F471154

General Info

Members Datasets Scaffolds Average Seq Length
634 382 581 335

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10000255|Ga0075370_100002554
Length 353
Sequence MPAAVTNDNPGDSTMSHVNRQILLASRPTGEPVAENFKLVETPVAPLADGQVLVRHHFLSLDPYMRGRMSDAKSYAAPQPLNEVMIGGTAGEVVESRSPHFKAGDQVVGMGGWQEYAVVDAGQRGVLQKVDTTHVPLSAYLGAVGMPGVTGWYGLVKIIAPKAGETVVVSSAAGAVGGAVGQLAKVRGCRVVGIAGGPDKCRMVKEELGFDECIDYRQHPDLKSMGGALKAACPDGIDGYFENVGGMLLDAVMLRANAFARVAMCGMIAGYNGEPIPMTLPQLILVNRMKIEGFIVSEHMEVWPEALKELGTLVATGKLKYRESVAQGLQNAPEAFFGLLKGRNQGKQLVKLV

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2547132374 Acidovorax radicis N35 Isolate Unclassified
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
10 2643221570 Acidovorax sp. Root568 Isolate Unclassified
11 2643221596 Acidovorax sp. Root70 Isolate Unclassified
12 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221656 Pelomonas sp. Root405 Isolate Unclassified
15 2643221658 Variovorax sp. Root411 Isolate Unclassified
16 2643221660 Methylibium sp. Root1272 Isolate Unclassified
17 2643221672 Variovorax sp. Root434 Isolate Unclassified
18 2643221683 Variovorax sp. Root473 Isolate Unclassified
19 2643221717 Acidovorax sp. Root267 Isolate Unclassified
20 2721755523 Delftia sp. HK171 Isolate Unclassified
21 2738541307 Variovorax sp. GV008 Isolate Unclassified
22 2738543019 Variovorax sp. GV040 Isolate Unclassified
23 2818991446 Variovorax sp. 1180 Isolate Unclassified
24 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
25 2831864461 Roseateles noduli HZ7 Isolate Nodule
26 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
27 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
28 2842677519 Variovorax sp. R-72495 Isolate Unclassified
29 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
30 2842733646 Variovorax sp. R-72446 Isolate Unclassified
31 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
32 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
33 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
34 2885198086 Variovorax sp. 679 Isolate Unclassified
35 2885211737 Variovorax sp. 553 Isolate Unclassified
36 2899924645 Variovorax sp. 369 Isolate Unclassified
37 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
38 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
39 2904456579 Variovorax sp. 2002 Isolate Unclassified
40 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
41 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
42 2928037797 Variovorax sp. 1126 Isolate Unclassified
43 2928044640 Variovorax sp. 1128 Isolate Unclassified
44 2928051484 Variovorax sp. 1133 Isolate Unclassified
45 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
46 2928070936 Variovorax gossypii 1167 Isolate Unclassified
47 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
48 2929520902 Variovorax beijingensis 502 Isolate Unclassified
49 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
50 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
51 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
52 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
53 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
54 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
55 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
56 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
57 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
58 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
59 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
60 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
61 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
62 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
63 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
64 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
65 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
66 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
67 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
68 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
69 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
70 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
71 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
72 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
73 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
74 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
75 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
76 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
77 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
78 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
79 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
80 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
81 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
82 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
83 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
84 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
85 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
86 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
87 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
88 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
89 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
90 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
91 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
92 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
93 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
94 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
95 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
96 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
97 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
98 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
99 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
100 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
101 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
102 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
103 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
104 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
105 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
106 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
107 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
108 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
109 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
110 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
111 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
112 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
113 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
114 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
115 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
116 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
117 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
118 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
119 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
120 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
121 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
122 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
123 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
124 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
125 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
126 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
127 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
128 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
129 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
130 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
131 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
132 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
133 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
134 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
135 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
136 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
137 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
139 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
140 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
141 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
142 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
143 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
145 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
149 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
153 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
154 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
159 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
160 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
161 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
164 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
165 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
169 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
171 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
172 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
173 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
176 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
177 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
186 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
189 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
232 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
234 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
238 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
239 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
240 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
241 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
242 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
243 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
244 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
245 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
246 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
247 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
248 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
251 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
252 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
253 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
258 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
259 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
260 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
261 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
262 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
263 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
270 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
271 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
272 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
273 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
274 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
275 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
276 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
277 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
278 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
279 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
280 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
281 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
282 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
283 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
284 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
285 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
286 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
287 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
288 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
289 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
290 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
291 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
292 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
293 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
294 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
295 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
296 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
297 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
298 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
299 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
300 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
301 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
302 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
303 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
304 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
305 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
306 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
307 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
308 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
309 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
310 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
311 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
312 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
313 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
314 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
315 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
316 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
317 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
318 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
319 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
320 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
321 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
322 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
323 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
324 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
325 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
326 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
331 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
332 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
333 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
334 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
335 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
342 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
348 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
349 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
350 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
351 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
352 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
353 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
354 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
355 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
356 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
357 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
358 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
359 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
362 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
363 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
364 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
365 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
366 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
367 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
368 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
369 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
370 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
371 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
372 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
373 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
374 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
375 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
376 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
377 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
378 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
379 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
380 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
381 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
382 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.91
Metatranscriptomes 1.58
Isolates 8.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.65
Nodule 1.42
Rhizoplane 1.42
Rhizosphere 52.21
Stem 0
Stem Tuber 0
Unclassified 12.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000002 3300002704 Bacteria 292156
2 JGI25156J39149_1000003 3300002705 Bacteria 305434
3 JGI25156J39149_1000360 3300002705 Bacteria 29472
4 JGI25156J39149_1013969 3300002705 Bacteria 1677
5 JGI25154J39366_1000009 3300002738 Bacteria 305408
6 JGI25154J39366_1001294 3300002738 Bacteria 9287
7 JGI25157J39369_1000002 3300002741 Bacteria 305434
8 JGI25157J39369_1000039 3300002741 Bacteria 128766
9 JGI25152J39213_1007790 3300002773 Bacteria 2734
10 JGI25150J39212_1000299 3300002774 Bacteria 25300
11 JGI25159J45721_1000302 3300002987 Bacteria 23151
12 JGI25159J45721_1000502 3300002987 Bacteria 17895
13 JGI25151J46595_10003392 3300003187 Bacteria 8814
14 JGI25151J46595_10027581 3300003187 Bacteria 2273
15 JGI25151J46595_10048496 3300003187 Bacteria 1467
16 JGI25153J46596_10010784 3300003215 Bacteria 4102
17 rootH1_10003791 3300003316 Bacteria 3730
18 rootH2_10044844 3300003320 Bacteria 3841
19 rootH1_10052997 3300003316 Bacteria 1238
20 rootH1_10052997 3300003323 Bacteria 4275
21 JGI25160J50197_1000145 3300003354 Bacteria 63479
22 JGI25161J50226_1000032 3300003374 Bacteria 138440
23 JGI25161J50226_1000064 3300003374 Bacteria 99448
24 Ga0006562J51391_1053800 3300003578 Bacteria 4580
25 Ga0006562J51391_1057153 3300003578 Bacteria 5380
26 Ga0006562J51391_1057155 3300003578 Bacteria 3920
27 Ga0055539_1000553 3300003752 Bacteria 10837
28 Ga0055539_1000654 3300003752 Bacteria 9218
29 Ga0055539_1004700 3300003752 Bacteria 1808
30 Ga0055533_1000028 3300003756 Bacteria 311012
31 Ga0055533_1000057 3300003756 Bacteria 194035
32 Ga0055525_1000026 3300003759 Bacteria 345798
33 Ga0055525_1000696 3300003759 Bacteria 12249
34 Ga0055535_1000438 3300003761 Bacteria 38493
35 Ga0055535_1000449 3300003761 Bacteria 37935
36 Ga0055535_1012328 3300003761 Bacteria 1310
37 Ga0055542_1000021 3300003762 Bacteria 331499
38 Ga0055529_1000331 3300003763 Bacteria 53202
39 Ga0055526_1003563 3300003771 Bacteria 9805
40 Ga0055526_1007942 3300003771 Bacteria 5393
41 Ga0055526_1009226 3300003771 Bacteria 4786
42 Ga0055526_1009233 3300003771 Bacteria 4784
43 Ga0055526_1009997 3300003771 Bacteria 4477
44 Ga0055537_1000036 3300003773 Bacteria 96045
45 Ga0055537_1000043 3300003773 Bacteria 90816
46 Ga0055537_1000537 3300003773 Bacteria 21989
47 Ga0055524_1000012 3300003775 Bacteria 260384
48 Ga0055524_1000888 3300003775 Bacteria 19418
49 Ga0055524_1004862 3300003775 Bacteria 6112
50 Ga0055524_1005810 3300003775 Bacteria 5450
51 Ga0055536_1000858 3300003781 Bacteria 19884
52 Ga0055536_1003402 3300003781 Bacteria 8561
53 Ga0055536_1004794 3300003781 Bacteria 6779
54 Ga0055534_1000018 3300003784 Bacteria 138136
55 Ga0055528_1000717 3300003790 Bacteria 23401
56 Ga0055528_1005325 3300003790 Bacteria 6010
57 Ga0055528_1007566 3300003790 Bacteria 4786
58 Ga0055530_10000015 3300003791 Bacteria 148790
59 Ga0055530_10001441 3300003791 Bacteria 17398
60 Ga0055530_10003937 3300003791 Bacteria 8038
61 Ga0055540_1000012 3300003792 Bacteria 262667
62 Ga0055540_1000039 3300003792 Bacteria 161844
63 Ga0055540_1000800 3300003792 Bacteria 21286
64 Ga0055540_1000917 3300003792 Bacteria 19241
65 Ga0055540_1000922 3300003792 Bacteria 19189
66 Ga0055540_1007984 3300003792 Bacteria 3884
67 Ga0055540_1015055 3300003792 Bacteria 2271
68 Ga0055531_10000783 3300003794 Bacteria 26398
69 Ga0055531_10006340 3300003794 Bacteria 6734
70 Ga0055531_10023607 3300003794 Bacteria 2298
71 Ga0055531_10024056 3300003794 Bacteria 2261
72 Ga0055531_10026534 3300003794 Bacteria 2063
73 Ga0055543_1000445 3300004625 Bacteria 25284
74 Ga0055543_1000516 3300004625 Bacteria 22037
75 Ga0055543_1000752 3300004625 Bacteria 16244
76 Ga0065165_1000184 3300005262 Bacteria 109539
77 Ga0065165_1000354 3300005262 Bacteria 75337
78 Ga0065165_1001466 3300005262 Bacteria 25284
79 Ga0065165_1007478 3300005262 Bacteria 5355
80 Ga0065165_1016049 3300005262 Bacteria 2823
81 Ga0065165_1016671 3300005262 Bacteria 2741
82 Ga0065714_10068241 3300005288 Bacteria 4868
83 Ga0065704_10089162 3300005289 Bacteria 2881
84 Ga0065712_10122919 3300005290 Bacteria 1645
85 Ga0070658_10022204 3300005327 Bacteria 5092
86 Ga0070658_10031424 3300005327 Bacteria 4264
87 Ga0070676_10027403 3300005328 Bacteria 3231
88 Ga0070690_100068422 3300005330 Bacteria 2303
89 Ga0070670_100001862 3300005331 Bacteria 17185
90 Ga0070670_100158873 3300005331 Bacteria 1959
91 Ga0070677_10004530 3300005333 Bacteria 4536
92 Ga0068869_100193131 3300005334 Bacteria 1602
93 Ga0070666_10017093 3300005335 Bacteria 4647
94 Ga0070680_100194800 3300005336 Bacteria 1708
95 Ga0068868_100012222 3300005338 Bacteria 6273
96 Ga0070660_100018535 3300005339 Bacteria 5087
97 Ga0070660_100172637 3300005339 Bacteria 1747
98 Ga0070660_100208910 3300005339 Bacteria 1584
99 Ga0070689_100040224 3300005340 Bacteria 3584
100 Ga0070691_10046864 3300005341 Bacteria 2054
101 Ga0070668_100202604 3300005347 Bacteria 1629
102 Ga0070669_100091172 3300005353 Bacteria 2285
103 Ga0070675_100000269 3300005354 Bacteria 34213
104 Ga0070675_100000373 3300005354 Bacteria 30278
105 Ga0070671_100005667 3300005355 Bacteria 9939
106 Ga0070671_100033809 3300005355 Bacteria 4231
107 Ga0070671_100044215 3300005355 Bacteria 3701
108 Ga0070674_100010689 3300005356 Bacteria 5562
109 Ga0070673_100009535 3300005364 Bacteria 6519
110 Ga0070673_100277824 3300005364 Bacteria 1468
111 Ga0070659_100435246 3300005366 Bacteria 1110
112 Ga0070667_100009497 3300005367 Bacteria 8067
113 Ga0070678_100010796 3300005456 Bacteria 5598
114 Ga0070678_100029774 3300005456 Bacteria 3743
115 Ga0070662_100053787 3300005457 Bacteria 2916
116 Ga0068867_100114586 3300005459 Bacteria 2075
117 Ga0070679_100032501 3300005530 Bacteria 5162
118 Ga0070679_100048853 3300005530 Bacteria 4215
119 Ga0068853_100051532 3300005539 Bacteria 3542
120 Ga0070672_100018738 3300005543 Bacteria 5012
121 Ga0070672_100414253 3300005543 Bacteria 1156
122 Ga0070665_100112863 3300005548 Bacteria 2720
123 Ga0068855_100028023 3300005563 Bacteria 6738
124 Ga0068855_100128814 3300005563 Bacteria 2891
125 Ga0068855_100143829 3300005563 Bacteria 2716
126 Ga0068855_100211523 3300005563 Bacteria 2179
127 Ga0068855_100334645 3300005563 Bacteria 1671
128 Ga0068857_100009357 3300005577 Bacteria 8507
129 Ga0068854_100002736 3300005578 Bacteria 10940
130 Ga0068854_100023819 3300005578 Bacteria 4184
131 Ga0068856_100121801 3300005614 Bacteria 2610
132 Ga0068859_100006353 3300005617 Bacteria 11993
133 Ga0068864_100001695 3300005618 Bacteria 18112
134 Ga0068861_100021943 3300005719 Bacteria 4594
135 Ga0068851_10009865 3300005834 Bacteria 4446
136 Ga0068863_100002152 3300005841 Bacteria 19541
137 Ga0068863_100081714 3300005841 Bacteria 3061
138 Ga0068858_100013023 3300005842 Bacteria 7844
139 Ga0068860_100069043 3300005843 Bacteria 3358
140 Ga0068862_100134226 3300005844 Bacteria 2192
141 Ga0075365_10057383 3300006038 Bacteria 2590
142 Ga0075365_10145674 3300006038 Bacteria 1646
143 Ga0075363_100047715 3300006048 Bacteria 2275
144 Ga0075364_10036191 3300006051 Bacteria 3191
145 Ga0075432_10015641 3300006058 Bacteria 2588
146 Ga0075362_10008792 3300006177 Bacteria 3879
147 Ga0075366_10000743 3300006195 Bacteria 15491
148 Ga0075366_10005108 3300006195 Bacteria 7097
149 Ga0075366_10074755 3300006195 Bacteria 2021
150 Ga0075370_10000255 3300006353 Bacteria 19150
151 Ga0075370_10010934 3300006353 Bacteria 4758
152 Ga0075370_10015240 3300006353 Bacteria 4111
153 Ga0075370_10030148 3300006353 Bacteria 3025
154 Ga0075429_100001889 3300006880 Bacteria 17349
155 Ga0068865_100211970 3300006881 Bacteria 1510
156 Ga0097620_100006353 3300006931 Bacteria 11993
157 Ga0079104_1000011 3300006946 Bacteria 359962
158 Ga0099826_10003934 3300006948 Bacteria 10271
159 Ga0099826_10155344 3300006948 Bacteria 1304
160 Ga0105244_10004770 3300009036 Bacteria 9224
161 Ga0105250_10009489 3300009092 Bacteria 4095
162 Ga0105240_10001089 3300009093 Bacteria 47935
163 Ga0105240_10044801 3300009093 Bacteria 5617
164 Ga0111539_10002121 3300009094 Bacteria 26502
165 Ga0114129_10023730 3300009147 Bacteria 8694
166 Ga0105243_10000246 3300009148 Bacteria 62205
167 Ga0105243_10001827 3300009148 Bacteria 18207
168 Ga0105243_10002130 3300009148 Bacteria 16732
169 Ga0105243_10227182 3300009148 Bacteria 1654
170 Ga0105248_10136036 3300009177 Bacteria 2772
171 Ga0105237_10353161 3300009545 Bacteria 1475
172 Ga0105249_10179357 3300009553 Bacteria 2059
173 Ga0157319_1000009 3300012497 Bacteria 227971
174 Ga0157370_10086305 3300013104 Bacteria 2948
175 Ga0157369_10005851 3300013105 Bacteria 14286
176 Ga0157369_10009093 3300013105 Bacteria 11370
177 Ga0157374_10011952 3300013296 Bacteria 7537
178 Ga0157378_10284231 3300013297 Bacteria 1596
179 Ga0163162_10162615 3300013306 Bacteria 2355
180 Ga0157375_10330902 3300013308 Bacteria 1688
181 Ga0163163_10000864 3300014325 Bacteria 25838
182 Ga0157380_10298890 3300014326 Bacteria 1482
183 Ga0157380_10415154 3300014326 Bacteria 1282
184 Ga0182008_10001753 3300014497 Bacteria 14233
185 Ga0182008_10020103 3300014497 Bacteria 3441
186 Ga0157379_10023287 3300014968 Bacteria 5494
187 Ga0182006_1001664 3300015261 Bacteria 13088
188 Ga0182006_1023000 3300015261 Bacteria 2584
189 Ga0182007_10000524 3300015262 Bacteria 22633
190 Ga0163161_10000139 3300017792 Bacteria 67878
191 Ga0163161_10010958 3300017792 Bacteria 6281
192 Ga0163161_10328816 3300017792 Bacteria 1210
193 Ga0213872_10000099 3300021361 Bacteria 80083
194 Ga0213872_10013435 3300021361 Bacteria 3836
195 Ga0209435_100001 3300025206 Bacteria 1424171
196 Ga0209674_100007 3300025226 Bacteria 1077082
197 Ga0209147_101671 3300025229 Bacteria 7290
198 Ga0209563_100005 3300025230 Bacteria 1774893
199 Ga0209563_100033 3300025230 Bacteria 457883
200 Ga0207427_101424 3300025231 Bacteria 8703
201 Ga0209258_100058 3300025242 Bacteria 331567
202 Ga0209258_100353 3300025242 Bacteria 63996
203 Ga0209258_100475 3300025242 Bacteria 42279
204 Ga0207425_1000157 3300025245 Bacteria 57625
205 Ga0207425_1001936 3300025245 Bacteria 7797
206 Ga0209646_1000001 3300025246 Bacteria 3092932
207 Ga0209646_1000053 3300025246 Bacteria 284737
208 Ga0209026_1000003 3300025250 Bacteria 1060571
209 Ga0209026_1000020 3300025250 Bacteria 376211
210 Ga0209677_100132 3300025253 Bacteria 72060
211 Ga0209677_100161 3300025253 Bacteria 59768
212 Ga0209677_100999 3300025253 Bacteria 13659
213 Ga0209148_1000071 3300025254 Bacteria 331551
214 Ga0209759_1000001 3300025256 Bacteria 2799452
215 Ga0209759_1000017 3300025256 Bacteria 376232
216 Ga0209759_1002547 3300025256 Bacteria 7921
217 Ga0209759_1004959 3300025256 Bacteria 4812
218 Ga0209759_1010156 3300025256 Bacteria 2779
219 Ga0209759_1019775 3300025256 Bacteria 1585
220 Ga0209129_1000494 3300025258 Bacteria 28711
221 Ga0209129_1007584 3300025258 Bacteria 3195
222 Ga0209129_1008644 3300025258 Bacteria 2802
223 Ga0209565_1000004 3300025263 Bacteria 983150
224 Ga0209565_1000038 3300025263 Bacteria 286433
225 Ga0209565_1000066 3300025263 Bacteria 173062
226 Ga0209565_1000075 3300025263 Bacteria 162259
227 Ga0209565_1001286 3300025263 Bacteria 11626
228 Ga0209565_1004849 3300025263 Bacteria 4017
229 Ga0209455_1000136 3300025272 Bacteria 146375
230 Ga0209673_1000066 3300025273 Bacteria 250037
231 Ga0209673_1000289 3300025273 Bacteria 93941
232 Ga0209673_1000357 3300025273 Bacteria 82249
233 Ga0209673_1000362 3300025273 Bacteria 81651
234 Ga0209673_1009554 3300025273 Bacteria 4180
235 Ga0209673_1014452 3300025273 Bacteria 3053
236 Ga0209673_1036032 3300025273 Bacteria 1473
237 Ga0209130_1000082 3300025284 Bacteria 164441
238 Ga0209130_1000094 3300025284 Bacteria 145569
239 Ga0209130_1000131 3300025284 Bacteria 119977
240 Ga0209130_1000929 3300025284 Bacteria 23451
241 Ga0209675_1000061 3300025291 Bacteria 181096
242 Ga0209675_1000074 3300025291 Bacteria 162260
243 Ga0209675_1000177 3300025291 Bacteria 73574
244 Ga0209675_1000930 3300025291 Bacteria 18669
245 Ga0209675_1004048 3300025291 Bacteria 6674
246 Ga0209675_1006569 3300025291 Bacteria 4633
247 Ga0209675_1008579 3300025291 Bacteria 3734
248 Ga0209676_1000005 3300025292 Bacteria 1076001
249 Ga0209676_1000029 3300025292 Bacteria 520536
250 Ga0209676_1000142 3300025292 Bacteria 175752
251 Ga0209676_1000186 3300025292 Bacteria 142440
252 Ga0209676_1001149 3300025292 Bacteria 28950
253 Ga0209676_1003547 3300025292 Bacteria 9476
254 Ga0209676_1003883 3300025292 Bacteria 8718
255 Ga0209025_1000056 3300025294 Bacteria 316188
256 Ga0209025_1000088 3300025294 Bacteria 255087
257 Ga0209025_1001607 3300025294 Bacteria 28356
258 Ga0209025_1004754 3300025294 Bacteria 11531
259 Ga0209025_1007422 3300025294 Bacteria 8182
260 Ga0209025_1012270 3300025294 Bacteria 5519
261 Ga0209025_1042395 3300025294 Bacteria 1934
262 Ga0209564_1000003 3300025295 Bacteria 1585848
263 Ga0209564_1000090 3300025295 Bacteria 249298
264 Ga0209564_1000539 3300025295 Bacteria 61208
265 Ga0209564_1000542 3300025295 Bacteria 60997
266 Ga0209564_1000969 3300025295 Bacteria 36292
267 Ga0209564_1002810 3300025295 Bacteria 12935
268 Ga0209758_1000044 3300025297 Bacteria 398448
269 Ga0209758_1002642 3300025297 Bacteria 17764
270 Ga0209758_1003972 3300025297 Bacteria 12820
271 Ga0209758_1015243 3300025297 Bacteria 4001
272 Ga0209050_1000003 3300025298 Bacteria 1609245
273 Ga0209050_1000007 3300025298 Bacteria 1187891
274 Ga0209050_1001266 3300025298 Bacteria 29109
275 Ga0209050_1001371 3300025298 Bacteria 26591
276 Ga0209050_1005923 3300025298 Bacteria 7452
277 Ga0209050_1015438 3300025298 Bacteria 3208
278 Ga0209256_1000001 3300025299 Bacteria 2166974
279 Ga0209256_1000020 3300025299 Bacteria 542402
280 Ga0209256_1000022 3300025299 Bacteria 481843
281 Ga0209256_1000600 3300025299 Bacteria 50120
282 Ga0209256_1001560 3300025299 Bacteria 22629
283 Ga0209256_1001777 3300025299 Bacteria 20459
284 Ga0207426_1000001 3300025302 Bacteria 1341301
285 Ga0207426_1000025 3300025302 Bacteria 532921
286 Ga0207426_1000031 3300025302 Bacteria 460699
287 Ga0209051_1000003 3300025303 Bacteria 1609245
288 Ga0209051_1000036 3300025303 Bacteria 339863
289 Ga0209051_1000213 3300025303 Bacteria 98755
290 Ga0209051_1000243 3300025303 Bacteria 91605
291 Ga0209051_1000455 3300025303 Bacteria 54195
292 Ga0209051_1000987 3300025303 Bacteria 27532
293 Ga0209051_1018683 3300025303 Bacteria 3058
294 Ga0209051_1021258 3300025303 Bacteria 2768
295 Ga0209051_1022261 3300025303 Bacteria 2671
296 Ga0209051_1058649 3300025303 Bacteria 1225
297 Ga0209257_1000011 3300025304 Bacteria 1112630
298 Ga0209257_1000018 3300025304 Bacteria 836016
299 Ga0209257_1000021 3300025304 Bacteria 771986
300 Ga0209257_1000226 3300025304 Bacteria 133836
301 Ga0209257_1000980 3300025304 Bacteria 38745
302 Ga0209257_1002939 3300025304 Bacteria 15675
303 Ga0209257_1009850 3300025304 Bacteria 4994
304 Ga0209257_1014547 3300025304 Bacteria 3372
305 Ga0207697_10027391 3300025315 Bacteria 2330
306 Ga0207656_10030898 3300025321 Bacteria 2215
307 Ga0207682_10000456 3300025893 Bacteria 18858
308 Ga0207680_10005735 3300025903 Bacteria 5951
309 Ga0207647_10213424 3300025904 Bacteria 1114
310 Ga0207645_10010065 3300025907 Bacteria 6511
311 Ga0207705_10153859 3300025909 Bacteria 1724
312 Ga0207695_10033270 3300025913 Bacteria 5626
313 Ga0207695_10049144 3300025913 Bacteria 4449
314 Ga0207671_10237480 3300025914 Bacteria 1431
315 Ga0207660_10203173 3300025917 Bacteria 1548
316 Ga0207657_10054433 3300025919 Bacteria 3460
317 Ga0207657_10128056 3300025919 Bacteria 2083
318 Ga0207657_10191632 3300025919 Bacteria 1649
319 Ga0207652_10073160 3300025921 Bacteria 2981
320 Ga0207681_10021166 3300025923 Bacteria 4130
321 Ga0207694_10008847 3300025924 Bacteria 7594
322 Ga0207650_10003907 3300025925 Bacteria 10190
323 Ga0207659_10000135 3300025926 Bacteria 43365
324 Ga0207659_10000412 3300025926 Bacteria 25823
325 Ga0207706_10004063 3300025933 Bacteria 13832
326 Ga0207706_10315156 3300025933 Bacteria 1362
327 Ga0207686_10009207 3300025934 Bacteria 5356
328 Ga0207709_10000074 3300025935 Bacteria 174947
329 Ga0207709_10000147 3300025935 Bacteria 97401
330 Ga0207709_10002508 3300025935 Bacteria 11471
331 Ga0207670_10094212 3300025936 Bacteria 2124
332 Ga0207669_10017445 3300025937 Bacteria 3682
333 Ga0207691_10002618 3300025940 Bacteria 17576
334 Ga0207691_10044008 3300025940 Bacteria 4111
335 Ga0207691_10222263 3300025940 Bacteria 1637
336 Ga0207711_10399669 3300025941 Bacteria 1277
337 Ga0207689_10061799 3300025942 Bacteria 3080
338 Ga0207679_10025752 3300025945 Bacteria 4049
339 Ga0207679_10055673 3300025945 Bacteria 2917
340 Ga0207679_10272712 3300025945 Bacteria 1447
341 Ga0207667_10059702 3300025949 Bacteria 3993
342 Ga0207667_10072624 3300025949 Bacteria 3576
343 Ga0207651_10001078 3300025960 Bacteria 12121
344 Ga0207651_10011381 3300025960 Bacteria 4980
345 Ga0207651_10018452 3300025960 Bacteria 4152
346 Ga0207651_10391894 3300025960 Bacteria 1180
347 Ga0207640_10007869 3300025981 Bacteria 5882
348 Ga0207658_10010935 3300025986 Bacteria 6178
349 Ga0207658_10046839 3300025986 Bacteria 3160
350 Ga0207677_10164847 3300026023 Bacteria 1726
351 Ga0207677_10248196 3300026023 Bacteria 1444
352 Ga0207703_10001097 3300026035 Bacteria 25719
353 Ga0207639_10070432 3300026041 Bacteria 2731
354 Ga0207702_10001077 3300026078 Bacteria 27952
355 Ga0207641_10004871 3300026088 Bacteria 11549
356 Ga0207641_10029888 3300026088 Bacteria 4508
357 Ga0207648_10028147 3300026089 Bacteria 4984
358 Ga0207676_10001370 3300026095 Bacteria 18134
359 Ga0207676_10028402 3300026095 Bacteria 4178
360 Ga0207674_10009929 3300026116 Bacteria 10829
361 Ga0207675_100063752 3300026118 Bacteria 3444
362 Ga0207683_10005554 3300026121 Bacteria 10802
363 Ga0207683_10008385 3300026121 Bacteria 8840
364 Ga0207698_10030616 3300026142 Bacteria 3873
365 Ga0209281_1000005 3300027111 Bacteria 1242284
366 Ga0209970_1002284 3300027614 Bacteria 3270
367 Ga0209282_1001367 3300027666 Bacteria 13338
368 Ga0209971_1008632 3300027682 Bacteria 2419
369 Ga0207428_10000486 3300027907 Bacteria 47460
370 Ga0207428_10020006 3300027907 Bacteria 5701
371 Ga0268264_10031665 3300028381 Bacteria 4336
372 Ga0265336_10000012 3300028666 Bacteria 261478
373 Ga0307515_10205530 3300028794 Bacteria 1831
374 Ga0265324_10001796 3300029957 Bacteria 11686
375 Ga0265324_10008792 3300029957 Bacteria 3982
376 Ga0307511_10061197 3300030521 Bacteria 2872
377 Ga0316180_1157121 3300030736 Bacteria 2469
378 Ga0316183_1116801 3300030742 Bacteria 6204
379 Ga0316182_1399623 3300030745 Bacteria 1740
380 Ga0265328_10014254 3300031239 Bacteria 3132
381 Ga0265331_10001642 3300031250 Bacteria 16262
382 Ga0265327_10000012 3300031251 Bacteria 530403
383 Ga0265327_10001589 3300031251 Bacteria 27701
384 Ga0307513_10000019 3300031456 Bacteria 231194
385 Ga0307513_10000051 3300031456 Bacteria 149733
386 Ga0307513_10146513 3300031456 Bacteria 2278
387 Ga0307513_10357525 3300031456 Bacteria 1206
388 Ga0307509_10325640 3300031507 Bacteria 1271
389 Ga0307408_100000010 3300031548 Bacteria 420048
390 Ga0307408_100005073 3300031548 Bacteria 8837
391 Ga0307408_100082546 3300031548 Bacteria 2406
392 Ga0307514_10001730 3300031649 Bacteria 25002
393 Ga0307514_10063221 3300031649 Bacteria 2811
394 Ga0307516_10000268 3300031730 Bacteria 66758
395 Ga0307516_10000910 3300031730 Bacteria 40607
396 Ga0307516_10009769 3300031730 Bacteria 10643
397 Ga0307516_10207558 3300031730 Bacteria 1675
398 Ga0307405_10038176 3300031731 Bacteria 2892
399 Ga0307413_10012999 3300031824 Bacteria 4165
400 Ga0307406_10005046 3300031901 Bacteria 7196
401 Ga0307406_10006192 3300031901 Bacteria 6586
402 Ga0307406_10072159 3300031901 Bacteria 2265
403 Ga0307407_10083218 3300031903 Bacteria 1941
404 Ga0307412_10003417 3300031911 Bacteria 8821
405 Ga0307412_10059241 3300031911 Bacteria 2565
406 Ga0307416_100083501 3300032002 Bacteria 2710
407 Ga0307416_100130931 3300032002 Bacteria 2258
408 Ga0307411_10003262 3300032005 Bacteria 7486
409 Ga0307411_10009327 3300032005 Bacteria 5153
410 Ga0373934_0014201 3300035086 Bacteria 3017
411 Ga0373939_0000118 3300035114 Bacteria 23751
412 Ga0373960_0002289 3300035121 Bacteria 4310
413 Ga0373961_0023755 3300035241 Bacteria 1652
414 Ga0373962_0008010 3300035242 Bacteria 2595
415 Ga0373931_0000873 3300035691 Bacteria 12732
416 Ga0373931_0010219 3300035691 Bacteria 4508
417 Ga0395899_0001240 3300037312 Bacteria 22229
418 Ga0395899_0002622 3300037312 Bacteria 14501
419 Ga0395899_0029980 3300037312 Bacteria 4094
420 Ga0395900_0000535 3300037418 Bacteria 53622
421 Ga0395900_0036004 3300037418 Bacteria 5100
422 Ga0395900_0344366 3300037418 Bacteria 1465
423 Ga0395898_0000485 3300037466 Bacteria 78871
424 Ga0395898_0120811 3300037466 Bacteria 2510
425 Ga0395898_0285188 3300037466 Bacteria 1575
426 Ga0395905_0007305 3300037471 Bacteria 11010
427 Ga0395905_0018032 3300037471 Bacteria 6702
428 Ga0395905_0027898 3300037471 Bacteria 5323
429 Ga0395905_0046926 3300037471 Bacteria 4049
430 Ga0395905_0214114 3300037471 Bacteria 1804
431 Ga0395901_0037371 3300038443 Bacteria 5022
432 Ga0395901_0086684 3300038443 Bacteria 3274
433 Ga0395901_0139747 3300038443 Bacteria 2545
434 Ga0395901_0408365 3300038443 Bacteria 1394
435 Ga0436361_0166276 3300039447 Bacteria 3363
436 Ga0436361_0720979 3300039447 Bacteria 74253
437 Ga0436361_0848510 3300039447 Bacteria 27411
438 Ga0439436_0012948 3300041404 Bacteria 2528
439 Ga0439437_002470 3300042000 Bacteria 1976
440 Ga0439449_0001507 3300042007 Bacteria 9126
441 Ga0450923_000170 3300042125 Bacteria 6022
442 Ga0450890_000362 3300042127 Bacteria 6648
443 Ga0450890_002768 3300042127 Bacteria 2379
444 Ga0450891_004720 3300042129 Bacteria 1269
445 Ga0450892_001375 3300042130 Bacteria 2411
446 Ga0450903_015923 3300042138 Bacteria 1182
447 Ga0450904_007673 3300042139 Bacteria 1070
448 Ga0450906_001542 3300042145 Bacteria 5032
449 Ga0439459_0001763 3300042438 Bacteria 3239
450 Ga0450893_0000221 3300042532 Bacteria 7597
451 Ga0451577_0000114 3300042876 Bacteria 175957
452 Ga0466969_0000002 3300044656 Bacteria 178693
453 Ga0466969_0006006 3300044656 Bacteria 6464
454 Ga0466969_0006376 3300044656 Bacteria 6277
455 Ga0466969_0016312 3300044656 Bacteria 3890
456 Ga0466972_0001454 3300044658 Bacteria 11509
457 Ga0466965_0076285 3300044683 Bacteria 1691
458 Ga0466965_0079510 3300044683 Bacteria 1656
459 Ga0466966_0023879 3300044684 Bacteria 4001
460 Ga0466966_0036473 3300044684 Bacteria 3174
461 Ga0466966_0037188 3300044684 Bacteria 3140
462 Ga0466961_0026070 3300044693 Bacteria 3758
463 Ga0466961_0052112 3300044693 Bacteria 2611
464 Ga0466961_0066092 3300044693 Bacteria 2297
465 Ga0466963_0035083 3300044694 Bacteria 3266
466 Ga0466963_0067834 3300044694 Bacteria 2395
467 Ga0466964_0017097 3300044706 Bacteria 2774
468 Ga0466964_0038470 3300044706 Bacteria 1923
469 Ga0453684_0000606 3300044712 Bacteria 132056
470 Ga0453684_0049647 3300044712 Bacteria 5529
471 Ga0466971_0036776 3300044719 Bacteria 2195
472 Ga0466970_0024329 3300044765 Bacteria 3165
473 Ga0466970_0040206 3300044765 Bacteria 2483
474 Ga0466970_0093791 3300044765 Bacteria 1631
475 Ga0466957_0025407 3300044842 Bacteria 3510
476 Ga0466957_0058309 3300044842 Bacteria 2365
477 Ga0466959_0008985 3300045049 Bacteria 7086
478 Ga0466959_0014711 3300045049 Bacteria 5695
479 Ga0466959_0040490 3300045049 Bacteria 3442
480 Ga0451576_0019867 3300045051 Bacteria 7325
481 Ga0451576_0086654 3300045051 Bacteria 3257
482 Ga0451576_0087179 3300045051 Bacteria 3247
483 Ga0466958_0052840 3300045836 Bacteria 2463
484 Ga0466958_0056548 3300045836 Bacteria 2383
485 Ga0466967_0008599 3300045976 Bacteria 7502
486 Ga0466967_0045641 3300045976 Bacteria 3808
487 Ga0495627_009890 3300046453 Bacteria 3492
488 Ga0495650_0033678 3300046471 Bacteria 2277
489 Ga0495580_0208169 3300046472 Bacteria 1346
490 Ga0495583_0001567 3300046506 Bacteria 22599
491 Ga0495606_0000606 3300046507 Bacteria 56734
492 Ga0495610_0018664 3300046512 Bacteria 3908
493 Ga0495616_0006275 3300046513 Bacteria 7218
494 Ga0495620_0057388 3300046515 Bacteria 1634
495 Ga0495631_0000441 3300046518 Bacteria 28421
496 Ga0495637_0001468 3300046520 Bacteria 13872
497 Ga0495663_0052415 3300046525 Bacteria 1266
498 Ga0495642_0010858 3300046528 Bacteria 3491
499 Ga0495654_0008489 3300046530 Bacteria 5669
500 Ga0495598_0004858 3300046537 Bacteria 2940
501 Ga0495621_0021938 3300046539 Bacteria 2111
502 Ga0495597_0000065 3300046542 Bacteria 90745
503 Ga0495656_0008104 3300046615 Bacteria 3740
504 Ga0495668_0008144 3300046616 Bacteria 6589
505 Ga0495625_0000044 3300046660 Bacteria 203855
506 Ga0495625_0084918 3300046660 Bacteria 2198
507 Ga0495669_0013029 3300046684 Bacteria 3543
508 Ga0495671_0001710 3300046692 Bacteria 14296
509 Ga0495649_0001268 3300046694 Bacteria 19452
510 Ga0495636_0033130 3300047318 Bacteria 2121
511 Ga0495676_0069842 3300047321 Bacteria 2708
512 Ga0495686_0041824 3300047472 Bacteria 2916
513 Ga0495614_0011922 3300048089 Bacteria 3821
514 Ga0496101_0023990 3300048904 Bacteria 4219
515 Ga0496102_0182439 3300048905 Bacteria 1978
516 Ga0496104_0086093 3300048907 Bacteria 3000
517 Ga0496108_0066411 3300048911 Bacteria 3041
518 Ga0496109_0224898 3300048912 Bacteria 1765
519 Ga0496112_0065778 3300048915 Bacteria 3577
520 Ga0496116_0074194 3300048919 Bacteria 2141
521 Ga0496117_0035489 3300048920 Bacteria 3741
522 Ga0496117_0074983 3300048920 Bacteria 2249
523 Ga0496118_0009730 3300048921 Bacteria 9648
524 Ga0496122_0019248 3300048925 Bacteria 6247
525 Ga0496123_0028920 3300048926 Bacteria 4092
526 Ga0496125_0024712 3300048928 Bacteria 5517
527 Ga0496125_0060343 3300048928 Bacteria 3049
528 Ga0496126_0197794 3300048929 Bacteria 1699
529 Ga0501310_001584 3300049130 Bacteria 2077
530 Ga0501305_004765 3300049161 Bacteria 1611
531 Ga0501307_003263 3300049162 Bacteria 1579
532 Ga0501300_001969 3300049523 Bacteria 3076
533 Ga0501311_002504 3300049527 Bacteria 1768
534 Ga0501312_012436 3300049528 Bacteria 1171
535 Ga0501314_001588 3300049530 Bacteria 1663
536 Ga0501315_001393 3300049531 Bacteria 2058
537 Ga0501031_0009899 3300049568 Bacteria 6208
538 Ga0501201_001519 3300049651 Bacteria 2164
539 Ga0501211_000538 3300049658 Bacteria 3722
540 Ga0501235_017532 3300049669 Bacteria 1584
541 Ga0501249_012730 3300049679 Bacteria 1780
542 Ga0501225_0003751 3300049705 Bacteria 4571
543 Ga0501229_004139 3300049706 Bacteria 1757
544 Ga0501262_000052 3300049759 Bacteria 14942
545 Ga0501262_004354 3300049759 Bacteria 1642
546 Ga0501265_002343 3300049762 Bacteria 2149
547 Ga0501265_006136 3300049762 Bacteria 1397
548 nmdc:mga00v17_49238_c1 3300050491 Bacteria 2556
549 nmdc:mga0yw44_4196_c1 3300050492 Bacteria 6558
550 nmdc:mga0k408_97917_c1 3300050493 Bacteria 1728
551 nmdc:mga06z11_156924_c1 3300050494 Bacteria 1298
552 nmdc:mga07m45_198529_c1 3300050496 Bacteria 1167
553 nmdc:mga07m45_238_c1 3300050496 Bacteria 22186
554 nmdc:mga07m45_92600_c2 3300050496 Bacteria 1287
555 nmdc:mga05p37_29220_c1 3300050507 Bacteria 6728
556 nmdc:mga09592_4640_c1 3300050508 Bacteria 11128
557 nmdc:mga08y16_3722_c1 3300050511 Bacteria 15880
558 nmdc:mga08y16_97039_c1 3300050511 Bacteria 3069
559 Ga0500610_0001062 3300053079 Bacteria 9024
560 Ga0500610_0001287 3300053079 Bacteria 8420
561 Ga0500635_0000233 3300053080 Bacteria 24594
562 Ga0500643_015386 3300053087 Bacteria 2626
563 Ga0500644_0016039 3300053088 Bacteria 2150
564 Ga0500651_0000053 3300053093 Bacteria 76219
565 Ga0500641_0149879 3300053096 Bacteria 1007
566 Ga0500571_000136 3300053110 Bacteria 24931
567 Ga0500593_000482 3300053117 Bacteria 15716
568 Ga0500593_016489 3300053117 Bacteria 3202
569 Ga0500594_0011564 3300053118 Bacteria 2062
570 Ga0500608_086963 3300053122 Bacteria 1467
571 Ga0500658_0000385 3300053134 Bacteria 19451
572 Ga0500559_0014489 3300053136 Bacteria 3332
573 Ga0500568_0002715 3300053139 Bacteria 10257
574 Ga0500574_043332 3300053141 Bacteria 1263
575 Ga0500622_0024292 3300053156 Bacteria 3204
576 Ga0500638_056152 3300053162 Bacteria 1897
577 Ga0500645_001435 3300053730 Bacteria 12097
578 Ga0500645_002264 3300053730 Bacteria 8744
579 Ga0500661_001087 3300055283 Bacteria 5115
580 Ga0500661_005496 3300055283 Bacteria 2366
581 Ga0466962_0038583 3300061719 Bacteria 2287

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053096 Ga0500641_0149879 Ga0500641_0149879_15_824 255
2 3300049762 Ga0501265_006136 Ga0501265_006136_522_1376 270
3 3300044683 Ga0466965_0076285 Ga0466965_0076285_11_868 271
4 3300044694 Ga0466963_0067834 Ga0466963_0067834_1497_2366 275
5 3300046472 Ga0495580_0208169 Ga0495580_0208169_11_880 275
6 3300025940 Ga0207691_10222263 Ga0207691_102222631 287
7 3300049759 Ga0501262_004354 Ga0501262_004354_677_1600 293
8 3300031251 Ga0265327_10001589 Ga0265327_1000158922 299
9 3300005290 Ga0065712_10122919 Ga0065712_101229191 301
10 3300005331 Ga0070670_100001862 Ga0070670_10000186210 301
11 3300005333 Ga0070677_10004530 Ga0070677_100045305 301
12 3300005354 Ga0070675_100000373 Ga0070675_10000037318 301
13 3300005356 Ga0070674_100010689 Ga0070674_1000106891 301
14 3300005456 Ga0070678_100029774 Ga0070678_1000297742 301
15 3300005543 Ga0070672_100018738 Ga0070672_1000187385 301
16 3300005548 Ga0070665_100112863 Ga0070665_1001128632 301
17 3300005834 Ga0068851_10009865 Ga0068851_100098652 301
18 3300005841 Ga0068863_100081714 Ga0068863_1000817143 301
19 3300025315 Ga0207697_10027391 Ga0207697_100273913 301
20 3300025893 Ga0207682_10000456 Ga0207682_1000045615 301
21 3300025923 Ga0207681_10021166 Ga0207681_100211663 301
22 3300025925 Ga0207650_10003907 Ga0207650_100039078 301
23 3300025926 Ga0207659_10000135 Ga0207659_1000013515 301
24 3300025937 Ga0207669_10017445 Ga0207669_100174452 301
25 3300025940 Ga0207691_10002618 Ga0207691_1000261810 301
26 3300025945 Ga0207679_10025752 Ga0207679_100257525 301
27 3300025960 Ga0207651_10001078 Ga0207651_100010789 301
28 3300025986 Ga0207658_10046839 Ga0207658_100468391 301
29 3300026023 Ga0207677_10164847 Ga0207677_101648472 301
30 3300026088 Ga0207641_10029888 Ga0207641_100298885 301
31 3300026095 Ga0207676_10028402 Ga0207676_100284025 301
32 3300026121 Ga0207683_10005554 Ga0207683_100055546 301
33 3300003323 rootH1_10052997 rootH1_100529974 303
34 3300037418 Ga0395900_0344366 Ga0395900_0344366_50_1063 310
35 3300037471 Ga0395905_0214114 Ga0395905_0214114_398_1411 310
36 iso_pu_bacteria 2856287931 2856293542 314
37 iso_pu_bacteria 2857357740 2857360701 314
38 3300005563 Ga0068855_100211523 Ga0068855_1002115231 315
39 3300009094 Ga0111539_10002121 Ga0111539_1000212121 317
40 3300027907 Ga0207428_10000486 Ga0207428_100004869 317
41 3300031548 Ga0307408_100082546 Ga0307408_1000825462 317
42 3300046525 Ga0495663_0052415 Ga0495663_0052415_258_1253 317
43 3300050511 nmdc:mga08y16_3722_c1 nmdc:mga08y16_3722_c1_586_1584 317
44 3300050511 nmdc:mga08y16_97039_c1 nmdc:mga08y16_97039_c1_1845_2843 317
45 3300014326 Ga0157380_10298890 Ga0157380_102988901 318
46 iso_pu_bacteria 2513237150 2513956832 318
47 iso_pu_bacteria 2901300506 2901306952 318
48 iso_pu_bacteria 644736347 644747782 318
49 3300005355 Ga0070671_100033809 Ga0070671_1000338096 320
50 3300048905 Ga0496102_0182439 Ga0496102_0182439_209_1228 320
51 3300048915 Ga0496112_0065778 Ga0496112_0065778_250_1269 320
52 iso_pu_bacteria 2511231002 2511247025 320
53 iso_pu_bacteria 2513020051 2513228923 320
54 iso_pu_bacteria 2547132374 2548500988 320
55 iso_pu_bacteria 2599185214 2599626594 320
56 iso_pu_bacteria 2599185226 2599675658 320
57 iso_pu_bacteria 2599185227 2599684131 320
58 iso_pu_bacteria 2599185229 2599696145 320
59 iso_pu_bacteria 2643221570 2643866697 320
60 iso_pu_bacteria 2643221596 2643993430 320
61 iso_pu_bacteria 2643221628 2644163271 320
62 iso_pu_bacteria 2643221652 2644294568 320
63 iso_pu_bacteria 2643221658 2644327874 320
64 iso_pu_bacteria 2643221672 2644397835 320
65 iso_pu_bacteria 2643221683 2644468327 320
66 iso_pu_bacteria 2643221717 2644645873 320
67 iso_pu_bacteria 2721755523 2722884054 320
68 iso_pu_bacteria 2738541307 2738885101 320
69 iso_pu_bacteria 2738543019 2739278690 320
70 iso_pu_bacteria 2818991446 2819595697 320
71 iso_pu_bacteria 2831265667 2831266709 320
72 iso_pu_bacteria 2838054893 2838057211 320
73 iso_pu_bacteria 2839138175 2839140107 320
74 iso_pu_bacteria 2842677519 2842679617 320
75 iso_pu_bacteria 2842718218 2842719951 320
76 iso_pu_bacteria 2842733646 2842734989 320
77 iso_pu_bacteria 2881101125 2881101926 320
78 iso_pu_bacteria 2885198086 2885200269 320
79 iso_pu_bacteria 2885211737 2885213936 320
80 iso_pu_bacteria 2899924645 2899925043 320
81 iso_pu_bacteria 2904449895 2904455722 320
82 iso_pu_bacteria 2904456579 2904462768 320
83 iso_pu_bacteria 2904541872 2904544828 320
84 iso_pu_bacteria 2919462493 2919467287 320
85 iso_pu_bacteria 2928037797 2928038832 320
86 iso_pu_bacteria 2928044640 2928045563 320
87 iso_pu_bacteria 2928051484 2928053179 320
88 iso_pu_bacteria 2928064002 2928066785 320
89 iso_pu_bacteria 2928070936 2928071322 320
90 iso_pu_bacteria 2928084124 2928084743 320
91 iso_pu_bacteria 2929520902 2929522705 320
92 iso_pu_bacteria 2945909444 2945912197 320
93 iso_pu_bacteria 2945972063 2945977394 320
94 iso_pu_bacteria 2954767861 2954772065 320
95 iso_pu_bacteria 2974320154 2974323104 320
96 iso_pu_bacteria 2990710928 2990712666 320
97 3300003187 JGI25151J46595_10003392 JGI25151J46595_100033926 321
98 3300003187 JGI25151J46595_10048496 JGI25151J46595_100484961 321
99 3300003759 Ga0055525_1000026 Ga0055525_100002680 321
100 3300003775 Ga0055524_1004862 Ga0055524_10048624 321
101 3300003775 Ga0055524_1005810 Ga0055524_10058105 321
102 3300025230 Ga0209563_100005 Ga0209563_1000051514 321
103 3300025263 Ga0209565_1000066 Ga0209565_1000066123 321
104 3300025263 Ga0209565_1004849 Ga0209565_10048492 321
105 3300025273 Ga0209673_1009554 Ga0209673_10095544 321
106 3300025291 Ga0209675_1000930 Ga0209675_100093017 321
107 3300025294 Ga0209025_1001607 Ga0209025_100160718 321
108 3300025294 Ga0209025_1012270 Ga0209025_10122705 321
109 3300025295 Ga0209564_1000539 Ga0209564_100053912 321
110 3300025297 Ga0209758_1015243 Ga0209758_10152434 321
111 3300025299 Ga0209256_1000600 Ga0209256_100060027 321
112 3300025299 Ga0209256_1001560 Ga0209256_100156022 321
113 3300025303 Ga0209051_1058649 Ga0209051_10586492 321
114 3300047318 Ga0495636_0033130 Ga0495636_0033130_527_1537 321
115 iso_pu_bacteria 2643221544 2643746206 321
116 iso_pu_bacteria 2643221656 2644314675 321
117 iso_pu_bacteria 2643221660 2644337930 321
118 iso_pu_bacteria 2831864461 2831866207 321
119 3300025933 Ga0207706_10004063 Ga0207706_100040637 322
120 3300031239 Ga0265328_10014254 Ga0265328_100142543 322
121 3300031250 Ga0265331_10001642 Ga0265331_100016423 322
122 3300031251 Ga0265327_10000012 Ga0265327_10000012481 322
123 3300031456 Ga0307513_10146513 Ga0307513_101465132 322
124 3300032002 Ga0307416_100130931 Ga0307416_1001309311 322
125 3300037471 Ga0395905_0018032 Ga0395905_0018032_3183_4196 322
126 3300038443 Ga0395901_0086684 Ga0395901_0086684_716_1732 322
127 3300044658 Ga0466972_0001454 Ga0466972_0001454_10145_11158 322
128 3300005327 Ga0070658_10031424 Ga0070658_100314244 323
129 3300006195 Ga0075366_10000743 Ga0075366_100007436 323
130 3300009093 Ga0105240_10044801 Ga0105240_100448013 323
131 3300009147 Ga0114129_10023730 Ga0114129_100237304 323
132 3300013308 Ga0157375_10330902 Ga0157375_103309021 323
133 3300025909 Ga0207705_10153859 Ga0207705_101538591 323
134 3300025913 Ga0207695_10033270 Ga0207695_100332703 323
135 3300025914 Ga0207671_10237480 Ga0207671_102374801 323
136 3300025960 Ga0207651_10391894 Ga0207651_103918942 323
137 3300027907 Ga0207428_10020006 Ga0207428_100200061 323
138 3300035691 Ga0373931_0010219 Ga0373931_0010219_2804_3820 323
139 3300044656 Ga0466969_0000002 Ga0466969_0000002_63811_64827 323
140 3300044684 Ga0466966_0023879 Ga0466966_0023879_1797_2813 323
141 3300044693 Ga0466961_0066092 Ga0466961_0066092_432_1448 323
142 3300045049 Ga0466959_0040490 Ga0466959_0040490_1561_2577 323
143 3300046506 Ga0495583_0001567 Ga0495583_0001567_968_1984 323
144 3300046507 Ga0495606_0000606 Ga0495606_0000606_39678_40694 323
145 3300046616 Ga0495668_0008144 Ga0495668_0008144_3274_4290 323
146 3300046684 Ga0495669_0013029 Ga0495669_0013029_2338_3354 323
147 3300046694 Ga0495649_0001268 Ga0495649_0001268_10813_11829 323
148 3300050507 nmdc:mga05p37_29220_c1 nmdc:mga05p37_29220_c1_1921_2937 323
149 3300053156 Ga0500622_0024292 Ga0500622_0024292_1835_2893 323
150 3300002704 JGI25155J39150_1000002 JGI25155J39150_100000223 324
151 3300002705 JGI25156J39149_1000003 JGI25156J39149_1000003282 324
152 3300002705 JGI25156J39149_1000360 JGI25156J39149_100036013 324
153 3300002705 JGI25156J39149_1013969 JGI25156J39149_10139693 324
154 3300002738 JGI25154J39366_1000009 JGI25154J39366_100000923 324
155 3300002738 JGI25154J39366_1001294 JGI25154J39366_10012946 324
156 3300002741 JGI25157J39369_1000002 JGI25157J39369_100000223 324
157 3300002741 JGI25157J39369_1000039 JGI25157J39369_100003918 324
158 3300002773 JGI25152J39213_1007790 JGI25152J39213_10077902 324
159 3300002774 JGI25150J39212_1000299 JGI25150J39212_10002996 324
160 3300002987 JGI25159J45721_1000302 JGI25159J45721_10003025 324
161 3300002987 JGI25159J45721_1000502 JGI25159J45721_10005025 324
162 3300003187 JGI25151J46595_10027581 JGI25151J46595_100275812 324
163 3300003215 JGI25153J46596_10010784 JGI25153J46596_100107846 324
164 3300003316 rootH1_10003791 rootH1_100037914 324
165 3300003320 rootH2_10044844 rootH2_100448443 324
166 3300003354 JGI25160J50197_1000145 JGI25160J50197_100014569 324
167 3300003374 JGI25161J50226_1000032 JGI25161J50226_1000032104 324
168 3300003374 JGI25161J50226_1000064 JGI25161J50226_100006413 324
169 3300003578 Ga0006562J51391_1053800 Ga0006562J51391_10538004 324
170 3300003578 Ga0006562J51391_1057153 Ga0006562J51391_10571532 324
171 3300003578 Ga0006562J51391_1057155 Ga0006562J51391_10571553 324
172 3300003752 Ga0055539_1000553 Ga0055539_10005534 324
173 3300003752 Ga0055539_1000654 Ga0055539_10006546 324
174 3300003752 Ga0055539_1004700 Ga0055539_10047003 324
175 3300003756 Ga0055533_1000028 Ga0055533_1000028208 324
176 3300003756 Ga0055533_1000057 Ga0055533_100005763 324
177 3300003759 Ga0055525_1000696 Ga0055525_10006964 324
178 3300003761 Ga0055535_1000438 Ga0055535_10004388 324
179 3300003761 Ga0055535_1000449 Ga0055535_100044934 324
180 3300003761 Ga0055535_1012328 Ga0055535_10123281 324
181 3300003762 Ga0055542_1000021 Ga0055542_1000021192 324
182 3300003763 Ga0055529_1000331 Ga0055529_100033141 324
183 3300003771 Ga0055526_1003563 Ga0055526_10035635 324
184 3300003771 Ga0055526_1007942 Ga0055526_10079425 324
185 3300003771 Ga0055526_1009226 Ga0055526_10092262 324
186 3300003771 Ga0055526_1009233 Ga0055526_10092332 324
187 3300003771 Ga0055526_1009997 Ga0055526_10099975 324
188 3300003773 Ga0055537_1000036 Ga0055537_100003627 324
189 3300003773 Ga0055537_1000043 Ga0055537_10000437 324
190 3300003773 Ga0055537_1000537 Ga0055537_100053722 324
191 3300003775 Ga0055524_1000012 Ga0055524_1000012120 324
192 3300003775 Ga0055524_1000888 Ga0055524_100088813 324
193 3300003781 Ga0055536_1000858 Ga0055536_100085814 324
194 3300003781 Ga0055536_1003402 Ga0055536_10034026 324
195 3300003781 Ga0055536_1004794 Ga0055536_10047947 324
196 3300003784 Ga0055534_1000018 Ga0055534_100001857 324
197 3300003790 Ga0055528_1000717 Ga0055528_10007178 324
198 3300003790 Ga0055528_1005325 Ga0055528_10053254 324
199 3300003790 Ga0055528_1007566 Ga0055528_10075662 324
200 3300003791 Ga0055530_10000015 Ga0055530_10000015121 324
201 3300003791 Ga0055530_10001441 Ga0055530_1000144112 324
202 3300003791 Ga0055530_10003937 Ga0055530_100039378 324
203 3300003792 Ga0055540_1000012 Ga0055540_1000012239 324
204 3300003792 Ga0055540_1000039 Ga0055540_100003921 324
205 3300003792 Ga0055540_1000800 Ga0055540_100080012 324
206 3300003792 Ga0055540_1000917 Ga0055540_10009175 324
207 3300003792 Ga0055540_1000922 Ga0055540_100092214 324
208 3300003792 Ga0055540_1007984 Ga0055540_10079843 324
209 3300003792 Ga0055540_1015055 Ga0055540_10150552 324
210 3300003794 Ga0055531_10000783 Ga0055531_1000078317 324
211 3300003794 Ga0055531_10006340 Ga0055531_100063404 324
212 3300003794 Ga0055531_10023607 Ga0055531_100236072 324
213 3300003794 Ga0055531_10024056 Ga0055531_100240562 324
214 3300003794 Ga0055531_10026534 Ga0055531_100265343 324
215 3300004625 Ga0055543_1000445 Ga0055543_10004456 324
216 3300004625 Ga0055543_1000516 Ga0055543_10005163 324
217 3300004625 Ga0055543_1000752 Ga0055543_100075212 324
218 3300005262 Ga0065165_1000184 Ga0065165_10001846 324
219 3300005262 Ga0065165_1000354 Ga0065165_100035453 324
220 3300005262 Ga0065165_1001466 Ga0065165_100146622 324
221 3300005262 Ga0065165_1007478 Ga0065165_10074785 324
222 3300005262 Ga0065165_1016049 Ga0065165_10160492 324
223 3300005262 Ga0065165_1016671 Ga0065165_10166713 324
224 3300005288 Ga0065714_10068241 Ga0065714_100682413 324
225 3300005289 Ga0065704_10089162 Ga0065704_100891622 324
226 3300005327 Ga0070658_10022204 Ga0070658_100222044 324
227 3300005328 Ga0070676_10027403 Ga0070676_100274032 324
228 3300005330 Ga0070690_100068422 Ga0070690_1000684223 324
229 3300005331 Ga0070670_100158873 Ga0070670_1001588732 324
230 3300005334 Ga0068869_100193131 Ga0068869_1001931312 324
231 3300005335 Ga0070666_10017093 Ga0070666_100170934 324
232 3300005336 Ga0070680_100194800 Ga0070680_1001948002 324
233 3300005338 Ga0068868_100012222 Ga0068868_1000122226 324
234 3300005339 Ga0070660_100018535 Ga0070660_1000185355 324
235 3300005339 Ga0070660_100172637 Ga0070660_1001726372 324
236 3300005339 Ga0070660_100208910 Ga0070660_1002089101 324
237 3300005340 Ga0070689_100040224 Ga0070689_1000402242 324
238 3300005341 Ga0070691_10046864 Ga0070691_100468642 324
239 3300005347 Ga0070668_100202604 Ga0070668_1002026041 324
240 3300005353 Ga0070669_100091172 Ga0070669_1000911723 324
241 3300005354 Ga0070675_100000269 Ga0070675_10000026919 324
242 3300005355 Ga0070671_100005667 Ga0070671_1000056673 324
243 3300005355 Ga0070671_100044215 Ga0070671_1000442152 324
244 3300005364 Ga0070673_100009535 Ga0070673_1000095358 324
245 3300005364 Ga0070673_100277824 Ga0070673_1002778241 324
246 3300005366 Ga0070659_100435246 Ga0070659_1004352461 324
247 3300005367 Ga0070667_100009497 Ga0070667_1000094978 324
248 3300005456 Ga0070678_100010796 Ga0070678_1000107963 324
249 3300005457 Ga0070662_100053787 Ga0070662_1000537874 324
250 3300005459 Ga0068867_100114586 Ga0068867_1001145861 324
251 3300005530 Ga0070679_100032501 Ga0070679_1000325016 324
252 3300005530 Ga0070679_100048853 Ga0070679_1000488536 324
253 3300005539 Ga0068853_100051532 Ga0068853_1000515322 324
254 3300005543 Ga0070672_100414253 Ga0070672_1004142531 324
255 3300005563 Ga0068855_100028023 Ga0068855_1000280236 324
256 3300005563 Ga0068855_100128814 Ga0068855_1001288143 324
257 3300005563 Ga0068855_100143829 Ga0068855_1001438293 324
258 3300005563 Ga0068855_100334645 Ga0068855_1003346452 324
259 3300005577 Ga0068857_100009357 Ga0068857_1000093574 324
260 3300005578 Ga0068854_100002736 Ga0068854_1000027364 324
261 3300005578 Ga0068854_100023819 Ga0068854_1000238193 324
262 3300005614 Ga0068856_100121801 Ga0068856_1001218013 324
263 3300005617 Ga0068859_100006353 Ga0068859_10000635312 324
264 3300005618 Ga0068864_100001695 Ga0068864_10000169515 324
265 3300005719 Ga0068861_100021943 Ga0068861_1000219434 324
266 3300005841 Ga0068863_100002152 Ga0068863_1000021521 324
267 3300005842 Ga0068858_100013023 Ga0068858_1000130237 324
268 3300005843 Ga0068860_100069043 Ga0068860_1000690432 324
269 3300005844 Ga0068862_100134226 Ga0068862_1001342263 324
270 3300006038 Ga0075365_10057383 Ga0075365_100573832 324
271 3300006038 Ga0075365_10145674 Ga0075365_101456742 324
272 3300006048 Ga0075363_100047715 Ga0075363_1000477151 324
273 3300006051 Ga0075364_10036191 Ga0075364_100361913 324
274 3300006058 Ga0075432_10015641 Ga0075432_100156412 324
275 3300006177 Ga0075362_10008792 Ga0075362_100087922 324
276 3300006195 Ga0075366_10005108 Ga0075366_100051087 324
277 3300006195 Ga0075366_10074755 Ga0075366_100747552 324
278 3300006353 Ga0075370_10000255 Ga0075370_100002554 324
279 3300006353 Ga0075370_10010934 Ga0075370_100109345 324
280 3300006353 Ga0075370_10015240 Ga0075370_100152401 324
281 3300006353 Ga0075370_10030148 Ga0075370_100301482 324
282 3300006880 Ga0075429_100001889 Ga0075429_10000188912 324
283 3300006881 Ga0068865_100211970 Ga0068865_1002119701 324
284 3300006931 Ga0097620_100006353 Ga0097620_1000063532 324
285 3300006946 Ga0079104_1000011 Ga0079104_1000011214 324
286 3300006948 Ga0099826_10003934 Ga0099826_100039348 324
287 3300006948 Ga0099826_10155344 Ga0099826_101553442 324
288 3300009036 Ga0105244_10004770 Ga0105244_100047707 324
289 3300009092 Ga0105250_10009489 Ga0105250_100094895 324
290 3300009093 Ga0105240_10001089 Ga0105240_1000108932 324
291 3300009148 Ga0105243_10000246 Ga0105243_100002461 324
292 3300009148 Ga0105243_10001827 Ga0105243_100018278 324
293 3300009148 Ga0105243_10002130 Ga0105243_1000213012 324
294 3300009148 Ga0105243_10227182 Ga0105243_102271821 324
295 3300009177 Ga0105248_10136036 Ga0105248_101360362 324
296 3300009545 Ga0105237_10353161 Ga0105237_103531612 324
297 3300009553 Ga0105249_10179357 Ga0105249_101793573 324
298 3300012497 Ga0157319_1000009 Ga0157319_100000935 324
299 3300013104 Ga0157370_10086305 Ga0157370_100863054 324
300 3300013105 Ga0157369_10005851 Ga0157369_100058514 324
301 3300013105 Ga0157369_10009093 Ga0157369_100090936 324
302 3300013296 Ga0157374_10011952 Ga0157374_100119525 324
303 3300013297 Ga0157378_10284231 Ga0157378_102842312 324
304 3300013306 Ga0163162_10162615 Ga0163162_101626153 324
305 3300014325 Ga0163163_10000864 Ga0163163_1000086411 324
306 3300014326 Ga0157380_10415154 Ga0157380_104151541 324
307 3300014497 Ga0182008_10001753 Ga0182008_100017536 324
308 3300014497 Ga0182008_10020103 Ga0182008_100201033 324
309 3300014968 Ga0157379_10023287 Ga0157379_100232874 324
310 3300015261 Ga0182006_1001664 Ga0182006_10016649 324
311 3300015261 Ga0182006_1023000 Ga0182006_10230003 324
312 3300015262 Ga0182007_10000524 Ga0182007_1000052415 324
313 3300017792 Ga0163161_10000139 Ga0163161_1000013963 324
314 3300017792 Ga0163161_10010958 Ga0163161_100109581 324
315 3300017792 Ga0163161_10328816 Ga0163161_103288161 324
316 3300021361 Ga0213872_10000099 Ga0213872_1000009917 324
317 3300021361 Ga0213872_10013435 Ga0213872_100134353 324
318 3300025206 Ga0209435_100001 Ga0209435_100001693 324
319 3300025226 Ga0209674_100007 Ga0209674_100007837 324
320 3300025229 Ga0209147_101671 Ga0209147_1016716 324
321 3300025230 Ga0209563_100033 Ga0209563_100033204 324
322 3300025231 Ga0207427_101424 Ga0207427_1014243 324
323 3300025242 Ga0209258_100058 Ga0209258_100058192 324
324 3300025242 Ga0209258_100353 Ga0209258_10035342 324
325 3300025242 Ga0209258_100475 Ga0209258_10047518 324
326 3300025245 Ga0207425_1000157 Ga0207425_100015748 324
327 3300025245 Ga0207425_1001936 Ga0207425_10019362 324
328 3300025246 Ga0209646_1000001 Ga0209646_10000011062 324
329 3300025246 Ga0209646_1000053 Ga0209646_100005397 324
330 3300025250 Ga0209026_1000003 Ga0209026_1000003693 324
331 3300025250 Ga0209026_1000020 Ga0209026_1000020222 324
332 3300025253 Ga0209677_100132 Ga0209677_10013248 324
333 3300025253 Ga0209677_100161 Ga0209677_10016134 324
334 3300025253 Ga0209677_100999 Ga0209677_1009994 324
335 3300025254 Ga0209148_1000071 Ga0209148_1000071192 324
336 3300025256 Ga0209759_1000001 Ga0209759_1000001693 324
337 3300025256 Ga0209759_1000017 Ga0209759_100001797 324
338 3300025256 Ga0209759_1002547 Ga0209759_10025474 324
339 3300025256 Ga0209759_1004959 Ga0209759_10049594 324
340 3300025256 Ga0209759_1010156 Ga0209759_10101562 324
341 3300025256 Ga0209759_1019775 Ga0209759_10197751 324
342 3300025258 Ga0209129_1000494 Ga0209129_100049425 324
343 3300025258 Ga0209129_1007584 Ga0209129_10075842 324
344 3300025258 Ga0209129_1008644 Ga0209129_10086442 324
345 3300025263 Ga0209565_1000004 Ga0209565_1000004515 324
346 3300025263 Ga0209565_1000038 Ga0209565_10000386 324
347 3300025263 Ga0209565_1000075 Ga0209565_1000075100 324
348 3300025263 Ga0209565_1001286 Ga0209565_10012865 324
349 3300025272 Ga0209455_1000136 Ga0209455_100013699 324
350 3300025273 Ga0209673_1000066 Ga0209673_1000066132 324
351 3300025273 Ga0209673_1000289 Ga0209673_100028977 324
352 3300025273 Ga0209673_1000357 Ga0209673_100035733 324
353 3300025273 Ga0209673_1000362 Ga0209673_100036225 324
354 3300025273 Ga0209673_1014452 Ga0209673_10144522 324
355 3300025273 Ga0209673_1036032 Ga0209673_10360322 324
356 3300025284 Ga0209130_1000082 Ga0209130_100008245 324
357 3300025284 Ga0209130_1000094 Ga0209130_100009452 324
358 3300025284 Ga0209130_1000131 Ga0209130_100013112 324
359 3300025284 Ga0209130_1000929 Ga0209130_10009292 324
360 3300025291 Ga0209675_1000061 Ga0209675_1000061115 324
361 3300025291 Ga0209675_1000074 Ga0209675_1000074100 324
362 3300025291 Ga0209675_1000177 Ga0209675_100017725 324
363 3300025291 Ga0209675_1004048 Ga0209675_10040485 324
364 3300025291 Ga0209675_1006569 Ga0209675_10065693 324
365 3300025291 Ga0209675_1008579 Ga0209675_10085794 324
366 3300025292 Ga0209676_1000005 Ga0209676_1000005834 324
367 3300025292 Ga0209676_1000029 Ga0209676_1000029388 324
368 3300025292 Ga0209676_1000142 Ga0209676_100014264 324
369 3300025292 Ga0209676_1000186 Ga0209676_100018620 324
370 3300025292 Ga0209676_1001149 Ga0209676_100114917 324
371 3300025292 Ga0209676_1003547 Ga0209676_10035472 324
372 3300025292 Ga0209676_1003883 Ga0209676_10038835 324
373 3300025294 Ga0209025_1000056 Ga0209025_1000056278 324
374 3300025294 Ga0209025_1000088 Ga0209025_1000088228 324
375 3300025294 Ga0209025_1004754 Ga0209025_100475410 324
376 3300025294 Ga0209025_1007422 Ga0209025_10074227 324
377 3300025294 Ga0209025_1042395 Ga0209025_10423952 324
378 3300025295 Ga0209564_1000003 Ga0209564_1000003386 324
379 3300025295 Ga0209564_1000090 Ga0209564_1000090115 324
380 3300025295 Ga0209564_1000542 Ga0209564_10005429 324
381 3300025295 Ga0209564_1000969 Ga0209564_100096932 324
382 3300025295 Ga0209564_1002810 Ga0209564_10028107 324
383 3300025297 Ga0209758_1000044 Ga0209758_1000044265 324
384 3300025297 Ga0209758_1002642 Ga0209758_100264212 324
385 3300025297 Ga0209758_1003972 Ga0209758_10039722 324
386 3300025298 Ga0209050_1000003 Ga0209050_1000003450 324
387 3300025298 Ga0209050_1000007 Ga0209050_1000007263 324
388 3300025298 Ga0209050_1001266 Ga0209050_10012664 324
389 3300025298 Ga0209050_1001371 Ga0209050_100137110 324
390 3300025298 Ga0209050_1005923 Ga0209050_10059232 324
391 3300025298 Ga0209050_1015438 Ga0209050_10154383 324
392 3300025299 Ga0209256_1000001 Ga0209256_1000001452 324
393 3300025299 Ga0209256_1000020 Ga0209256_1000020268 324
394 3300025299 Ga0209256_1000022 Ga0209256_1000022177 324
395 3300025299 Ga0209256_1001777 Ga0209256_100177713 324
396 3300025302 Ga0207426_1000001 Ga0207426_1000001903 324
397 3300025302 Ga0207426_1000025 Ga0207426_1000025507 324
398 3300025302 Ga0207426_1000031 Ga0207426_1000031334 324
399 3300025303 Ga0209051_1000003 Ga0209051_1000003450 324
400 3300025303 Ga0209051_1000036 Ga0209051_1000036185 324
401 3300025303 Ga0209051_1000213 Ga0209051_100021372 324
402 3300025303 Ga0209051_1000243 Ga0209051_100024364 324
403 3300025303 Ga0209051_1000455 Ga0209051_100045517 324
404 3300025303 Ga0209051_1000987 Ga0209051_100098710 324
405 3300025303 Ga0209051_1018683 Ga0209051_10186832 324
406 3300025303 Ga0209051_1021258 Ga0209051_10212582 324
407 3300025303 Ga0209051_1022261 Ga0209051_10222612 324
408 3300025304 Ga0209257_1000011 Ga0209257_1000011808 324
409 3300025304 Ga0209257_1000018 Ga0209257_1000018450 324
410 3300025304 Ga0209257_1000021 Ga0209257_1000021733 324
411 3300025304 Ga0209257_1000226 Ga0209257_1000226109 324
412 3300025304 Ga0209257_1000980 Ga0209257_100098016 324
413 3300025304 Ga0209257_1002939 Ga0209257_10029393 324
414 3300025304 Ga0209257_1009850 Ga0209257_10098502 324
415 3300025304 Ga0209257_1014547 Ga0209257_10145473 324
416 3300025321 Ga0207656_10030898 Ga0207656_100308982 324
417 3300025903 Ga0207680_10005735 Ga0207680_100057356 324
418 3300025904 Ga0207647_10213424 Ga0207647_102134241 324
419 3300025907 Ga0207645_10010065 Ga0207645_100100655 324
420 3300025913 Ga0207695_10049144 Ga0207695_100491442 324
421 3300025917 Ga0207660_10203173 Ga0207660_102031732 324
422 3300025919 Ga0207657_10054433 Ga0207657_100544332 324
423 3300025919 Ga0207657_10128056 Ga0207657_101280563 324
424 3300025919 Ga0207657_10191632 Ga0207657_101916322 324
425 3300025921 Ga0207652_10073160 Ga0207652_100731605 324
426 3300025924 Ga0207694_10008847 Ga0207694_100088473 324
427 3300025926 Ga0207659_10000412 Ga0207659_100004129 324
428 3300025933 Ga0207706_10315156 Ga0207706_103151562 324
429 3300025934 Ga0207686_10009207 Ga0207686_100092072 324
430 3300025935 Ga0207709_10000074 Ga0207709_1000007498 324
431 3300025935 Ga0207709_10000147 Ga0207709_1000014717 324
432 3300025935 Ga0207709_10002508 Ga0207709_100025085 324
433 3300025936 Ga0207670_10094212 Ga0207670_100942122 324
434 3300025940 Ga0207691_10044008 Ga0207691_100440085 324
435 3300025941 Ga0207711_10399669 Ga0207711_103996692 324
436 3300025942 Ga0207689_10061799 Ga0207689_100617993 324
437 3300025945 Ga0207679_10055673 Ga0207679_100556733 324
438 3300025945 Ga0207679_10272712 Ga0207679_102727122 324
439 3300025949 Ga0207667_10059702 Ga0207667_100597022 324
440 3300025949 Ga0207667_10072624 Ga0207667_100726246 324
441 3300025960 Ga0207651_10011381 Ga0207651_100113814 324
442 3300025960 Ga0207651_10018452 Ga0207651_100184525 324
443 3300025981 Ga0207640_10007869 Ga0207640_100078694 324
444 3300025986 Ga0207658_10010935 Ga0207658_100109355 324
445 3300026023 Ga0207677_10248196 Ga0207677_102481961 324
446 3300026035 Ga0207703_10001097 Ga0207703_1000109719 324
447 3300026041 Ga0207639_10070432 Ga0207639_100704323 324
448 3300026078 Ga0207702_10001077 Ga0207702_100010778 324
449 3300026088 Ga0207641_10004871 Ga0207641_1000487112 324
450 3300026089 Ga0207648_10028147 Ga0207648_100281473 324
451 3300026095 Ga0207676_10001370 Ga0207676_100013706 324
452 3300026116 Ga0207674_10009929 Ga0207674_100099292 324
453 3300026118 Ga0207675_100063752 Ga0207675_1000637522 324
454 3300026121 Ga0207683_10008385 Ga0207683_100083853 324
455 3300026142 Ga0207698_10030616 Ga0207698_100306165 324
456 3300027111 Ga0209281_1000005 Ga0209281_1000005727 324
457 3300027614 Ga0209970_1002284 Ga0209970_10022842 324
458 3300027666 Ga0209282_1001367 Ga0209282_10013679 324
459 3300027682 Ga0209971_1008632 Ga0209971_10086322 324
460 3300028381 Ga0268264_10031665 Ga0268264_100316652 324
461 3300028666 Ga0265336_10000012 Ga0265336_10000012128 324
462 3300028794 Ga0307515_10205530 Ga0307515_102055302 324
463 3300029957 Ga0265324_10001796 Ga0265324_100017964 324
464 3300029957 Ga0265324_10008792 Ga0265324_100087923 324
465 3300030521 Ga0307511_10061197 Ga0307511_100611972 324
466 3300030736 Ga0316180_1157121 Ga0316180_11571213 324
467 3300030742 Ga0316183_1116801 Ga0316183_11168016 324
468 3300030745 Ga0316182_1399623 Ga0316182_13996232 324
469 3300031456 Ga0307513_10000019 Ga0307513_1000001984 324
470 3300031456 Ga0307513_10000051 Ga0307513_1000005156 324
471 3300031456 Ga0307513_10357525 Ga0307513_103575251 324
472 3300031507 Ga0307509_10325640 Ga0307509_103256401 324
473 3300031548 Ga0307408_100000010 Ga0307408_100000010298 324
474 3300031548 Ga0307408_100005073 Ga0307408_1000050738 324
475 3300031649 Ga0307514_10001730 Ga0307514_1000173011 324
476 3300031649 Ga0307514_10063221 Ga0307514_100632212 324
477 3300031730 Ga0307516_10000268 Ga0307516_1000026833 324
478 3300031730 Ga0307516_10000910 Ga0307516_1000091021 324
479 3300031730 Ga0307516_10009769 Ga0307516_100097694 324
480 3300031730 Ga0307516_10207558 Ga0307516_102075582 324
481 3300031731 Ga0307405_10038176 Ga0307405_100381763 324
482 3300031824 Ga0307413_10012999 Ga0307413_100129992 324
483 3300031901 Ga0307406_10005046 Ga0307406_100050462 324
484 3300031901 Ga0307406_10006192 Ga0307406_100061925 324
485 3300031901 Ga0307406_10072159 Ga0307406_100721593 324
486 3300031903 Ga0307407_10083218 Ga0307407_100832182 324
487 3300031911 Ga0307412_10003417 Ga0307412_100034173 324
488 3300031911 Ga0307412_10059241 Ga0307412_100592413 324
489 3300032002 Ga0307416_100083501 Ga0307416_1000835012 324
490 3300032005 Ga0307411_10003262 Ga0307411_100032628 324
491 3300032005 Ga0307411_10009327 Ga0307411_100093273 324
492 3300035086 Ga0373934_0014201 Ga0373934_0014201_1158_2177 324
493 3300035114 Ga0373939_0000118 Ga0373939_0000118_16410_17429 324
494 3300035121 Ga0373960_0002289 Ga0373960_0002289_118_1137 324
495 3300035241 Ga0373961_0023755 Ga0373961_0023755_203_1222 324
496 3300035242 Ga0373962_0008010 Ga0373962_0008010_363_1382 324
497 3300035691 Ga0373931_0000873 Ga0373931_0000873_1732_2751 324
498 3300037312 Ga0395899_0001240 Ga0395899_0001240_19556_20572 324
499 3300037312 Ga0395899_0002622 Ga0395899_0002622_8779_9798 324
500 3300037312 Ga0395899_0029980 Ga0395899_0029980_1288_2304 324
501 3300037418 Ga0395900_0000535 Ga0395900_0000535_25426_26445 324
502 3300037418 Ga0395900_0036004 Ga0395900_0036004_610_1626 324
503 3300037466 Ga0395898_0000485 Ga0395898_0000485_14612_15634 324
504 3300037466 Ga0395898_0120811 Ga0395898_0120811_87_1106 324
505 3300037466 Ga0395898_0285188 Ga0395898_0285188_479_1495 324
506 3300037471 Ga0395905_0007305 Ga0395905_0007305_2444_3484 324
507 3300037471 Ga0395905_0027898 Ga0395905_0027898_2295_3311 324
508 3300037471 Ga0395905_0046926 Ga0395905_0046926_2970_3986 324
509 3300038443 Ga0395901_0037371 Ga0395901_0037371_414_1433 324
510 3300038443 Ga0395901_0139747 Ga0395901_0139747_694_1713 324
511 3300038443 Ga0395901_0408365 Ga0395901_0408365_299_1315 324
512 3300039447 Ga0436361_0166276 Ga0436361_0166276_1087_2106 324
513 3300039447 Ga0436361_0720979 Ga0436361_0720979_55771_56796 324
514 3300039447 Ga0436361_0848510 Ga0436361_0848510_18016_19038 324
515 3300041404 Ga0439436_0012948 Ga0439436_0012948_417_1439 324
516 3300042000 Ga0439437_002470 Ga0439437_002470_29_1048 324
517 3300042007 Ga0439449_0001507 Ga0439449_0001507_4054_5070 324
518 3300042125 Ga0450923_000170 Ga0450923_000170_1821_2837 324
519 3300042127 Ga0450890_000362 Ga0450890_000362_3991_5010 324
520 3300042127 Ga0450890_002768 Ga0450890_002768_1239_2258 324
521 3300042129 Ga0450891_004720 Ga0450891_004720_129_1148 324
522 3300042130 Ga0450892_001375 Ga0450892_001375_122_1141 324
523 3300042138 Ga0450903_015923 Ga0450903_015923_29_1048 324
524 3300042139 Ga0450904_007673 Ga0450904_007673_19_1035 324
525 3300042145 Ga0450906_001542 Ga0450906_001542_902_1918 324
526 3300042438 Ga0439459_0001763 Ga0439459_0001763_648_1667 324
527 3300042532 Ga0450893_0000221 Ga0450893_0000221_4365_5384 324
528 3300042876 Ga0451577_0000114 Ga0451577_0000114_137853_138869 324
529 3300044656 Ga0466969_0006006 Ga0466969_0006006_148_1167 324
530 3300044656 Ga0466969_0006376 Ga0466969_0006376_3315_4334 324
531 3300044656 Ga0466969_0016312 Ga0466969_0016312_140_1156 324
532 3300044683 Ga0466965_0079510 Ga0466965_0079510_328_1347 324
533 3300044684 Ga0466966_0036473 Ga0466966_0036473_1887_2906 324
534 3300044684 Ga0466966_0037188 Ga0466966_0037188_904_1923 324
535 3300044693 Ga0466961_0026070 Ga0466961_0026070_737_1753 324
536 3300044693 Ga0466961_0052112 Ga0466961_0052112_1432_2451 324
537 3300044694 Ga0466963_0035083 Ga0466963_0035083_1906_2925 324
538 3300044706 Ga0466964_0017097 Ga0466964_0017097_1612_2631 324
539 3300044706 Ga0466964_0038470 Ga0466964_0038470_591_1610 324
540 3300044712 Ga0453684_0000606 Ga0453684_0000606_51914_52930 324
541 3300044712 Ga0453684_0049647 Ga0453684_0049647_485_1504 324
542 3300044719 Ga0466971_0036776 Ga0466971_0036776_388_1407 324
543 3300044765 Ga0466970_0024329 Ga0466970_0024329_1107_2126 324
544 3300044765 Ga0466970_0040206 Ga0466970_0040206_304_1323 324
545 3300044765 Ga0466970_0093791 Ga0466970_0093791_140_1156 324
546 3300044842 Ga0466957_0025407 Ga0466957_0025407_1703_2722 324
547 3300044842 Ga0466957_0058309 Ga0466957_0058309_261_1280 324
548 3300045049 Ga0466959_0008985 Ga0466959_0008985_4292_5311 324
549 3300045049 Ga0466959_0014711 Ga0466959_0014711_3937_4956 324
550 3300045051 Ga0451576_0019867 Ga0451576_0019867_1845_2864 324
551 3300045051 Ga0451576_0086654 Ga0451576_0086654_1930_2949 324
552 3300045051 Ga0451576_0087179 Ga0451576_0087179_673_1689 324
553 3300045836 Ga0466958_0052840 Ga0466958_0052840_358_1377 324
554 3300045836 Ga0466958_0056548 Ga0466958_0056548_212_1231 324
555 3300045976 Ga0466967_0008599 Ga0466967_0008599_6329_7348 324
556 3300045976 Ga0466967_0045641 Ga0466967_0045641_2203_3222 324
557 3300046453 Ga0495627_009890 Ga0495627_009890_489_1505 324
558 3300046471 Ga0495650_0033678 Ga0495650_0033678_752_1771 324
559 3300046512 Ga0495610_0018664 Ga0495610_0018664_438_1454 324
560 3300046513 Ga0495616_0006275 Ga0495616_0006275_531_1547 324
561 3300046515 Ga0495620_0057388 Ga0495620_0057388_259_1278 324
562 3300046518 Ga0495631_0000441 Ga0495631_0000441_22881_23897 324
563 3300046520 Ga0495637_0001468 Ga0495637_0001468_6056_7072 324
564 3300046528 Ga0495642_0010858 Ga0495642_0010858_1499_2515 324
565 3300046530 Ga0495654_0008489 Ga0495654_0008489_3918_4934 324
566 3300046537 Ga0495598_0004858 Ga0495598_0004858_1375_2397 324
567 3300046539 Ga0495621_0021938 Ga0495621_0021938_423_1445 324
568 3300046542 Ga0495597_0000065 Ga0495597_0000065_76492_77529 324
569 3300046615 Ga0495656_0008104 Ga0495656_0008104_697_1713 324
570 3300046660 Ga0495625_0000044 Ga0495625_0000044_76770_77786 324
571 3300046660 Ga0495625_0084918 Ga0495625_0084918_673_1689 324
572 3300046692 Ga0495671_0001710 Ga0495671_0001710_723_1739 324
573 3300047321 Ga0495676_0069842 Ga0495676_0069842_568_1584 324
574 3300047472 Ga0495686_0041824 Ga0495686_0041824_869_1888 324
575 3300048089 Ga0495614_0011922 Ga0495614_0011922_656_1672 324
576 3300048904 Ga0496101_0023990 Ga0496101_0023990_2957_3973 324
577 3300048907 Ga0496104_0086093 Ga0496104_0086093_688_1710 324
578 3300048911 Ga0496108_0066411 Ga0496108_0066411_1072_2094 324
579 3300048912 Ga0496109_0224898 Ga0496109_0224898_270_1292 324
580 3300048919 Ga0496116_0074194 Ga0496116_0074194_823_1839 324
581 3300048920 Ga0496117_0035489 Ga0496117_0035489_172_1188 324
582 3300048920 Ga0496117_0074983 Ga0496117_0074983_152_1168 324
583 3300048921 Ga0496118_0009730 Ga0496118_0009730_2641_3657 324
584 3300048925 Ga0496122_0019248 Ga0496122_0019248_1625_2641 324
585 3300048926 Ga0496123_0028920 Ga0496123_0028920_2494_3510 324
586 3300048928 Ga0496125_0024712 Ga0496125_0024712_516_1532 324
587 3300048928 Ga0496125_0060343 Ga0496125_0060343_991_2007 324
588 3300048929 Ga0496126_0197794 Ga0496126_0197794_51_1067 324
589 3300049130 Ga0501310_001584 Ga0501310_001584_280_1299 324
590 3300049161 Ga0501305_004765 Ga0501305_004765_222_1241 324
591 3300049162 Ga0501307_003263 Ga0501307_003263_190_1209 324
592 3300049523 Ga0501300_001969 Ga0501300_001969_2013_3032 324
593 3300049527 Ga0501311_002504 Ga0501311_002504_738_1757 324
594 3300049528 Ga0501312_012436 Ga0501312_012436_140_1159 324
595 3300049530 Ga0501314_001588 Ga0501314_001588_274_1293 324
596 3300049531 Ga0501315_001393 Ga0501315_001393_139_1158 324
597 3300049568 Ga0501031_0009899 Ga0501031_0009899_4717_5733 324
598 3300049651 Ga0501201_001519 Ga0501201_001519_952_1971 324
599 3300049658 Ga0501211_000538 Ga0501211_000538_611_1630 324
600 3300049669 Ga0501235_017532 Ga0501235_017532_37_1056 324
601 3300049679 Ga0501249_012730 Ga0501249_012730_229_1248 324
602 3300049705 Ga0501225_0003751 Ga0501225_0003751_3416_4432 324
603 3300049706 Ga0501229_004139 Ga0501229_004139_552_1571 324
604 3300049759 Ga0501262_000052 Ga0501262_000052_12456_13472 324
605 3300049762 Ga0501265_002343 Ga0501265_002343_423_1442 324
606 3300050491 nmdc:mga00v17_49238_c1 nmdc:mga00v17_49238_c1_1377_2393 324
607 3300050492 nmdc:mga0yw44_4196_c1 nmdc:mga0yw44_4196_c1_1922_2938 324
608 3300050493 nmdc:mga0k408_97917_c1 nmdc:mga0k408_97917_c1_376_1395 324
609 3300050494 nmdc:mga06z11_156924_c1 nmdc:mga06z11_156924_c1_249_1265 324
610 3300050496 nmdc:mga07m45_198529_c1 nmdc:mga07m45_198529_c1_100_1116 324
611 3300050496 nmdc:mga07m45_238_c1 nmdc:mga07m45_238_c1_215_1234 324
612 3300050496 nmdc:mga07m45_92600_c2 nmdc:mga07m45_92600_c2_204_1220 324
613 3300050508 nmdc:mga09592_4640_c1 nmdc:mga09592_4640_c1_4898_5923 324
614 3300053079 Ga0500610_0001062 Ga0500610_0001062_927_1943 324
615 3300053079 Ga0500610_0001287 Ga0500610_0001287_6154_7170 324
616 3300053080 Ga0500635_0000233 Ga0500635_0000233_7989_9008 324
617 3300053087 Ga0500643_015386 Ga0500643_015386_981_1997 324
618 3300053088 Ga0500644_0016039 Ga0500644_0016039_433_1449 324
619 3300053093 Ga0500651_0000053 Ga0500651_0000053_51472_52488 324
620 3300053110 Ga0500571_000136 Ga0500571_000136_990_2006 324
621 3300053117 Ga0500593_000482 Ga0500593_000482_5466_6494 324
622 3300053117 Ga0500593_016489 Ga0500593_016489_903_1919 324
623 3300053118 Ga0500594_0011564 Ga0500594_0011564_25_1041 324
624 3300053122 Ga0500608_086963 Ga0500608_086963_324_1343 324
625 3300053134 Ga0500658_0000385 Ga0500658_0000385_1237_2253 324
626 3300053136 Ga0500559_0014489 Ga0500559_0014489_1747_2802 324
627 3300053139 Ga0500568_0002715 Ga0500568_0002715_1734_2750 324
628 3300053141 Ga0500574_043332 Ga0500574_043332_152_1168 324
629 3300053162 Ga0500638_056152 Ga0500638_056152_810_1826 324
630 3300053730 Ga0500645_001435 Ga0500645_001435_845_1861 324
631 3300053730 Ga0500645_002264 Ga0500645_002264_2633_3649 324
632 3300055283 Ga0500661_001087 Ga0500661_001087_568_1584 324
633 3300055283 Ga0500661_005496 Ga0500661_005496_124_1143 324
634 3300061719 Ga0466962_0038583 Ga0466962_0038583_617_1636 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16884

ADH_N_2

N-terminal domain of oxidoreductase

20

128

0.98

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

175

312

0.89

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

208

350

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j3j-assembly1.cif.gz_B crystal structure of arabidopsis thaliana double bond reductase (at5g16970)-ternary complex i 0.9303 2 323
6ysb-assembly2.cif.gz_A crystal structure of malus domestica double bond reductase (mddbr) apo form 0.9247 2 323
6eow-assembly1.cif.gz_A structure of raspberry ketone synthase with hydroxybenzalacetone 0.9244 1 323
7vr4-assembly1.cif.gz_A crystal structure of (-)-pulegone reductase pr1294 from nepeta tenuifolia in complex with nadph 0.9228 2 324
6ytz-assembly1.cif.gz_A-2 crystal structure of malus domestica double bond reductase (mddbr) in complex with nadph 0.9223 2 323
ID Description Score Start End Superfamily
af_P76113_7_128_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9498 4 127 3.90.180.10
af_Q2G2D7_2_124_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9421 4 126 3.90.180.10
4b7cA01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9358 2 323 3.90.180.10
af_Q39173_2_340_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9356 2 323 3.90.180.10
af_P76113_7_128_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9349 4 127 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A5C8BLI3-F1-model_v4 deleted 0.9767 2 324
AF-A0A6N0ZHK2-F1-model_v4 NADP-dependent oxidoreductase 0.9747 159 324 GO:0016628
AF-A0A1H7ZE42-F1-model_v4 NADPH-dependent curcumin reductase CurA 0.9744 1 323 GO:0016628
GO:0016740
AF-A0A5C8BLI3-F1-model_v4 deleted 0.9707 2 324
AF-A0A1H7ZE42-F1-model_v4 NADPH-dependent curcumin reductase CurA 0.9685 1 323 GO:0016628
GO:0016740

Feature Viewer

pLDDT pTM Quality
90.17 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map