Ga0395900_0029613_1933_2745 268
183 3300037418 Ga0395900_0295912 Ga0395900_0295912_349_1155 268
184 3300037466 Ga0395898_0008291 Ga0395898_0008291_8073_8882 268
185 3300037466 Ga0395898_0011141 Ga0395898_0011141_3118_3924 268
186 3300037471 Ga0395905_0000047 Ga0395905_0000047_210260_211066 268
187 3300037471 Ga0395905_0003373 Ga0395905_0003373_1829_2635 268
188 3300037471 Ga0395905_0021306 Ga0395905_0021306_3262_4068 268
189 3300037471 Ga0395905_0025494 Ga0395905_0025494_4498_5304 268
190 3300037471 Ga0395905_0047730 Ga0395905_0047730_2598_3404 268
191 3300037471 Ga0395905_0069200 Ga0395905_0069200_1569_2378 268
192 3300037471 Ga0395905_0268017 Ga0395905_0268017_431_1243 268
193 3300037471 Ga0395905_0644139 Ga0395905_0644139_133_939 268
194 3300038443 Ga0395901_0011214 Ga0395901_0011214_4793_5599 268
195 3300038443 Ga0395901_0098912 Ga0395901_0098912_691_1500 268
196 3300041408 Ga0439453_0007236 Ga0439453_0007236_906_1715 268
197 3300042001 Ga0439441_020509 Ga0439441_020509_301_1110 268
198 3300042007 Ga0439449_0002256 Ga0439449_0002256_3231_4040 268
199 3300042014 Ga0439457_020332 Ga0439457_020332_330_1139 268
200 3300042015 Ga0439462_0015839 Ga0439462_0015839_684_1493 268
201 3300042156 Ga0439446_0083243 Ga0439446_0083243_132_941 268
202 3300042439 Ga0439464_0007913 Ga0439464_0007913_377_1186 268
203 3300042876 Ga0451577_0000126 Ga0451577_0000126_62664_63479 268
204 3300042876 Ga0451577_0025518 Ga0451577_0025518_594_1400 268
205 3300044656 Ga0466969_0029606 Ga0466969_0029606_1312_2118 268
206 3300044673 Ga0453683_0013716 Ga0453683_0013716_3719_4528 268
207 3300044684 Ga0466966_0114593 Ga0466966_0114593_662_1468 268
208 3300044693 Ga0466961_0074220 Ga0466961_0074220_1182_1988 268
209 3300044712 Ga0453684_0000365 Ga0453684_0000365_69989_70804 268
210 3300044712 Ga0453684_0125592 Ga0453684_0125592_1209_2015 268
211 3300044765 Ga0466970_0037469 Ga0466970_0037469_1754_2560 268
212 3300044842 Ga0466957_0073868 Ga0466957_0073868_362_1171 268
213 3300045049 Ga0466959_0205503 Ga0466959_0205503_71_880 268
214 3300045051 Ga0451576_0000627 Ga0451576_0000627_63664_64479 268
215 3300045051 Ga0451576_0005543 Ga0451576_0005543_8574_9383 268
216 3300045051 Ga0451576_0071836 Ga0451576_0071836_2295_3101 268
217 3300046558 Ga0495633_0041532 Ga0495633_0041532_724_1533 268
218 3300046615 Ga0495656_0023666 Ga0495656_0023666_217_1026 268
219 3300047447 Ga0495685_027928 Ga0495685_027928_1089_1898 268
220 3300048911 Ga0496108_0228012 Ga0496108_0228012_389_1195 268
221 3300049571 Ga0501034_0079060 Ga0501034_0079060_1639_2445 268
222 3300049579 Ga0501043_0171303 Ga0501043_0171303_349_1155 268
223 3300049580 Ga0501046_0059645 Ga0501046_0059645_1724_2530 268
224 3300049590 Ga0501074_0092268 Ga0501074_0092268_1146_1952 268
225 3300049679 Ga0501249_024272 Ga0501249_024272_360_1169 268
226 3300049822 Ga0501035_0032989 Ga0501035_0032989_1968_2774 268
227 3300049822 Ga0501035_0103879 Ga0501035_0103879_272_1081 268
228 3300049823 Ga0501044_0348673 Ga0501044_0348673_529_1338 268
229 3300049823 Ga0501044_0649749 Ga0501044_0649749_42_851 268
230 3300050492 nmdc:mga0yw44_161451_c1 nmdc:mga0yw44_161451_c1_260_1069 268
231 3300050508 nmdc:mga09592_204946_c1 nmdc:mga09592_204946_c1_261_1070 268
232 3300059426 Ga0590077_017000 Ga0590077_017000_314_1123 268
233 iso_pu_bacteria 2547132374 2548500461 268
234 iso_pu_bacteria 2643221717 2644646992 268
235 3300048924 Ga0496121_0008557 Ga0496121_0008557_10275_11087 270
236 3300048925 Ga0496122_0294146 Ga0496122_0294146_49_861 270
237 3300048928 Ga0496125_0027115 Ga0496125_0027115_142_954 270
238 3300001979 JGI24740J21852_10009520 JGI24740J21852_100095202 271
239 3300001989 JGI24739J22299_10007263 JGI24739J22299_100072632 271
240 3300001989 JGI24739J22299_10033104 JGI24739J22299_100331042 271
241 3300002739 JGI25158J39367_1005551 JGI25158J39367_10055511 271
242 3300002739 JGI25158J39367_1007034 JGI25158J39367_10070342 271
243 3300002773 JGI25152J39213_1004060 JGI25152J39213_10040602 271
244 3300002773 JGI25152J39213_1013640 JGI25152J39213_10136402 271
245 3300002774 JGI25150J39212_1005028 JGI25150J39212_10050282 271
246 3300002987 JGI25159J45721_1008872 JGI25159J45721_10088722 271
247 3300002987 JGI25159J45721_1009866 JGI25159J45721_10098662 271
248 3300003187 JGI25151J46595_10001517 JGI25151J46595_1000151710 271
249 3300003187 JGI25151J46595_10004727 JGI25151J46595_100047272 271
250 3300003187 JGI25151J46595_10013246 JGI25151J46595_100132463 271
251 3300003187 JGI25151J46595_10023959 JGI25151J46595_100239592 271
252 3300003215 JGI25153J46596_10020431 JGI25153J46596_100204312 271
253 3300003316 rootH1_10012410 rootH1_100124108 271
254 3300003320 rootH2_10008704 rootH2_100087042 271
255 3300003320 rootH2_10008705 rootH2_100087052 271
256 3300003322 rootL2_10089357 rootL2_100893572 271
257 3300003354 JGI25160J50197_1026910 JGI25160J50197_10269102 271
258 3300003354 JGI25160J50197_1030306 JGI25160J50197_10303062 271
259 3300003374 JGI25161J50226_1001559 JGI25161J50226_10015593 271
260 3300003374 JGI25161J50226_1012310 JGI25161J50226_10123101 271
261 3300003578 Ga0006562J51391_1058358 Ga0006562J51391_10583585 271
262 3300003578 Ga0006562J51391_1058359 Ga0006562J51391_10583592 271
263 3300003761 Ga0055535_1000542 Ga0055535_100054229 271
264 3300003762 Ga0055542_1000003 Ga0055542_1000003178 271
265 3300003771 Ga0055526_1030423 Ga0055526_10304232 271
266 3300003771 Ga0055526_1033425 Ga0055526_10334252 271
267 3300003773 Ga0055537_1000137 Ga0055537_100013737 271
268 3300003773 Ga0055537_1013112 Ga0055537_10131122 271
269 3300003773 Ga0055537_1014659 Ga0055537_10146592 271
270 3300003775 Ga0055524_1019857 Ga0055524_10198572 271
271 3300003775 Ga0055524_1021192 Ga0055524_10211922 271
272 3300003781 Ga0055536_1002973 Ga0055536_10029734 271
273 3300003781 Ga0055536_1012962 Ga0055536_10129622 271
274 3300003784 Ga0055534_1000118 Ga0055534_100011837 271
275 3300003784 Ga0055534_1001345 Ga0055534_10013455 271
276 3300003784 Ga0055534_1004575 Ga0055534_10045752 271
277 3300003784 Ga0055534_1005179 Ga0055534_10051792 271
278 3300003790 Ga0055528_1000152 Ga0055528_100015235 271
279 3300003790 Ga0055528_1011265 Ga0055528_10112652 271
280 3300003791 Ga0055530_10001323 Ga0055530_100013236 271
281 3300003791 Ga0055530_10011121 Ga0055530_100111212 271
282 3300003792 Ga0055540_1001243 Ga0055540_10012436 271
283 3300003792 Ga0055540_1001728 Ga0055540_10017282 271
284 3300003792 Ga0055540_1001887 Ga0055540_10018874 271
285 3300003792 Ga0055540_1009727 Ga0055540_10097272 271
286 3300003792 Ga0055540_1025462 Ga0055540_10254622 271
287 3300003794 Ga0055531_10007097 Ga0055531_100070972 271
288 3300003794 Ga0055531_10007150 Ga0055531_100071502 271
289 3300003794 Ga0055531_10036085 Ga0055531_100360852 271
290 3300003794 Ga0055531_10039140 Ga0055531_100391402 271
291 3300004625 Ga0055543_1003323 Ga0055543_10033234 271
292 3300005262 Ga0065165_1008540 Ga0065165_10085404 271
293 3300005288 Ga0065714_10020927 Ga0065714_100209272 271
294 3300005327 Ga0070658_10071203 Ga0070658_100712032 271
295 3300005327 Ga0070658_10094800 Ga0070658_100948002 271
296 3300005333 Ga0070677_10022212 Ga0070677_100222122 271
297 3300005347 Ga0070668_100094738 Ga0070668_1000947382 271
298 3300005353 Ga0070669_100036807 Ga0070669_1000368072 271
299 3300005356 Ga0070674_100216244 Ga0070674_1002162442 271
300 3300005364 Ga0070673_100035285 Ga0070673_1000352852 271
301 3300005366 Ga0070659_100148239 Ga0070659_1001482392 271
302 3300005366 Ga0070659_100353246 Ga0070659_1003532462 271
303 3300005456 Ga0070678_100043169 Ga0070678_1000431692 271
304 3300005456 Ga0070678_100086090 Ga0070678_1000860902 271
305 3300005459 Ga0068867_100077165 Ga0068867_1000771652 271
306 3300005539 Ga0068853_100012346 Ga0068853_1000123462 271
307 3300005539 Ga0068853_100109410 Ga0068853_1001094102 271
308 3300005543 Ga0070672_100062016 Ga0070672_1000620162 271
309 3300005548 Ga0070665_100256697 Ga0070665_1002566972 271
310 3300005548 Ga0070665_100486874 Ga0070665_1004868742 271
311 3300005563 Ga0068855_100015273 Ga0068855_1000152739 271
312 3300005564 Ga0070664_100029916 Ga0070664_1000299162 271
313 3300005577 Ga0068857_100038245 Ga0068857_1000382451 271
314 3300005577 Ga0068857_100310948 Ga0068857_1003109482 271
315 3300005578 Ga0068854_100175185 Ga0068854_1001751852 271
316 3300005844 Ga0068862_100024710 Ga0068862_1000247103 271
317 3300006038 Ga0075365_10040833 Ga0075365_100408332 271
318 3300006038 Ga0075365_10180673 Ga0075365_101806732 271
319 3300006048 Ga0075363_100002936 Ga0075363_1000029362 271
320 3300006048 Ga0075363_100009667 Ga0075363_1000096672 271
321 3300006048 Ga0075363_100131366 Ga0075363_1001313662 271
322 3300006051 Ga0075364_10007902 Ga0075364_100079023 271
323 3300006051 Ga0075364_10020489 Ga0075364_100204892 271
324 3300006058 Ga0075432_10044455 Ga0075432_100444552 271
325 3300006177 Ga0075362_10010620 Ga0075362_100106202 271
326 3300006177 Ga0075362_10034478 Ga0075362_100344782 271
327 3300006178 Ga0075367_10105522 Ga0075367_101055222 271
328 3300006186 Ga0075369_10062102 Ga0075369_100621021 271
329 3300006195 Ga0075366_10023521 Ga0075366_100235212 271
330 3300006195 Ga0075366_10153939 Ga0075366_101539392 271
331 3300006195 Ga0075366_10276515 Ga0075366_102765152 271
332 3300006237 Ga0097621_100175774 Ga0097621_1001757742 271
333 3300006353 Ga0075370_10001072 Ga0075370_100010725 271
334 3300006353 Ga0075370_10004593 Ga0075370_100045932 271
335 3300006353 Ga0075370_10052346 Ga0075370_100523462 271
336 3300006353 Ga0075370_10078624 Ga0075370_100786242 271
337 3300006353 Ga0075370_10187686 Ga0075370_101876862 271
338 3300006946 Ga0079104_1007224 Ga0079104_10072242 271
339 3300006948 Ga0099826_10000746 Ga0099826_1000074610 271
340 3300009148 Ga0105243_10000787 Ga0105243_1000078711 271
341 3300009148 Ga0105243_10006024 Ga0105243_100060242 271
342 3300009148 Ga0105243_10239941 Ga0105243_102399411 271
343 3300009551 Ga0105238_10401749 Ga0105238_104017492 271
344 3300011119 Ga0105246_10033388 Ga0105246_100333882 271
345 3300013100 Ga0157373_10008247 Ga0157373_100082473 271
346 3300013102 Ga0157371_10019901 Ga0157371_100199012 271
347 3300013104 Ga0157370_10005598 Ga0157370_100055983 271
348 3300013105 Ga0157369_10042153 Ga0157369_100421532 271
349 3300013306 Ga0163162_10039046 Ga0163162_100390462 271
350 3300013307 Ga0157372_10036824 Ga0157372_100368242 271
351 3300014497 Ga0182008_10000871 Ga0182008_100008717 271
352 3300014497 Ga0182008_10004373 Ga0182008_100043734 271
353 3300014497 Ga0182008_10006756 Ga0182008_100067562 271
354 3300014497 Ga0182008_10087380 Ga0182008_100873802 271
355 3300015261 Ga0182006_1004055 Ga0182006_10040558 271
356 3300015261 Ga0182006_1039701 Ga0182006_10397012 271
357 3300015261 Ga0182006_1048403 Ga0182006_10484032 271
358 3300015262 Ga0182007_10000609 Ga0182007_1000060910 271
359 3300015262 Ga0182007_10002723 Ga0182007_100027232 271
360 3300015265 Ga0182005_1048127 Ga0182005_10481271 271
361 3300015683 Ga0183362_10004 Ga0183362_1000499 271
362 3300017792 Ga0163161_10001481 Ga0163161_1000148110 271
363 3300017792 Ga0163161_10014836 Ga0163161_100148362 271
364 3300017792 Ga0163161_10074193 Ga0163161_100741932 271
365 3300017792 Ga0163161_10091821 Ga0163161_100918212 271
366 3300017792 Ga0163161_10170412 Ga0163161_101704122 271
367 3300017792 Ga0163161_10244870 Ga0163161_102448702 271
368 3300025208 Ga0209436_114069 Ga0209436_1140691 271
369 3300025208 Ga0209436_116442 Ga0209436_1164421 271
370 3300025228 Ga0209672_100365 Ga0209672_1003656 271
371 3300025229 Ga0209147_102967 Ga0209147_1029672 271
372 3300025242 Ga0209258_100015 Ga0209258_100015297 271
373 3300025245 Ga0207425_1000309 Ga0207425_100030924 271
374 3300025245 Ga0207425_1025074 Ga0207425_10250742 271
375 3300025254 Ga0209148_1000028 Ga0209148_1000028372 271
376 3300025258 Ga0209129_1000160 Ga0209129_100016033 271
377 3300025258 Ga0209129_1001108 Ga0209129_10011082 271
378 3300025263 Ga0209565_1000227 Ga0209565_100022716 271
379 3300025263 Ga0209565_1000262 Ga0209565_100026210 271
380 3300025263 Ga0209565_1000653 Ga0209565_10006535 271
381 3300025273 Ga0209673_1000286 Ga0209673_100028634 271
382 3300025273 Ga0209673_1000524 Ga0209673_100052436 271
383 3300025273 Ga0209673_1002001 Ga0209673_100200110 271
384 3300025273 Ga0209673_1005197 Ga0209673_10051972 271
385 3300025284 Ga0209130_1000965 Ga0209130_10009652 271
386 3300025284 Ga0209130_1002421 Ga0209130_10024214 271
387 3300025284 Ga0209130_1002607 Ga0209130_10026073 271
388 3300025291 Ga0209675_1000164 Ga0209675_100016434 271
389 3300025291 Ga0209675_1002522 Ga0209675_10025223 271
390 3300025291 Ga0209675_1005415 Ga0209675_10054152 271
391 3300025291 Ga0209675_1006018 Ga0209675_10060182 271
392 3300025292 Ga0209676_1000074 Ga0209676_1000074161 271
393 3300025292 Ga0209676_1000303 Ga0209676_100030354 271
394 3300025292 Ga0209676_1001391 Ga0209676_100139110 271
395 3300025292 Ga0209676_1016100 Ga0209676_10161002 271
396 3300025292 Ga0209676_1052484 Ga0209676_10524842 271
397 3300025294 Ga0209025_1000269 Ga0209025_100026987 271
398 3300025294 Ga0209025_1000637 Ga0209025_100063711 271
399 3300025294 Ga0209025_1000656 Ga0209025_100065610 271
400 3300025295 Ga0209564_1000346 Ga0209564_100034634 271
401 3300025295 Ga0209564_1000764 Ga0209564_100076429 271
402 3300025297 Ga0209758_1000039 Ga0209758_1000039377 271
403 3300025297 Ga0209758_1004890 Ga0209758_10048903 271
404 3300025297 Ga0209758_1009469 Ga0209758_10094692 271
405 3300025298 Ga0209050_1000015 Ga0209050_1000015309 271
406 3300025298 Ga0209050_1004313 Ga0209050_10043132 271
407 3300025299 Ga0209256_1000136 Ga0209256_1000136131 271
408 3300025299 Ga0209256_1000382 Ga0209256_100038219 271
409 3300025302 Ga0207426_1000108 Ga0207426_1000108115 271
410 3300025302 Ga0207426_1000130 Ga0207426_100013092 271
411 3300025303 Ga0209051_1000010 Ga0209051_1000010309 271
412 3300025303 Ga0209051_1000277 Ga0209051_100027734 271
413 3300025303 Ga0209051_1000361 Ga0209051_100036114 271
414 3300025303 Ga0209051_1001386 Ga0209051_10013867 271
415 3300025303 Ga0209051_1010675 Ga0209051_10106753 271
416 3300025303 Ga0209051_1043190 Ga0209051_10431902 271
417 3300025304 Ga0209257_1000026 Ga0209257_1000026368 271
418 3300025304 Ga0209257_1000172 Ga0209257_1000172114 271
419 3300025304 Ga0209257_1010352 Ga0209257_10103522 271
420 3300025304 Ga0209257_1021322 Ga0209257_10213222 271
421 3300025304 Ga0209257_1054820 Ga0209257_10548201 271
422 3300025321 Ga0207656_10008178 Ga0207656_100081781 271
423 3300025728 Ga0207655_1007709 Ga0207655_10077094 271
424 3300025904 Ga0207647_10131714 Ga0207647_101317142 271
425 3300025909 Ga0207705_10182000 Ga0207705_101820001 271
426 3300025914 Ga0207671_10122083 Ga0207671_101220831 271
427 3300025919 Ga0207657_10449915 Ga0207657_104499152 271
428 3300025923 Ga0207681_10029912 Ga0207681_100299122 271
429 3300025924 Ga0207694_10040683 Ga0207694_100406832 271
430 3300025933 Ga0207706_10230012 Ga0207706_102300122 271
431 3300025935 Ga0207709_10000290 Ga0207709_1000029016 271
432 3300025935 Ga0207709_10001845 Ga0207709_100018453 271
433 3300025935 Ga0207709_10060259 Ga0207709_100602592 271
434 3300025937 Ga0207669_10054975 Ga0207669_100549752 271
435 3300025937 Ga0207669_10215503 Ga0207669_102155032 271
436 3300025940 Ga0207691_10093259 Ga0207691_100932592 271
437 3300025945 Ga0207679_10060724 Ga0207679_100607242 271
438 3300025960 Ga0207651_10444212 Ga0207651_104442121 271
439 3300025972 Ga0207668_10411515 Ga0207668_104115151 271
440 3300026041 Ga0207639_10001749 Ga0207639_100017492 271
441 3300026041 Ga0207639_10094172 Ga0207639_100941722 271
442 3300026067 Ga0207678_10393781 Ga0207678_103937811 271
443 3300026089 Ga0207648_10126649 Ga0207648_101266492 271
444 3300026121 Ga0207683_10069612 Ga0207683_100696122 271
445 3300026121 Ga0207683_10150711 Ga0207683_101507112 271
446 3300026121 Ga0207683_10192686 Ga0207683_101926862 271
447 3300026142 Ga0207698_10183671 Ga0207698_101836712 271
448 3300027111 Ga0209281_1032670 Ga0209281_10326701 271
449 3300027682 Ga0209971_1003077 Ga0209971_10030772 271
450 3300027876 Ga0209974_10002191 Ga0209974_100021914 271
451 3300028379 Ga0268266_10122574 Ga0268266_101225742 271
452 3300028379 Ga0268266_10191052 Ga0268266_101910522 271
453 3300028380 Ga0268265_10068672 Ga0268265_100686722 271
454 3300028794 Ga0307515_10000034 Ga0307515_10000034222 271
455 3300030522 Ga0307512_10146128 Ga0307512_101461281 271
456 3300030732 Ga0316176_1044658 Ga0316176_10446582 271
457 3300030733 Ga0314311_1015200 Ga0314311_10152002 271
458 3300030735 Ga0316178_1092321 Ga0316178_10923212 271
459 3300030742 Ga0316183_1032606 Ga0316183_10326062 271
460 3300030742 Ga0316183_1047886 Ga0316183_10478862 271
461 3300030744 Ga0316181_1039120 Ga0316181_10391202 271
462 3300030745 Ga0316182_1038521 Ga0316182_10385212 271
463 3300031235 Ga0265330_10000122 Ga0265330_1000012210 271
464 3300031238 Ga0265332_10000006 Ga0265332_1000000691 271
465 3300031238 Ga0265332_10000048 Ga0265332_1000004857 271
466 3300031241 Ga0265325_10001946 Ga0265325_100019464 271
467 3300031251 Ga0265327_10001721 Ga0265327_1000172115 271
468 3300031456 Ga0307513_10066483 Ga0307513_100664832 271
469 3300031456 Ga0307513_10120068 Ga0307513_101200682 271
470 3300031548 Ga0307408_100000072 Ga0307408_10000007244 271
471 3300031548 Ga0307408_100026167 Ga0307408_1000261672 271
472 3300031548 Ga0307408_100088911 Ga0307408_1000889112 271
473 3300031548 Ga0307408_100175024 Ga0307408_1001750242 271
474 3300031548 Ga0307408_100645879 Ga0307408_1006458791 271
475 3300031649 Ga0307514_10004659 Ga0307514_100046598 271
476 3300031711 Ga0265314_10000132 Ga0265314_1000013248 271
477 3300031731 Ga0307405_10130148 Ga0307405_101301482 271
478 3300031824 Ga0307413_10061201 Ga0307413_100612012 271
479 3300031824 Ga0307413_10261958 Ga0307413_102619582 271
480 3300031824 Ga0307413_10265743 Ga0307413_102657431 271
481 3300031901 Ga0307406_10000249 Ga0307406_1000024910 271
482 3300031901 Ga0307406_10004096 Ga0307406_100040963 271
483 3300031903 Ga0307407_10033951 Ga0307407_100339512 271
484 3300031911 Ga0307412_10013623 Ga0307412_100136234 271
485 3300031911 Ga0307412_10028145 Ga0307412_100281452 271
486 3300031911 Ga0307412_10030084 Ga0307412_100300842 271
487 3300031911 Ga0307412_10035052 Ga0307412_100350522 271
488 3300031911 Ga0307412_10227283 Ga0307412_102272832 271
489 3300031911 Ga0307412_10388260 Ga0307412_103882601 271
490 3300031995 Ga0307409_100360714 Ga0307409_1003607142 271
491 3300032002 Ga0307416_100087871 Ga0307416_1000878712 271
492 3300032004 Ga0307414_10091968 Ga0307414_100919682 271
493 3300032004 Ga0307414_10194778 Ga0307414_101947781 271
494 3300032005 Ga0307411_10021542 Ga0307411_100215422 271
495 3300035114 Ga0373939_0128683 Ga0373939_0128683_23_838 271
496 3300041404 Ga0439436_0001605 Ga0439436_0001605_3342_4157 271
497 3300041404 Ga0439436_0003996 Ga0439436_0003996_2848_3663 271
498 3300041404 Ga0439436_0008597 Ga0439436_0008597_1133_1948 271
499 3300041405 Ga0439438_024839 Ga0439438_024839_703_1518 271
500 3300041406 Ga0439439_0000354 Ga0439439_0000354_2839_3654 271
501 3300041411 Ga0439466_0007584 Ga0439466_0007584_2293_3108 271
502 3300041411 Ga0439466_0014160 Ga0439466_0014160_406_1221 271
503 3300041413 Ga0439465_0013877 Ga0439465_0013877_1086_1901 271
504 3300041997 Ga0439431_0006224 Ga0439431_0006224_1189_2004 271
505 3300041999 Ga0439433_0001806 Ga0439433_0001806_386_1201 271
506 3300042002 Ga0439442_001254 Ga0439442_001254_2763_3578 271
507 3300042002 Ga0439442_031362 Ga0439442_031362_259_1074 271
508 3300042004 Ga0439445_0005434 Ga0439445_0005434_1827_2642 271
509 3300042006 Ga0439432_003005 Ga0439432_003005_2741_3556 271
510 3300042006 Ga0439432_028055 Ga0439432_028055_633_1448 271
511 3300042007 Ga0439449_0000821 Ga0439449_0000821_5578_6393 271
512 3300042007 Ga0439449_0010517 Ga0439449_0010517_2557_3372 271
513 3300042007 Ga0439449_0063635 Ga0439449_0063635_110_925 271
514 3300042010 Ga0439452_010149 Ga0439452_010149_1911_2726 271
515 3300042014 Ga0439457_002860 Ga0439457_002860_1552_2367 271
516 3300042015 Ga0439462_0018453 Ga0439462_0018453_80_895 271
517 3300042121 Ga0450919_003019 Ga0450919_003019_465_1280 271
518 3300042122 Ga0450920_007022 Ga0450920_007022_1085_1900 271
519 3300042125 Ga0450923_000626 Ga0450923_000626_2482_3300 271
520 3300042127 Ga0450890_003534 Ga0450890_003534_476_1291 271
521 3300042131 Ga0450894_005953 Ga0450894_005953_94_909 271
522 3300042133 Ga0450896_011176 Ga0450896_011176_408_1223 271
523 3300042147 Ga0450910_000694 Ga0450910_000694_2782_3597 271
524 3300042147 Ga0450910_005575 Ga0450910_005575_853_1668 271
525 3300042435 Ga0439434_0001123 Ga0439434_0001123_4385_5200 271
526 3300042435 Ga0439434_0001864 Ga0439434_0001864_893_1708 271
527 3300042435 Ga0439434_0025266 Ga0439434_0025266_536_1351 271
528 3300042876 Ga0451577_0002572 Ga0451577_0002572_4874_5707 271
529 3300042876 Ga0451577_0083590 Ga0451577_0083590_665_1480 271
530 3300044673 Ga0453683_0017744 Ga0453683_0017744_2911_3744 271
531 3300044683 Ga0466965_0091841 Ga0466965_0091841_610_1425 271
532 3300044712 Ga0453684_0037918 Ga0453684_0037918_644_1477 271
533 3300044901 Ga0466960_0032942 Ga0466960_0032942_1320_2135 271
534 3300045051 Ga0451576_0003400 Ga0451576_0003400_16229_17062 271
535 3300045051 Ga0451576_0397034 Ga0451576_0397034_232_1047 271
536 3300046453 Ga0495627_007976 Ga0495627_007976_796_1611 271
537 3300046453 Ga0495627_013800 Ga0495627_013800_681_1496 271
538 3300046459 Ga0495629_0177104 Ga0495629_0177104_538_1353 271
539 3300046475 Ga0495639_0007301 Ga0495639_0007301_458_1273 271
540 3300046512 Ga0495610_0032190 Ga0495610_0032190_943_1758 271
541 3300046515 Ga0495620_0072733 Ga0495620_0072733_207_1022 271
542 3300046518 Ga0495631_0000050 Ga0495631_0000050_39234_40049 271
543 3300046520 Ga0495637_0004019 Ga0495637_0004019_3214_4029 271
544 3300046520 Ga0495637_0038409 Ga0495637_0038409_334_1149 271
545 3300046525 Ga0495663_0029736 Ga0495663_0029736_369_1184 271
546 3300046528 Ga0495642_0049498 Ga0495642_0049498_258_1073 271
547 3300046615 Ga0495656_0003211 Ga0495656_0003211_192_1007 271
548 3300046616 Ga0495668_0066318 Ga0495668_0066318_83_898 271
549 3300046642 Ga0495634_0279213 Ga0495634_0279213_178_993 271
550 3300046660 Ga0495625_0000098 Ga0495625_0000098_93400_94215 271
551 3300046660 Ga0495625_0060099 Ga0495625_0060099_1507_2322 271
552 3300046663 Ga0495635_0087817 Ga0495635_0087817_971_1786 271
553 3300046674 Ga0495588_0014830 Ga0495588_0014830_2006_2821 271
554 3300046674 Ga0495588_0023421 Ga0495588_0023421_278_1093 271
555 3300046675 Ga0495657_0226432 Ga0495657_0226432_114_929 271
556 3300046683 Ga0495658_0026831 Ga0495658_0026831_1714_2529 271
557 3300046691 Ga0495670_0110751 Ga0495670_0110751_335_1150 271
558 3300046692 Ga0495671_0003067 Ga0495671_0003067_9048_9863 271
559 3300046809 Ga0495600_0150003 Ga0495600_0150003_360_1175 271
560 3300047321 Ga0495676_0013204 Ga0495676_0013204_1213_2028 271
561 3300047673 Ga0495593_0063152 Ga0495593_0063152_382_1197 271
562 3300048089 Ga0495614_0032377 Ga0495614_0032377_1163_1978 271
563 3300048903 Ga0496100_0040858 Ga0496100_0040858_520_1335 271
564 3300048904 Ga0496101_0001604 Ga0496101_0001604_7687_8502 271
565 3300048904 Ga0496101_0008375 Ga0496101_0008375_4961_5776 271
566 3300048905 Ga0496102_0010166 Ga0496102_0010166_4561_5376 271
567 3300048906 Ga0496103_0010808 Ga0496103_0010808_921_1736 271
568 3300048907 Ga0496104_0128117 Ga0496104_0128117_1005_1820 271
569 3300048908 Ga0496105_0004183 Ga0496105_0004183_4164_4979 271
570 3300048910 Ga0496107_0321526 Ga0496107_0321526_150_965 271
571 3300048911 Ga0496108_0513274 Ga0496108_0513274_76_891 271
572 3300048912 Ga0496109_0168290 Ga0496109_0168290_458_1273 271
573 3300048914 Ga0496111_0133149 Ga0496111_0133149_636_1451 271
574 3300048919 Ga0496116_0027955 Ga0496116_0027955_232_1047 271
575 3300048920 Ga0496117_0060149 Ga0496117_0060149_1402_2217 271
576 3300048920 Ga0496117_0067736 Ga0496117_0067736_95_910 271
577 3300048920 Ga0496117_0068280 Ga0496117_0068280_1305_2120 271
578 3300048921 Ga0496118_0007408 Ga0496118_0007408_7053_7868 271
579 3300048921 Ga0496118_0007776 Ga0496118_0007776_6584_7399 271
580 3300048921 Ga0496118_0142832 Ga0496118_0142832_603_1418 271
581 3300048924 Ga0496121_0107927 Ga0496121_0107927_636_1451 271
582 3300048924 Ga0496121_0162201 Ga0496121_0162201_363_1178 271
583 3300048924 Ga0496121_0198218 Ga0496121_0198218_328_1143 271
584 3300048925 Ga0496122_0002306 Ga0496122_0002306_14391_15206 271
585 3300048926 Ga0496123_0000631 Ga0496123_0000631_26065_26880 271
586 3300048926 Ga0496123_0051214 Ga0496123_0051214_1612_2427 271
587 3300048927 Ga0496124_0019022 Ga0496124_0019022_740_1555 271
588 3300048927 Ga0496124_0054996 Ga0496124_0054996_1260_2075 271
589 3300048927 Ga0496124_0070695 Ga0496124_0070695_872_1687 271
590 3300048927 Ga0496124_0088696 Ga0496124_0088696_508_1323 271
591 3300048928 Ga0496125_0003351 Ga0496125_0003351_4308_5123 271
592 3300048928 Ga0496125_0005808 Ga0496125_0005808_11021_11836 271
593 3300048928 Ga0496125_0014076 Ga0496125_0014076_4316_5131 271
594 3300048928 Ga0496125_0088516 Ga0496125_0088516_708_1523 271
595 3300048928 Ga0496125_0091791 Ga0496125_0091791_335_1150 271
596 3300048929 Ga0496126_0209117 Ga0496126_0209117_540_1355 271
597 3300048929 Ga0496126_0290439 Ga0496126_0290439_489_1304 271
598 3300049571 Ga0501034_0210259 Ga0501034_0210259_348_1166 271
599 3300049679 Ga0501249_004029 Ga0501249_004029_609_1424 271
600 3300049705 Ga0501225_0002587 Ga0501225_0002587_2034_2849 271
601 3300049759 Ga0501262_000223 Ga0501262_000223_289_1104 271
602 3300049823 Ga0501044_0305459 Ga0501044_0305459_398_1213 271
603 3300050489 nmdc:mga03683_22738_c1 nmdc:mga03683_22738_c1_840_1655 271
604 3300050489 nmdc:mga03683_6664_c1 nmdc:mga03683_6664_c1_2260_3075 271
605 3300050490 nmdc:mga03n38_10324_c1 nmdc:mga03n38_10324_c1_743_1558 271
606 3300050490 nmdc:mga03n38_41288_c1 nmdc:mga03n38_41288_c1_604_1419 271
607 3300050491 nmdc:mga00v17_6053_c1 nmdc:mga00v17_6053_c1_511_1326 271
608 3300050491 nmdc:mga00v17_78903_c1 nmdc:mga00v17_78903_c1_1018_1833 271
609 3300050492 nmdc:mga0yw44_36061_c1 nmdc:mga0yw44_36061_c1_586_1401 271
610 3300050493 nmdc:mga0k408_144878_c1 nmdc:mga0k408_144878_c1_588_1403 271
611 3300050493 nmdc:mga0k408_78342_c1 nmdc:mga0k408_78342_c1_974_1789 271
612 3300050494 nmdc:mga06z11_125475_c1 nmdc:mga06z11_125475_c1_353_1168 271
613 3300050494 nmdc:mga06z11_19009_c1 nmdc:mga06z11_19009_c1_717_1532 271
614 3300050496 nmdc:mga07m45_2557_c1 nmdc:mga07m45_2557_c1_892_1707 271
615 3300050496 nmdc:mga07m45_4055_c1 nmdc:mga07m45_4055_c1_3528_4343 271
616 3300050496 nmdc:mga07m45_69746_c1 nmdc:mga07m45_69746_c1_1023_1838 271
617 3300053093 Ga0500651_0000147 Ga0500651_0000147_2188_3003 271
618 3300053096 Ga0500641_0037790 Ga0500641_0037790_1020_1850 271
619 3300053110 Ga0500571_000101 Ga0500571_000101_18064_18879 271
620 3300053117 Ga0500593_002115 Ga0500593_002115_1191_2006 271
621 3300053118 Ga0500594_0003665 Ga0500594_0003665_930_1745 271
622 3300053121 Ga0500607_002039 Ga0500607_002039_6428_7243 271
623 3300053128 Ga0500626_011707 Ga0500626_011707_2006_2821 271
624 3300053133 Ga0500655_007262 Ga0500655_007262_23_838 271
625 3300053134 Ga0500658_0002085 Ga0500658_0002085_2877_3692 271
626 3300053134 Ga0500658_0002814 Ga0500658_0002814_2676_3491 271
627 3300053136 Ga0500559_0001099 Ga0500559_0001099_5568_6383 271
628 3300053139 Ga0500568_0000929 Ga0500568_0000929_17957_18772 271
629 3300053140 Ga0500573_0125717 Ga0500573_0125717_226_1041 271
630 3300053141 Ga0500574_003073 Ga0500574_003073_2025_2840 271
631 3300053161 Ga0500634_0052477 Ga0500634_0052477_361_1176 271
632 3300053161 Ga0500634_0070379 Ga0500634_0070379_983_1810 271
633 3300053161 Ga0500634_0104913 Ga0500634_0104913_20_835 271
634 3300053162 Ga0500638_004507 Ga0500638_004507_4132_4947 271
635 3300053177 Ga0500636_0061311 Ga0500636_0061311_342_1157 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

2

267

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2w1v-assembly1.cif.gz_B crystal structure of mouse nitrilase-2 at 1.4a resolution 0.9258 2 263
3iw3-assembly1.cif.gz_B crystal structure of hyperthermophilic nitrilase 0.9101 1 253
7ovg-assembly1.cif.gz_B the c146a variant of an amidase from pyrococcus horikoshii with bound acetamide 0.9091 1 254
1j31-assembly2.cif.gz_D crystal structure of hypothetical protein ph0642 from pyrococcus horikoshii 0.9046 1 254
1f89-assembly1.cif.gz_B crystal structure of saccharomyces cerevisiae nit3, a member of branch 10 of the nitrilase superfamily 0.8933 1 262
ID Description Score Start End Superfamily
af_O76463_1_291_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9337 2 266 3.60.110.10
af_Q8VDK1_45_315_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9313 4 267 3.60.110.10
af_O94660_4_273_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9297 4 262 3.60.110.10
af_A4I2F5_5_278_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9261 1 263 3.60.110.10
af_O76463_1_291_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9202 2 266 3.60.110.10
ID Description Score Start End GO Terms
AF-K2DXD4-F1-model_v4 Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase 0.9939 36 182 GO:0016746
AF-A0A7V9E099-F1-model_v4 Carbon-nitrogen hydrolase family protein 0.9814 131 268 GO:0016787
AF-A0A6G0XMK9-F1-model_v4 CN hydrolase domain-containing protein 0.9812 172 268
AF-A0A2N6BAK1-F1-model_v4 Amidohydrolase 0.9757 152 268 GO:0016787
AF-A0A2M8WXI3-F1-model_v4 Nitrilase 0.9755 43 268 GO:0016811

Feature Viewer

pLDDT pTM Quality
92.15 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map