F471154
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 634 | 382 | 581 | 335 |
Family's Representative Sequence
| Representative Sequence | 3300006353|Ga0075370_10000255|Ga0075370_100002554 |
| Length | 353 |
| Sequence | MPAAVTNDNPGDSTMSHVNRQILLASRPTGEPVAENFKLVETPVAPLADGQVLVRHHFLSLDPYMRGRMSDAKSYAAPQPLNEVMIGGTAGEVVESRSPHFKAGDQVVGMGGWQEYAVVDAGQRGVLQKVDTTHVPLSAYLGAVGMPGVTGWYGLVKIIAPKAGETVVVSSAAGAVGGAVGQLAKVRGCRVVGIAGGPDKCRMVKEELGFDECIDYRQHPDLKSMGGALKAACPDGIDGYFENVGGMLLDAVMLRANAFARVAMCGMIAGYNGEPIPMTLPQLILVNRMKIEGFIVSEHMEVWPEALKELGTLVATGKLKYRESVAQGLQNAPEAFFGLLKGRNQGKQLVKLV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 4 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 5 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 6 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 7 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 8 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 9 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 10 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 11 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 12 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 13 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 14 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 15 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 16 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 17 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 18 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 19 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 20 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 21 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 22 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 23 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 24 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 25 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 26 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 27 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 28 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 29 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 30 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 31 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 32 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 33 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 34 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 35 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 36 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 37 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 38 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 39 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 40 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 41 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 42 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 43 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 44 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 45 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 46 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 47 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 48 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 49 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 50 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 51 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 52 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 53 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 54 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 55 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 56 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 57 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 58 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 59 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 60 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 61 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 62 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 63 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 64 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 65 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 66 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 67 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 68 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 69 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 70 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 71 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 72 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 73 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 74 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 75 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 76 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 77 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 78 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 79 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 80 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 81 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 82 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 83 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 84 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 85 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 86 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 87 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 88 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 89 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 92 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 95 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 97 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 98 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 100 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 112 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 113 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 114 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 117 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 118 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 119 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 120 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 121 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 122 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 123 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 124 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 125 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 126 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 127 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 128 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 129 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 130 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 131 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 132 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 133 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 134 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 135 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 136 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 137 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 139 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 140 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 150 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 159 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 164 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 172 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 176 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 232 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 236 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 239 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 241 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 242 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 243 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 244 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 245 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 246 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 247 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 248 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 249 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 250 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 251 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 252 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 253 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 254 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 255 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 256 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 257 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 258 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 259 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 261 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 269 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 270 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 271 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 272 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 273 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 274 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 275 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 276 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 277 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 278 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 279 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 280 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 281 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 282 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 283 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 284 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 285 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 286 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 287 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 288 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 289 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 290 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 291 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 292 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 293 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 294 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 295 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 296 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 297 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 298 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 299 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 327 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 328 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 331 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 332 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 333 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 334 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 335 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 336 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 337 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 338 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 342 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 348 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 349 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 350 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 351 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 352 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 353 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 354 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 355 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 357 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 358 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 359 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 364 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 365 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 366 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 367 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 368 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 369 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 371 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 372 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 373 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 375 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 376 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 377 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 378 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 379 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 380 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 381 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 382 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.91 |
| Metatranscriptomes | 1.58 |
| Isolates | 8.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 32.65 |
| Nodule | 1.42 |
| Rhizoplane | 1.42 |
| Rhizosphere | 52.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000002 | 3300002704 | Bacteria | 292156 |
| 2 | JGI25156J39149_1000003 | 3300002705 | Bacteria | 305434 |
| 3 | JGI25156J39149_1000360 | 3300002705 | Bacteria | 29472 |
| 4 | JGI25156J39149_1013969 | 3300002705 | Bacteria | 1677 |
| 5 | JGI25154J39366_1000009 | 3300002738 | Bacteria | 305408 |
| 6 | JGI25154J39366_1001294 | 3300002738 | Bacteria | 9287 |
| 7 | JGI25157J39369_1000002 | 3300002741 | Bacteria | 305434 |
| 8 | JGI25157J39369_1000039 | 3300002741 | Bacteria | 128766 |
| 9 | JGI25152J39213_1007790 | 3300002773 | Bacteria | 2734 |
| 10 | JGI25150J39212_1000299 | 3300002774 | Bacteria | 25300 |
| 11 | JGI25159J45721_1000302 | 3300002987 | Bacteria | 23151 |
| 12 | JGI25159J45721_1000502 | 3300002987 | Bacteria | 17895 |
| 13 | JGI25151J46595_10003392 | 3300003187 | Bacteria | 8814 |
| 14 | JGI25151J46595_10027581 | 3300003187 | Bacteria | 2273 |
| 15 | JGI25151J46595_10048496 | 3300003187 | Bacteria | 1467 |
| 16 | JGI25153J46596_10010784 | 3300003215 | Bacteria | 4102 |
| 17 | rootH1_10003791 | 3300003316 | Bacteria | 3730 |
| 18 | rootH2_10044844 | 3300003320 | Bacteria | 3841 |
| 19 | rootH1_10052997 | 3300003316 | Bacteria | 1238 |
| 20 | rootH1_10052997 | 3300003323 | Bacteria | 4275 |
| 21 | JGI25160J50197_1000145 | 3300003354 | Bacteria | 63479 |
| 22 | JGI25161J50226_1000032 | 3300003374 | Bacteria | 138440 |
| 23 | JGI25161J50226_1000064 | 3300003374 | Bacteria | 99448 |
| 24 | Ga0006562J51391_1053800 | 3300003578 | Bacteria | 4580 |
| 25 | Ga0006562J51391_1057153 | 3300003578 | Bacteria | 5380 |
| 26 | Ga0006562J51391_1057155 | 3300003578 | Bacteria | 3920 |
| 27 | Ga0055539_1000553 | 3300003752 | Bacteria | 10837 |
| 28 | Ga0055539_1000654 | 3300003752 | Bacteria | 9218 |
| 29 | Ga0055539_1004700 | 3300003752 | Bacteria | 1808 |
| 30 | Ga0055533_1000028 | 3300003756 | Bacteria | 311012 |
| 31 | Ga0055533_1000057 | 3300003756 | Bacteria | 194035 |
| 32 | Ga0055525_1000026 | 3300003759 | Bacteria | 345798 |
| 33 | Ga0055525_1000696 | 3300003759 | Bacteria | 12249 |
| 34 | Ga0055535_1000438 | 3300003761 | Bacteria | 38493 |
| 35 | Ga0055535_1000449 | 3300003761 | Bacteria | 37935 |
| 36 | Ga0055535_1012328 | 3300003761 | Bacteria | 1310 |
| 37 | Ga0055542_1000021 | 3300003762 | Bacteria | 331499 |
| 38 | Ga0055529_1000331 | 3300003763 | Bacteria | 53202 |
| 39 | Ga0055526_1003563 | 3300003771 | Bacteria | 9805 |
| 40 | Ga0055526_1007942 | 3300003771 | Bacteria | 5393 |
| 41 | Ga0055526_1009226 | 3300003771 | Bacteria | 4786 |
| 42 | Ga0055526_1009233 | 3300003771 | Bacteria | 4784 |
| 43 | Ga0055526_1009997 | 3300003771 | Bacteria | 4477 |
| 44 | Ga0055537_1000036 | 3300003773 | Bacteria | 96045 |
| 45 | Ga0055537_1000043 | 3300003773 | Bacteria | 90816 |
| 46 | Ga0055537_1000537 | 3300003773 | Bacteria | 21989 |
| 47 | Ga0055524_1000012 | 3300003775 | Bacteria | 260384 |
| 48 | Ga0055524_1000888 | 3300003775 | Bacteria | 19418 |
| 49 | Ga0055524_1004862 | 3300003775 | Bacteria | 6112 |
| 50 | Ga0055524_1005810 | 3300003775 | Bacteria | 5450 |
| 51 | Ga0055536_1000858 | 3300003781 | Bacteria | 19884 |
| 52 | Ga0055536_1003402 | 3300003781 | Bacteria | 8561 |
| 53 | Ga0055536_1004794 | 3300003781 | Bacteria | 6779 |
| 54 | Ga0055534_1000018 | 3300003784 | Bacteria | 138136 |
| 55 | Ga0055528_1000717 | 3300003790 | Bacteria | 23401 |
| 56 | Ga0055528_1005325 | 3300003790 | Bacteria | 6010 |
| 57 | Ga0055528_1007566 | 3300003790 | Bacteria | 4786 |
| 58 | Ga0055530_10000015 | 3300003791 | Bacteria | 148790 |
| 59 | Ga0055530_10001441 | 3300003791 | Bacteria | 17398 |
| 60 | Ga0055530_10003937 | 3300003791 | Bacteria | 8038 |
| 61 | Ga0055540_1000012 | 3300003792 | Bacteria | 262667 |
| 62 | Ga0055540_1000039 | 3300003792 | Bacteria | 161844 |
| 63 | Ga0055540_1000800 | 3300003792 | Bacteria | 21286 |
| 64 | Ga0055540_1000917 | 3300003792 | Bacteria | 19241 |
| 65 | Ga0055540_1000922 | 3300003792 | Bacteria | 19189 |
| 66 | Ga0055540_1007984 | 3300003792 | Bacteria | 3884 |
| 67 | Ga0055540_1015055 | 3300003792 | Bacteria | 2271 |
| 68 | Ga0055531_10000783 | 3300003794 | Bacteria | 26398 |
| 69 | Ga0055531_10006340 | 3300003794 | Bacteria | 6734 |
| 70 | Ga0055531_10023607 | 3300003794 | Bacteria | 2298 |
| 71 | Ga0055531_10024056 | 3300003794 | Bacteria | 2261 |
| 72 | Ga0055531_10026534 | 3300003794 | Bacteria | 2063 |
| 73 | Ga0055543_1000445 | 3300004625 | Bacteria | 25284 |
| 74 | Ga0055543_1000516 | 3300004625 | Bacteria | 22037 |
| 75 | Ga0055543_1000752 | 3300004625 | Bacteria | 16244 |
| 76 | Ga0065165_1000184 | 3300005262 | Bacteria | 109539 |
| 77 | Ga0065165_1000354 | 3300005262 | Bacteria | 75337 |
| 78 | Ga0065165_1001466 | 3300005262 | Bacteria | 25284 |
| 79 | Ga0065165_1007478 | 3300005262 | Bacteria | 5355 |
| 80 | Ga0065165_1016049 | 3300005262 | Bacteria | 2823 |
| 81 | Ga0065165_1016671 | 3300005262 | Bacteria | 2741 |
| 82 | Ga0065714_10068241 | 3300005288 | Bacteria | 4868 |
| 83 | Ga0065704_10089162 | 3300005289 | Bacteria | 2881 |
| 84 | Ga0065712_10122919 | 3300005290 | Bacteria | 1645 |
| 85 | Ga0070658_10022204 | 3300005327 | Bacteria | 5092 |
| 86 | Ga0070658_10031424 | 3300005327 | Bacteria | 4264 |
| 87 | Ga0070676_10027403 | 3300005328 | Bacteria | 3231 |
| 88 | Ga0070690_100068422 | 3300005330 | Bacteria | 2303 |
| 89 | Ga0070670_100001862 | 3300005331 | Bacteria | 17185 |
| 90 | Ga0070670_100158873 | 3300005331 | Bacteria | 1959 |
| 91 | Ga0070677_10004530 | 3300005333 | Bacteria | 4536 |
| 92 | Ga0068869_100193131 | 3300005334 | Bacteria | 1602 |
| 93 | Ga0070666_10017093 | 3300005335 | Bacteria | 4647 |
| 94 | Ga0070680_100194800 | 3300005336 | Bacteria | 1708 |
| 95 | Ga0068868_100012222 | 3300005338 | Bacteria | 6273 |
| 96 | Ga0070660_100018535 | 3300005339 | Bacteria | 5087 |
| 97 | Ga0070660_100172637 | 3300005339 | Bacteria | 1747 |
| 98 | Ga0070660_100208910 | 3300005339 | Bacteria | 1584 |
| 99 | Ga0070689_100040224 | 3300005340 | Bacteria | 3584 |
| 100 | Ga0070691_10046864 | 3300005341 | Bacteria | 2054 |
| 101 | Ga0070668_100202604 | 3300005347 | Bacteria | 1629 |
| 102 | Ga0070669_100091172 | 3300005353 | Bacteria | 2285 |
| 103 | Ga0070675_100000269 | 3300005354 | Bacteria | 34213 |
| 104 | Ga0070675_100000373 | 3300005354 | Bacteria | 30278 |
| 105 | Ga0070671_100005667 | 3300005355 | Bacteria | 9939 |
| 106 | Ga0070671_100033809 | 3300005355 | Bacteria | 4231 |
| 107 | Ga0070671_100044215 | 3300005355 | Bacteria | 3701 |
| 108 | Ga0070674_100010689 | 3300005356 | Bacteria | 5562 |
| 109 | Ga0070673_100009535 | 3300005364 | Bacteria | 6519 |
| 110 | Ga0070673_100277824 | 3300005364 | Bacteria | 1468 |
| 111 | Ga0070659_100435246 | 3300005366 | Bacteria | 1110 |
| 112 | Ga0070667_100009497 | 3300005367 | Bacteria | 8067 |
| 113 | Ga0070678_100010796 | 3300005456 | Bacteria | 5598 |
| 114 | Ga0070678_100029774 | 3300005456 | Bacteria | 3743 |
| 115 | Ga0070662_100053787 | 3300005457 | Bacteria | 2916 |
| 116 | Ga0068867_100114586 | 3300005459 | Bacteria | 2075 |
| 117 | Ga0070679_100032501 | 3300005530 | Bacteria | 5162 |
| 118 | Ga0070679_100048853 | 3300005530 | Bacteria | 4215 |
| 119 | Ga0068853_100051532 | 3300005539 | Bacteria | 3542 |
| 120 | Ga0070672_100018738 | 3300005543 | Bacteria | 5012 |
| 121 | Ga0070672_100414253 | 3300005543 | Bacteria | 1156 |
| 122 | Ga0070665_100112863 | 3300005548 | Bacteria | 2720 |
| 123 | Ga0068855_100028023 | 3300005563 | Bacteria | 6738 |
| 124 | Ga0068855_100128814 | 3300005563 | Bacteria | 2891 |
| 125 | Ga0068855_100143829 | 3300005563 | Bacteria | 2716 |
| 126 | Ga0068855_100211523 | 3300005563 | Bacteria | 2179 |
| 127 | Ga0068855_100334645 | 3300005563 | Bacteria | 1671 |
| 128 | Ga0068857_100009357 | 3300005577 | Bacteria | 8507 |
| 129 | Ga0068854_100002736 | 3300005578 | Bacteria | 10940 |
| 130 | Ga0068854_100023819 | 3300005578 | Bacteria | 4184 |
| 131 | Ga0068856_100121801 | 3300005614 | Bacteria | 2610 |
| 132 | Ga0068859_100006353 | 3300005617 | Bacteria | 11993 |
| 133 | Ga0068864_100001695 | 3300005618 | Bacteria | 18112 |
| 134 | Ga0068861_100021943 | 3300005719 | Bacteria | 4594 |
| 135 | Ga0068851_10009865 | 3300005834 | Bacteria | 4446 |
| 136 | Ga0068863_100002152 | 3300005841 | Bacteria | 19541 |
| 137 | Ga0068863_100081714 | 3300005841 | Bacteria | 3061 |
| 138 | Ga0068858_100013023 | 3300005842 | Bacteria | 7844 |
| 139 | Ga0068860_100069043 | 3300005843 | Bacteria | 3358 |
| 140 | Ga0068862_100134226 | 3300005844 | Bacteria | 2192 |
| 141 | Ga0075365_10057383 | 3300006038 | Bacteria | 2590 |
| 142 | Ga0075365_10145674 | 3300006038 | Bacteria | 1646 |
| 143 | Ga0075363_100047715 | 3300006048 | Bacteria | 2275 |
| 144 | Ga0075364_10036191 | 3300006051 | Bacteria | 3191 |
| 145 | Ga0075432_10015641 | 3300006058 | Bacteria | 2588 |
| 146 | Ga0075362_10008792 | 3300006177 | Bacteria | 3879 |
| 147 | Ga0075366_10000743 | 3300006195 | Bacteria | 15491 |
| 148 | Ga0075366_10005108 | 3300006195 | Bacteria | 7097 |
| 149 | Ga0075366_10074755 | 3300006195 | Bacteria | 2021 |
| 150 | Ga0075370_10000255 | 3300006353 | Bacteria | 19150 |
| 151 | Ga0075370_10010934 | 3300006353 | Bacteria | 4758 |
| 152 | Ga0075370_10015240 | 3300006353 | Bacteria | 4111 |
| 153 | Ga0075370_10030148 | 3300006353 | Bacteria | 3025 |
| 154 | Ga0075429_100001889 | 3300006880 | Bacteria | 17349 |
| 155 | Ga0068865_100211970 | 3300006881 | Bacteria | 1510 |
| 156 | Ga0097620_100006353 | 3300006931 | Bacteria | 11993 |
| 157 | Ga0079104_1000011 | 3300006946 | Bacteria | 359962 |
| 158 | Ga0099826_10003934 | 3300006948 | Bacteria | 10271 |
| 159 | Ga0099826_10155344 | 3300006948 | Bacteria | 1304 |
| 160 | Ga0105244_10004770 | 3300009036 | Bacteria | 9224 |
| 161 | Ga0105250_10009489 | 3300009092 | Bacteria | 4095 |
| 162 | Ga0105240_10001089 | 3300009093 | Bacteria | 47935 |
| 163 | Ga0105240_10044801 | 3300009093 | Bacteria | 5617 |
| 164 | Ga0111539_10002121 | 3300009094 | Bacteria | 26502 |
| 165 | Ga0114129_10023730 | 3300009147 | Bacteria | 8694 |
| 166 | Ga0105243_10000246 | 3300009148 | Bacteria | 62205 |
| 167 | Ga0105243_10001827 | 3300009148 | Bacteria | 18207 |
| 168 | Ga0105243_10002130 | 3300009148 | Bacteria | 16732 |
| 169 | Ga0105243_10227182 | 3300009148 | Bacteria | 1654 |
| 170 | Ga0105248_10136036 | 3300009177 | Bacteria | 2772 |
| 171 | Ga0105237_10353161 | 3300009545 | Bacteria | 1475 |
| 172 | Ga0105249_10179357 | 3300009553 | Bacteria | 2059 |
| 173 | Ga0157319_1000009 | 3300012497 | Bacteria | 227971 |
| 174 | Ga0157370_10086305 | 3300013104 | Bacteria | 2948 |
| 175 | Ga0157369_10005851 | 3300013105 | Bacteria | 14286 |
| 176 | Ga0157369_10009093 | 3300013105 | Bacteria | 11370 |
| 177 | Ga0157374_10011952 | 3300013296 | Bacteria | 7537 |
| 178 | Ga0157378_10284231 | 3300013297 | Bacteria | 1596 |
| 179 | Ga0163162_10162615 | 3300013306 | Bacteria | 2355 |
| 180 | Ga0157375_10330902 | 3300013308 | Bacteria | 1688 |
| 181 | Ga0163163_10000864 | 3300014325 | Bacteria | 25838 |
| 182 | Ga0157380_10298890 | 3300014326 | Bacteria | 1482 |
| 183 | Ga0157380_10415154 | 3300014326 | Bacteria | 1282 |
| 184 | Ga0182008_10001753 | 3300014497 | Bacteria | 14233 |
| 185 | Ga0182008_10020103 | 3300014497 | Bacteria | 3441 |
| 186 | Ga0157379_10023287 | 3300014968 | Bacteria | 5494 |
| 187 | Ga0182006_1001664 | 3300015261 | Bacteria | 13088 |
| 188 | Ga0182006_1023000 | 3300015261 | Bacteria | 2584 |
| 189 | Ga0182007_10000524 | 3300015262 | Bacteria | 22633 |
| 190 | Ga0163161_10000139 | 3300017792 | Bacteria | 67878 |
| 191 | Ga0163161_10010958 | 3300017792 | Bacteria | 6281 |
| 192 | Ga0163161_10328816 | 3300017792 | Bacteria | 1210 |
| 193 | Ga0213872_10000099 | 3300021361 | Bacteria | 80083 |
| 194 | Ga0213872_10013435 | 3300021361 | Bacteria | 3836 |
| 195 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 196 | Ga0209674_100007 | 3300025226 | Bacteria | 1077082 |
| 197 | Ga0209147_101671 | 3300025229 | Bacteria | 7290 |
| 198 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 199 | Ga0209563_100033 | 3300025230 | Bacteria | 457883 |
| 200 | Ga0207427_101424 | 3300025231 | Bacteria | 8703 |
| 201 | Ga0209258_100058 | 3300025242 | Bacteria | 331567 |
| 202 | Ga0209258_100353 | 3300025242 | Bacteria | 63996 |
| 203 | Ga0209258_100475 | 3300025242 | Bacteria | 42279 |
| 204 | Ga0207425_1000157 | 3300025245 | Bacteria | 57625 |
| 205 | Ga0207425_1001936 | 3300025245 | Bacteria | 7797 |
| 206 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 207 | Ga0209646_1000053 | 3300025246 | Bacteria | 284737 |
| 208 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 209 | Ga0209026_1000020 | 3300025250 | Bacteria | 376211 |
| 210 | Ga0209677_100132 | 3300025253 | Bacteria | 72060 |
| 211 | Ga0209677_100161 | 3300025253 | Bacteria | 59768 |
| 212 | Ga0209677_100999 | 3300025253 | Bacteria | 13659 |
| 213 | Ga0209148_1000071 | 3300025254 | Bacteria | 331551 |
| 214 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 215 | Ga0209759_1000017 | 3300025256 | Bacteria | 376232 |
| 216 | Ga0209759_1002547 | 3300025256 | Bacteria | 7921 |
| 217 | Ga0209759_1004959 | 3300025256 | Bacteria | 4812 |
| 218 | Ga0209759_1010156 | 3300025256 | Bacteria | 2779 |
| 219 | Ga0209759_1019775 | 3300025256 | Bacteria | 1585 |
| 220 | Ga0209129_1000494 | 3300025258 | Bacteria | 28711 |
| 221 | Ga0209129_1007584 | 3300025258 | Bacteria | 3195 |
| 222 | Ga0209129_1008644 | 3300025258 | Bacteria | 2802 |
| 223 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 224 | Ga0209565_1000038 | 3300025263 | Bacteria | 286433 |
| 225 | Ga0209565_1000066 | 3300025263 | Bacteria | 173062 |
| 226 | Ga0209565_1000075 | 3300025263 | Bacteria | 162259 |
| 227 | Ga0209565_1001286 | 3300025263 | Bacteria | 11626 |
| 228 | Ga0209565_1004849 | 3300025263 | Bacteria | 4017 |
| 229 | Ga0209455_1000136 | 3300025272 | Bacteria | 146375 |
| 230 | Ga0209673_1000066 | 3300025273 | Bacteria | 250037 |
| 231 | Ga0209673_1000289 | 3300025273 | Bacteria | 93941 |
| 232 | Ga0209673_1000357 | 3300025273 | Bacteria | 82249 |
| 233 | Ga0209673_1000362 | 3300025273 | Bacteria | 81651 |
| 234 | Ga0209673_1009554 | 3300025273 | Bacteria | 4180 |
| 235 | Ga0209673_1014452 | 3300025273 | Bacteria | 3053 |
| 236 | Ga0209673_1036032 | 3300025273 | Bacteria | 1473 |
| 237 | Ga0209130_1000082 | 3300025284 | Bacteria | 164441 |
| 238 | Ga0209130_1000094 | 3300025284 | Bacteria | 145569 |
| 239 | Ga0209130_1000131 | 3300025284 | Bacteria | 119977 |
| 240 | Ga0209130_1000929 | 3300025284 | Bacteria | 23451 |
| 241 | Ga0209675_1000061 | 3300025291 | Bacteria | 181096 |
| 242 | Ga0209675_1000074 | 3300025291 | Bacteria | 162260 |
| 243 | Ga0209675_1000177 | 3300025291 | Bacteria | 73574 |
| 244 | Ga0209675_1000930 | 3300025291 | Bacteria | 18669 |
| 245 | Ga0209675_1004048 | 3300025291 | Bacteria | 6674 |
| 246 | Ga0209675_1006569 | 3300025291 | Bacteria | 4633 |
| 247 | Ga0209675_1008579 | 3300025291 | Bacteria | 3734 |
| 248 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 249 | Ga0209676_1000029 | 3300025292 | Bacteria | 520536 |
| 250 | Ga0209676_1000142 | 3300025292 | Bacteria | 175752 |
| 251 | Ga0209676_1000186 | 3300025292 | Bacteria | 142440 |
| 252 | Ga0209676_1001149 | 3300025292 | Bacteria | 28950 |
| 253 | Ga0209676_1003547 | 3300025292 | Bacteria | 9476 |
| 254 | Ga0209676_1003883 | 3300025292 | Bacteria | 8718 |
| 255 | Ga0209025_1000056 | 3300025294 | Bacteria | 316188 |
| 256 | Ga0209025_1000088 | 3300025294 | Bacteria | 255087 |
| 257 | Ga0209025_1001607 | 3300025294 | Bacteria | 28356 |
| 258 | Ga0209025_1004754 | 3300025294 | Bacteria | 11531 |
| 259 | Ga0209025_1007422 | 3300025294 | Bacteria | 8182 |
| 260 | Ga0209025_1012270 | 3300025294 | Bacteria | 5519 |
| 261 | Ga0209025_1042395 | 3300025294 | Bacteria | 1934 |
| 262 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 263 | Ga0209564_1000090 | 3300025295 | Bacteria | 249298 |
| 264 | Ga0209564_1000539 | 3300025295 | Bacteria | 61208 |
| 265 | Ga0209564_1000542 | 3300025295 | Bacteria | 60997 |
| 266 | Ga0209564_1000969 | 3300025295 | Bacteria | 36292 |
| 267 | Ga0209564_1002810 | 3300025295 | Bacteria | 12935 |
| 268 | Ga0209758_1000044 | 3300025297 | Bacteria | 398448 |
| 269 | Ga0209758_1002642 | 3300025297 | Bacteria | 17764 |
| 270 | Ga0209758_1003972 | 3300025297 | Bacteria | 12820 |
| 271 | Ga0209758_1015243 | 3300025297 | Bacteria | 4001 |
| 272 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 273 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 274 | Ga0209050_1001266 | 3300025298 | Bacteria | 29109 |
| 275 | Ga0209050_1001371 | 3300025298 | Bacteria | 26591 |
| 276 | Ga0209050_1005923 | 3300025298 | Bacteria | 7452 |
| 277 | Ga0209050_1015438 | 3300025298 | Bacteria | 3208 |
| 278 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 279 | Ga0209256_1000020 | 3300025299 | Bacteria | 542402 |
| 280 | Ga0209256_1000022 | 3300025299 | Bacteria | 481843 |
| 281 | Ga0209256_1000600 | 3300025299 | Bacteria | 50120 |
| 282 | Ga0209256_1001560 | 3300025299 | Bacteria | 22629 |
| 283 | Ga0209256_1001777 | 3300025299 | Bacteria | 20459 |
| 284 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 285 | Ga0207426_1000025 | 3300025302 | Bacteria | 532921 |
| 286 | Ga0207426_1000031 | 3300025302 | Bacteria | 460699 |
| 287 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 288 | Ga0209051_1000036 | 3300025303 | Bacteria | 339863 |
| 289 | Ga0209051_1000213 | 3300025303 | Bacteria | 98755 |
| 290 | Ga0209051_1000243 | 3300025303 | Bacteria | 91605 |
| 291 | Ga0209051_1000455 | 3300025303 | Bacteria | 54195 |
| 292 | Ga0209051_1000987 | 3300025303 | Bacteria | 27532 |
| 293 | Ga0209051_1018683 | 3300025303 | Bacteria | 3058 |
| 294 | Ga0209051_1021258 | 3300025303 | Bacteria | 2768 |
| 295 | Ga0209051_1022261 | 3300025303 | Bacteria | 2671 |
| 296 | Ga0209051_1058649 | 3300025303 | Bacteria | 1225 |
| 297 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 298 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 299 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 300 | Ga0209257_1000226 | 3300025304 | Bacteria | 133836 |
| 301 | Ga0209257_1000980 | 3300025304 | Bacteria | 38745 |
| 302 | Ga0209257_1002939 | 3300025304 | Bacteria | 15675 |
| 303 | Ga0209257_1009850 | 3300025304 | Bacteria | 4994 |
| 304 | Ga0209257_1014547 | 3300025304 | Bacteria | 3372 |
| 305 | Ga0207697_10027391 | 3300025315 | Bacteria | 2330 |
| 306 | Ga0207656_10030898 | 3300025321 | Bacteria | 2215 |
| 307 | Ga0207682_10000456 | 3300025893 | Bacteria | 18858 |
| 308 | Ga0207680_10005735 | 3300025903 | Bacteria | 5951 |
| 309 | Ga0207647_10213424 | 3300025904 | Bacteria | 1114 |
| 310 | Ga0207645_10010065 | 3300025907 | Bacteria | 6511 |
| 311 | Ga0207705_10153859 | 3300025909 | Bacteria | 1724 |
| 312 | Ga0207695_10033270 | 3300025913 | Bacteria | 5626 |
| 313 | Ga0207695_10049144 | 3300025913 | Bacteria | 4449 |
| 314 | Ga0207671_10237480 | 3300025914 | Bacteria | 1431 |
| 315 | Ga0207660_10203173 | 3300025917 | Bacteria | 1548 |
| 316 | Ga0207657_10054433 | 3300025919 | Bacteria | 3460 |
| 317 | Ga0207657_10128056 | 3300025919 | Bacteria | 2083 |
| 318 | Ga0207657_10191632 | 3300025919 | Bacteria | 1649 |
| 319 | Ga0207652_10073160 | 3300025921 | Bacteria | 2981 |
| 320 | Ga0207681_10021166 | 3300025923 | Bacteria | 4130 |
| 321 | Ga0207694_10008847 | 3300025924 | Bacteria | 7594 |
| 322 | Ga0207650_10003907 | 3300025925 | Bacteria | 10190 |
| 323 | Ga0207659_10000135 | 3300025926 | Bacteria | 43365 |
| 324 | Ga0207659_10000412 | 3300025926 | Bacteria | 25823 |
| 325 | Ga0207706_10004063 | 3300025933 | Bacteria | 13832 |
| 326 | Ga0207706_10315156 | 3300025933 | Bacteria | 1362 |
| 327 | Ga0207686_10009207 | 3300025934 | Bacteria | 5356 |
| 328 | Ga0207709_10000074 | 3300025935 | Bacteria | 174947 |
| 329 | Ga0207709_10000147 | 3300025935 | Bacteria | 97401 |
| 330 | Ga0207709_10002508 | 3300025935 | Bacteria | 11471 |
| 331 | Ga0207670_10094212 | 3300025936 | Bacteria | 2124 |
| 332 | Ga0207669_10017445 | 3300025937 | Bacteria | 3682 |
| 333 | Ga0207691_10002618 | 3300025940 | Bacteria | 17576 |
| 334 | Ga0207691_10044008 | 3300025940 | Bacteria | 4111 |
| 335 | Ga0207691_10222263 | 3300025940 | Bacteria | 1637 |
| 336 | Ga0207711_10399669 | 3300025941 | Bacteria | 1277 |
| 337 | Ga0207689_10061799 | 3300025942 | Bacteria | 3080 |
| 338 | Ga0207679_10025752 | 3300025945 | Bacteria | 4049 |
| 339 | Ga0207679_10055673 | 3300025945 | Bacteria | 2917 |
| 340 | Ga0207679_10272712 | 3300025945 | Bacteria | 1447 |
| 341 | Ga0207667_10059702 | 3300025949 | Bacteria | 3993 |
| 342 | Ga0207667_10072624 | 3300025949 | Bacteria | 3576 |
| 343 | Ga0207651_10001078 | 3300025960 | Bacteria | 12121 |
| 344 | Ga0207651_10011381 | 3300025960 | Bacteria | 4980 |
| 345 | Ga0207651_10018452 | 3300025960 | Bacteria | 4152 |
| 346 | Ga0207651_10391894 | 3300025960 | Bacteria | 1180 |
| 347 | Ga0207640_10007869 | 3300025981 | Bacteria | 5882 |
| 348 | Ga0207658_10010935 | 3300025986 | Bacteria | 6178 |
| 349 | Ga0207658_10046839 | 3300025986 | Bacteria | 3160 |
| 350 | Ga0207677_10164847 | 3300026023 | Bacteria | 1726 |
| 351 | Ga0207677_10248196 | 3300026023 | Bacteria | 1444 |
| 352 | Ga0207703_10001097 | 3300026035 | Bacteria | 25719 |
| 353 | Ga0207639_10070432 | 3300026041 | Bacteria | 2731 |
| 354 | Ga0207702_10001077 | 3300026078 | Bacteria | 27952 |
| 355 | Ga0207641_10004871 | 3300026088 | Bacteria | 11549 |
| 356 | Ga0207641_10029888 | 3300026088 | Bacteria | 4508 |
| 357 | Ga0207648_10028147 | 3300026089 | Bacteria | 4984 |
| 358 | Ga0207676_10001370 | 3300026095 | Bacteria | 18134 |
| 359 | Ga0207676_10028402 | 3300026095 | Bacteria | 4178 |
| 360 | Ga0207674_10009929 | 3300026116 | Bacteria | 10829 |
| 361 | Ga0207675_100063752 | 3300026118 | Bacteria | 3444 |
| 362 | Ga0207683_10005554 | 3300026121 | Bacteria | 10802 |
| 363 | Ga0207683_10008385 | 3300026121 | Bacteria | 8840 |
| 364 | Ga0207698_10030616 | 3300026142 | Bacteria | 3873 |
| 365 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 366 | Ga0209970_1002284 | 3300027614 | Bacteria | 3270 |
| 367 | Ga0209282_1001367 | 3300027666 | Bacteria | 13338 |
| 368 | Ga0209971_1008632 | 3300027682 | Bacteria | 2419 |
| 369 | Ga0207428_10000486 | 3300027907 | Bacteria | 47460 |
| 370 | Ga0207428_10020006 | 3300027907 | Bacteria | 5701 |
| 371 | Ga0268264_10031665 | 3300028381 | Bacteria | 4336 |
| 372 | Ga0265336_10000012 | 3300028666 | Bacteria | 261478 |
| 373 | Ga0307515_10205530 | 3300028794 | Bacteria | 1831 |
| 374 | Ga0265324_10001796 | 3300029957 | Bacteria | 11686 |
| 375 | Ga0265324_10008792 | 3300029957 | Bacteria | 3982 |
| 376 | Ga0307511_10061197 | 3300030521 | Bacteria | 2872 |
| 377 | Ga0316180_1157121 | 3300030736 | Bacteria | 2469 |
| 378 | Ga0316183_1116801 | 3300030742 | Bacteria | 6204 |
| 379 | Ga0316182_1399623 | 3300030745 | Bacteria | 1740 |
| 380 | Ga0265328_10014254 | 3300031239 | Bacteria | 3132 |
| 381 | Ga0265331_10001642 | 3300031250 | Bacteria | 16262 |
| 382 | Ga0265327_10000012 | 3300031251 | Bacteria | 530403 |
| 383 | Ga0265327_10001589 | 3300031251 | Bacteria | 27701 |
| 384 | Ga0307513_10000019 | 3300031456 | Bacteria | 231194 |
| 385 | Ga0307513_10000051 | 3300031456 | Bacteria | 149733 |
| 386 | Ga0307513_10146513 | 3300031456 | Bacteria | 2278 |
| 387 | Ga0307513_10357525 | 3300031456 | Bacteria | 1206 |
| 388 | Ga0307509_10325640 | 3300031507 | Bacteria | 1271 |
| 389 | Ga0307408_100000010 | 3300031548 | Bacteria | 420048 |
| 390 | Ga0307408_100005073 | 3300031548 | Bacteria | 8837 |
| 391 | Ga0307408_100082546 | 3300031548 | Bacteria | 2406 |
| 392 | Ga0307514_10001730 | 3300031649 | Bacteria | 25002 |
| 393 | Ga0307514_10063221 | 3300031649 | Bacteria | 2811 |
| 394 | Ga0307516_10000268 | 3300031730 | Bacteria | 66758 |
| 395 | Ga0307516_10000910 | 3300031730 | Bacteria | 40607 |
| 396 | Ga0307516_10009769 | 3300031730 | Bacteria | 10643 |
| 397 | Ga0307516_10207558 | 3300031730 | Bacteria | 1675 |
| 398 | Ga0307405_10038176 | 3300031731 | Bacteria | 2892 |
| 399 | Ga0307413_10012999 | 3300031824 | Bacteria | 4165 |
| 400 | Ga0307406_10005046 | 3300031901 | Bacteria | 7196 |
| 401 | Ga0307406_10006192 | 3300031901 | Bacteria | 6586 |
| 402 | Ga0307406_10072159 | 3300031901 | Bacteria | 2265 |
| 403 | Ga0307407_10083218 | 3300031903 | Bacteria | 1941 |
| 404 | Ga0307412_10003417 | 3300031911 | Bacteria | 8821 |
| 405 | Ga0307412_10059241 | 3300031911 | Bacteria | 2565 |
| 406 | Ga0307416_100083501 | 3300032002 | Bacteria | 2710 |
| 407 | Ga0307416_100130931 | 3300032002 | Bacteria | 2258 |
| 408 | Ga0307411_10003262 | 3300032005 | Bacteria | 7486 |
| 409 | Ga0307411_10009327 | 3300032005 | Bacteria | 5153 |
| 410 | Ga0373934_0014201 | 3300035086 | Bacteria | 3017 |
| 411 | Ga0373939_0000118 | 3300035114 | Bacteria | 23751 |
| 412 | Ga0373960_0002289 | 3300035121 | Bacteria | 4310 |
| 413 | Ga0373961_0023755 | 3300035241 | Bacteria | 1652 |
| 414 | Ga0373962_0008010 | 3300035242 | Bacteria | 2595 |
| 415 | Ga0373931_0000873 | 3300035691 | Bacteria | 12732 |
| 416 | Ga0373931_0010219 | 3300035691 | Bacteria | 4508 |
| 417 | Ga0395899_0001240 | 3300037312 | Bacteria | 22229 |
| 418 | Ga0395899_0002622 | 3300037312 | Bacteria | 14501 |
| 419 | Ga0395899_0029980 | 3300037312 | Bacteria | 4094 |
| 420 | Ga0395900_0000535 | 3300037418 | Bacteria | 53622 |
| 421 | Ga0395900_0036004 | 3300037418 | Bacteria | 5100 |
| 422 | Ga0395900_0344366 | 3300037418 | Bacteria | 1465 |
| 423 | Ga0395898_0000485 | 3300037466 | Bacteria | 78871 |
| 424 | Ga0395898_0120811 | 3300037466 | Bacteria | 2510 |
| 425 | Ga0395898_0285188 | 3300037466 | Bacteria | 1575 |
| 426 | Ga0395905_0007305 | 3300037471 | Bacteria | 11010 |
| 427 | Ga0395905_0018032 | 3300037471 | Bacteria | 6702 |
| 428 | Ga0395905_0027898 | 3300037471 | Bacteria | 5323 |
| 429 | Ga0395905_0046926 | 3300037471 | Bacteria | 4049 |
| 430 | Ga0395905_0214114 | 3300037471 | Bacteria | 1804 |
| 431 | Ga0395901_0037371 | 3300038443 | Bacteria | 5022 |
| 432 | Ga0395901_0086684 | 3300038443 | Bacteria | 3274 |
| 433 | Ga0395901_0139747 | 3300038443 | Bacteria | 2545 |
| 434 | Ga0395901_0408365 | 3300038443 | Bacteria | 1394 |
| 435 | Ga0436361_0166276 | 3300039447 | Bacteria | 3363 |
| 436 | Ga0436361_0720979 | 3300039447 | Bacteria | 74253 |
| 437 | Ga0436361_0848510 | 3300039447 | Bacteria | 27411 |
| 438 | Ga0439436_0012948 | 3300041404 | Bacteria | 2528 |
| 439 | Ga0439437_002470 | 3300042000 | Bacteria | 1976 |
| 440 | Ga0439449_0001507 | 3300042007 | Bacteria | 9126 |
| 441 | Ga0450923_000170 | 3300042125 | Bacteria | 6022 |
| 442 | Ga0450890_000362 | 3300042127 | Bacteria | 6648 |
| 443 | Ga0450890_002768 | 3300042127 | Bacteria | 2379 |
| 444 | Ga0450891_004720 | 3300042129 | Bacteria | 1269 |
| 445 | Ga0450892_001375 | 3300042130 | Bacteria | 2411 |
| 446 | Ga0450903_015923 | 3300042138 | Bacteria | 1182 |
| 447 | Ga0450904_007673 | 3300042139 | Bacteria | 1070 |
| 448 | Ga0450906_001542 | 3300042145 | Bacteria | 5032 |
| 449 | Ga0439459_0001763 | 3300042438 | Bacteria | 3239 |
| 450 | Ga0450893_0000221 | 3300042532 | Bacteria | 7597 |
| 451 | Ga0451577_0000114 | 3300042876 | Bacteria | 175957 |
| 452 | Ga0466969_0000002 | 3300044656 | Bacteria | 178693 |
| 453 | Ga0466969_0006006 | 3300044656 | Bacteria | 6464 |
| 454 | Ga0466969_0006376 | 3300044656 | Bacteria | 6277 |
| 455 | Ga0466969_0016312 | 3300044656 | Bacteria | 3890 |
| 456 | Ga0466972_0001454 | 3300044658 | Bacteria | 11509 |
| 457 | Ga0466965_0076285 | 3300044683 | Bacteria | 1691 |
| 458 | Ga0466965_0079510 | 3300044683 | Bacteria | 1656 |
| 459 | Ga0466966_0023879 | 3300044684 | Bacteria | 4001 |
| 460 | Ga0466966_0036473 | 3300044684 | Bacteria | 3174 |
| 461 | Ga0466966_0037188 | 3300044684 | Bacteria | 3140 |
| 462 | Ga0466961_0026070 | 3300044693 | Bacteria | 3758 |
| 463 | Ga0466961_0052112 | 3300044693 | Bacteria | 2611 |
| 464 | Ga0466961_0066092 | 3300044693 | Bacteria | 2297 |
| 465 | Ga0466963_0035083 | 3300044694 | Bacteria | 3266 |
| 466 | Ga0466963_0067834 | 3300044694 | Bacteria | 2395 |
| 467 | Ga0466964_0017097 | 3300044706 | Bacteria | 2774 |
| 468 | Ga0466964_0038470 | 3300044706 | Bacteria | 1923 |
| 469 | Ga0453684_0000606 | 3300044712 | Bacteria | 132056 |
| 470 | Ga0453684_0049647 | 3300044712 | Bacteria | 5529 |
| 471 | Ga0466971_0036776 | 3300044719 | Bacteria | 2195 |
| 472 | Ga0466970_0024329 | 3300044765 | Bacteria | 3165 |
| 473 | Ga0466970_0040206 | 3300044765 | Bacteria | 2483 |
| 474 | Ga0466970_0093791 | 3300044765 | Bacteria | 1631 |
| 475 | Ga0466957_0025407 | 3300044842 | Bacteria | 3510 |
| 476 | Ga0466957_0058309 | 3300044842 | Bacteria | 2365 |
| 477 | Ga0466959_0008985 | 3300045049 | Bacteria | 7086 |
| 478 | Ga0466959_0014711 | 3300045049 | Bacteria | 5695 |
| 479 | Ga0466959_0040490 | 3300045049 | Bacteria | 3442 |
| 480 | Ga0451576_0019867 | 3300045051 | Bacteria | 7325 |
| 481 | Ga0451576_0086654 | 3300045051 | Bacteria | 3257 |
| 482 | Ga0451576_0087179 | 3300045051 | Bacteria | 3247 |
| 483 | Ga0466958_0052840 | 3300045836 | Bacteria | 2463 |
| 484 | Ga0466958_0056548 | 3300045836 | Bacteria | 2383 |
| 485 | Ga0466967_0008599 | 3300045976 | Bacteria | 7502 |
| 486 | Ga0466967_0045641 | 3300045976 | Bacteria | 3808 |
| 487 | Ga0495627_009890 | 3300046453 | Bacteria | 3492 |
| 488 | Ga0495650_0033678 | 3300046471 | Bacteria | 2277 |
| 489 | Ga0495580_0208169 | 3300046472 | Bacteria | 1346 |
| 490 | Ga0495583_0001567 | 3300046506 | Bacteria | 22599 |
| 491 | Ga0495606_0000606 | 3300046507 | Bacteria | 56734 |
| 492 | Ga0495610_0018664 | 3300046512 | Bacteria | 3908 |
| 493 | Ga0495616_0006275 | 3300046513 | Bacteria | 7218 |
| 494 | Ga0495620_0057388 | 3300046515 | Bacteria | 1634 |
| 495 | Ga0495631_0000441 | 3300046518 | Bacteria | 28421 |
| 496 | Ga0495637_0001468 | 3300046520 | Bacteria | 13872 |
| 497 | Ga0495663_0052415 | 3300046525 | Bacteria | 1266 |
| 498 | Ga0495642_0010858 | 3300046528 | Bacteria | 3491 |
| 499 | Ga0495654_0008489 | 3300046530 | Bacteria | 5669 |
| 500 | Ga0495598_0004858 | 3300046537 | Bacteria | 2940 |
| 501 | Ga0495621_0021938 | 3300046539 | Bacteria | 2111 |
| 502 | Ga0495597_0000065 | 3300046542 | Bacteria | 90745 |
| 503 | Ga0495656_0008104 | 3300046615 | Bacteria | 3740 |
| 504 | Ga0495668_0008144 | 3300046616 | Bacteria | 6589 |
| 505 | Ga0495625_0000044 | 3300046660 | Bacteria | 203855 |
| 506 | Ga0495625_0084918 | 3300046660 | Bacteria | 2198 |
| 507 | Ga0495669_0013029 | 3300046684 | Bacteria | 3543 |
| 508 | Ga0495671_0001710 | 3300046692 | Bacteria | 14296 |
| 509 | Ga0495649_0001268 | 3300046694 | Bacteria | 19452 |
| 510 | Ga0495636_0033130 | 3300047318 | Bacteria | 2121 |
| 511 | Ga0495676_0069842 | 3300047321 | Bacteria | 2708 |
| 512 | Ga0495686_0041824 | 3300047472 | Bacteria | 2916 |
| 513 | Ga0495614_0011922 | 3300048089 | Bacteria | 3821 |
| 514 | Ga0496101_0023990 | 3300048904 | Bacteria | 4219 |
| 515 | Ga0496102_0182439 | 3300048905 | Bacteria | 1978 |
| 516 | Ga0496104_0086093 | 3300048907 | Bacteria | 3000 |
| 517 | Ga0496108_0066411 | 3300048911 | Bacteria | 3041 |
| 518 | Ga0496109_0224898 | 3300048912 | Bacteria | 1765 |
| 519 | Ga0496112_0065778 | 3300048915 | Bacteria | 3577 |
| 520 | Ga0496116_0074194 | 3300048919 | Bacteria | 2141 |
| 521 | Ga0496117_0035489 | 3300048920 | Bacteria | 3741 |
| 522 | Ga0496117_0074983 | 3300048920 | Bacteria | 2249 |
| 523 | Ga0496118_0009730 | 3300048921 | Bacteria | 9648 |
| 524 | Ga0496122_0019248 | 3300048925 | Bacteria | 6247 |
| 525 | Ga0496123_0028920 | 3300048926 | Bacteria | 4092 |
| 526 | Ga0496125_0024712 | 3300048928 | Bacteria | 5517 |
| 527 | Ga0496125_0060343 | 3300048928 | Bacteria | 3049 |
| 528 | Ga0496126_0197794 | 3300048929 | Bacteria | 1699 |
| 529 | Ga0501310_001584 | 3300049130 | Bacteria | 2077 |
| 530 | Ga0501305_004765 | 3300049161 | Bacteria | 1611 |
| 531 | Ga0501307_003263 | 3300049162 | Bacteria | 1579 |
| 532 | Ga0501300_001969 | 3300049523 | Bacteria | 3076 |
| 533 | Ga0501311_002504 | 3300049527 | Bacteria | 1768 |
| 534 | Ga0501312_012436 | 3300049528 | Bacteria | 1171 |
| 535 | Ga0501314_001588 | 3300049530 | Bacteria | 1663 |
| 536 | Ga0501315_001393 | 3300049531 | Bacteria | 2058 |
| 537 | Ga0501031_0009899 | 3300049568 | Bacteria | 6208 |
| 538 | Ga0501201_001519 | 3300049651 | Bacteria | 2164 |
| 539 | Ga0501211_000538 | 3300049658 | Bacteria | 3722 |
| 540 | Ga0501235_017532 | 3300049669 | Bacteria | 1584 |
| 541 | Ga0501249_012730 | 3300049679 | Bacteria | 1780 |
| 542 | Ga0501225_0003751 | 3300049705 | Bacteria | 4571 |
| 543 | Ga0501229_004139 | 3300049706 | Bacteria | 1757 |
| 544 | Ga0501262_000052 | 3300049759 | Bacteria | 14942 |
| 545 | Ga0501262_004354 | 3300049759 | Bacteria | 1642 |
| 546 | Ga0501265_002343 | 3300049762 | Bacteria | 2149 |
| 547 | Ga0501265_006136 | 3300049762 | Bacteria | 1397 |
| 548 | nmdc:mga00v17_49238_c1 | 3300050491 | Bacteria | 2556 |
| 549 | nmdc:mga0yw44_4196_c1 | 3300050492 | Bacteria | 6558 |
| 550 | nmdc:mga0k408_97917_c1 | 3300050493 | Bacteria | 1728 |
| 551 | nmdc:mga06z11_156924_c1 | 3300050494 | Bacteria | 1298 |
| 552 | nmdc:mga07m45_198529_c1 | 3300050496 | Bacteria | 1167 |
| 553 | nmdc:mga07m45_238_c1 | 3300050496 | Bacteria | 22186 |
| 554 | nmdc:mga07m45_92600_c2 | 3300050496 | Bacteria | 1287 |
| 555 | nmdc:mga05p37_29220_c1 | 3300050507 | Bacteria | 6728 |
| 556 | nmdc:mga09592_4640_c1 | 3300050508 | Bacteria | 11128 |
| 557 | nmdc:mga08y16_3722_c1 | 3300050511 | Bacteria | 15880 |
| 558 | nmdc:mga08y16_97039_c1 | 3300050511 | Bacteria | 3069 |
| 559 | Ga0500610_0001062 | 3300053079 | Bacteria | 9024 |
| 560 | Ga0500610_0001287 | 3300053079 | Bacteria | 8420 |
| 561 | Ga0500635_0000233 | 3300053080 | Bacteria | 24594 |
| 562 | Ga0500643_015386 | 3300053087 | Bacteria | 2626 |
| 563 | Ga0500644_0016039 | 3300053088 | Bacteria | 2150 |
| 564 | Ga0500651_0000053 | 3300053093 | Bacteria | 76219 |
| 565 | Ga0500641_0149879 | 3300053096 | Bacteria | 1007 |
| 566 | Ga0500571_000136 | 3300053110 | Bacteria | 24931 |
| 567 | Ga0500593_000482 | 3300053117 | Bacteria | 15716 |
| 568 | Ga0500593_016489 | 3300053117 | Bacteria | 3202 |
| 569 | Ga0500594_0011564 | 3300053118 | Bacteria | 2062 |
| 570 | Ga0500608_086963 | 3300053122 | Bacteria | 1467 |
| 571 | Ga0500658_0000385 | 3300053134 | Bacteria | 19451 |
| 572 | Ga0500559_0014489 | 3300053136 | Bacteria | 3332 |
| 573 | Ga0500568_0002715 | 3300053139 | Bacteria | 10257 |
| 574 | Ga0500574_043332 | 3300053141 | Bacteria | 1263 |
| 575 | Ga0500622_0024292 | 3300053156 | Bacteria | 3204 |
| 576 | Ga0500638_056152 | 3300053162 | Bacteria | 1897 |
| 577 | Ga0500645_001435 | 3300053730 | Bacteria | 12097 |
| 578 | Ga0500645_002264 | 3300053730 | Bacteria | 8744 |
| 579 | Ga0500661_001087 | 3300055283 | Bacteria | 5115 |
| 580 | Ga0500661_005496 | 3300055283 | Bacteria | 2366 |
| 581 | Ga0466962_0038583 | 3300061719 | Bacteria | 2287 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053096 | Ga0500641_0149879 | Ga0500641_0149879_15_824 | 255 |
| 2 | 3300049762 | Ga0501265_006136 | Ga0501265_006136_522_1376 | 270 |
| 3 | 3300044683 | Ga0466965_0076285 | Ga0466965_0076285_11_868 | 271 |
| 4 | 3300044694 | Ga0466963_0067834 | Ga0466963_0067834_1497_2366 | 275 |
| 5 | 3300046472 | Ga0495580_0208169 | Ga0495580_0208169_11_880 | 275 |
| 6 | 3300025940 | Ga0207691_10222263 | Ga0207691_102222631 | 287 |
| 7 | 3300049759 | Ga0501262_004354 | Ga0501262_004354_677_1600 | 293 |
| 8 | 3300031251 | Ga0265327_10001589 | Ga0265327_1000158922 | 299 |
| 9 | 3300005290 | Ga0065712_10122919 | Ga0065712_101229191 | 301 |
| 10 | 3300005331 | Ga0070670_100001862 | Ga0070670_10000186210 | 301 |
| 11 | 3300005333 | Ga0070677_10004530 | Ga0070677_100045305 | 301 |
| 12 | 3300005354 | Ga0070675_100000373 | Ga0070675_10000037318 | 301 |
| 13 | 3300005356 | Ga0070674_100010689 | Ga0070674_1000106891 | 301 |
| 14 | 3300005456 | Ga0070678_100029774 | Ga0070678_1000297742 | 301 |
| 15 | 3300005543 | Ga0070672_100018738 | Ga0070672_1000187385 | 301 |
| 16 | 3300005548 | Ga0070665_100112863 | Ga0070665_1001128632 | 301 |
| 17 | 3300005834 | Ga0068851_10009865 | Ga0068851_100098652 | 301 |
| 18 | 3300005841 | Ga0068863_100081714 | Ga0068863_1000817143 | 301 |
| 19 | 3300025315 | Ga0207697_10027391 | Ga0207697_100273913 | 301 |
| 20 | 3300025893 | Ga0207682_10000456 | Ga0207682_1000045615 | 301 |
| 21 | 3300025923 | Ga0207681_10021166 | Ga0207681_100211663 | 301 |
| 22 | 3300025925 | Ga0207650_10003907 | Ga0207650_100039078 | 301 |
| 23 | 3300025926 | Ga0207659_10000135 | Ga0207659_1000013515 | 301 |
| 24 | 3300025937 | Ga0207669_10017445 | Ga0207669_100174452 | 301 |
| 25 | 3300025940 | Ga0207691_10002618 | Ga0207691_1000261810 | 301 |
| 26 | 3300025945 | Ga0207679_10025752 | Ga0207679_100257525 | 301 |
| 27 | 3300025960 | Ga0207651_10001078 | Ga0207651_100010789 | 301 |
| 28 | 3300025986 | Ga0207658_10046839 | Ga0207658_100468391 | 301 |
| 29 | 3300026023 | Ga0207677_10164847 | Ga0207677_101648472 | 301 |
| 30 | 3300026088 | Ga0207641_10029888 | Ga0207641_100298885 | 301 |
| 31 | 3300026095 | Ga0207676_10028402 | Ga0207676_100284025 | 301 |
| 32 | 3300026121 | Ga0207683_10005554 | Ga0207683_100055546 | 301 |
| 33 | 3300003323 | rootH1_10052997 | rootH1_100529974 | 303 |
| 34 | 3300037418 | Ga0395900_0344366 | Ga0395900_0344366_50_1063 | 310 |
| 35 | 3300037471 | Ga0395905_0214114 | Ga0395905_0214114_398_1411 | 310 |
| 36 | iso_pu_bacteria | 2856287931 | 2856293542 | 314 |
| 37 | iso_pu_bacteria | 2857357740 | 2857360701 | 314 |
| 38 | 3300005563 | Ga0068855_100211523 | Ga0068855_1002115231 | 315 |
| 39 | 3300009094 | Ga0111539_10002121 | Ga0111539_1000212121 | 317 |
| 40 | 3300027907 | Ga0207428_10000486 | Ga0207428_100004869 | 317 |
| 41 | 3300031548 | Ga0307408_100082546 | Ga0307408_1000825462 | 317 |
| 42 | 3300046525 | Ga0495663_0052415 | Ga0495663_0052415_258_1253 | 317 |
| 43 | 3300050511 | nmdc:mga08y16_3722_c1 | nmdc:mga08y16_3722_c1_586_1584 | 317 |
| 44 | 3300050511 | nmdc:mga08y16_97039_c1 | nmdc:mga08y16_97039_c1_1845_2843 | 317 |
| 45 | 3300014326 | Ga0157380_10298890 | Ga0157380_102988901 | 318 |
| 46 | iso_pu_bacteria | 2513237150 | 2513956832 | 318 |
| 47 | iso_pu_bacteria | 2901300506 | 2901306952 | 318 |
| 48 | iso_pu_bacteria | 644736347 | 644747782 | 318 |
| 49 | 3300005355 | Ga0070671_100033809 | Ga0070671_1000338096 | 320 |
| 50 | 3300048905 | Ga0496102_0182439 | Ga0496102_0182439_209_1228 | 320 |
| 51 | 3300048915 | Ga0496112_0065778 | Ga0496112_0065778_250_1269 | 320 |
| 52 | iso_pu_bacteria | 2511231002 | 2511247025 | 320 |
| 53 | iso_pu_bacteria | 2513020051 | 2513228923 | 320 |
| 54 | iso_pu_bacteria | 2547132374 | 2548500988 | 320 |
| 55 | iso_pu_bacteria | 2599185214 | 2599626594 | 320 |
| 56 | iso_pu_bacteria | 2599185226 | 2599675658 | 320 |
| 57 | iso_pu_bacteria | 2599185227 | 2599684131 | 320 |
| 58 | iso_pu_bacteria | 2599185229 | 2599696145 | 320 |
| 59 | iso_pu_bacteria | 2643221570 | 2643866697 | 320 |
| 60 | iso_pu_bacteria | 2643221596 | 2643993430 | 320 |
| 61 | iso_pu_bacteria | 2643221628 | 2644163271 | 320 |
| 62 | iso_pu_bacteria | 2643221652 | 2644294568 | 320 |
| 63 | iso_pu_bacteria | 2643221658 | 2644327874 | 320 |
| 64 | iso_pu_bacteria | 2643221672 | 2644397835 | 320 |
| 65 | iso_pu_bacteria | 2643221683 | 2644468327 | 320 |
| 66 | iso_pu_bacteria | 2643221717 | 2644645873 | 320 |
| 67 | iso_pu_bacteria | 2721755523 | 2722884054 | 320 |
| 68 | iso_pu_bacteria | 2738541307 | 2738885101 | 320 |
| 69 | iso_pu_bacteria | 2738543019 | 2739278690 | 320 |
| 70 | iso_pu_bacteria | 2818991446 | 2819595697 | 320 |
| 71 | iso_pu_bacteria | 2831265667 | 2831266709 | 320 |
| 72 | iso_pu_bacteria | 2838054893 | 2838057211 | 320 |
| 73 | iso_pu_bacteria | 2839138175 | 2839140107 | 320 |
| 74 | iso_pu_bacteria | 2842677519 | 2842679617 | 320 |
| 75 | iso_pu_bacteria | 2842718218 | 2842719951 | 320 |
| 76 | iso_pu_bacteria | 2842733646 | 2842734989 | 320 |
| 77 | iso_pu_bacteria | 2881101125 | 2881101926 | 320 |
| 78 | iso_pu_bacteria | 2885198086 | 2885200269 | 320 |
| 79 | iso_pu_bacteria | 2885211737 | 2885213936 | 320 |
| 80 | iso_pu_bacteria | 2899924645 | 2899925043 | 320 |
| 81 | iso_pu_bacteria | 2904449895 | 2904455722 | 320 |
| 82 | iso_pu_bacteria | 2904456579 | 2904462768 | 320 |
| 83 | iso_pu_bacteria | 2904541872 | 2904544828 | 320 |
| 84 | iso_pu_bacteria | 2919462493 | 2919467287 | 320 |
| 85 | iso_pu_bacteria | 2928037797 | 2928038832 | 320 |
| 86 | iso_pu_bacteria | 2928044640 | 2928045563 | 320 |
| 87 | iso_pu_bacteria | 2928051484 | 2928053179 | 320 |
| 88 | iso_pu_bacteria | 2928064002 | 2928066785 | 320 |
| 89 | iso_pu_bacteria | 2928070936 | 2928071322 | 320 |
| 90 | iso_pu_bacteria | 2928084124 | 2928084743 | 320 |
| 91 | iso_pu_bacteria | 2929520902 | 2929522705 | 320 |
| 92 | iso_pu_bacteria | 2945909444 | 2945912197 | 320 |
| 93 | iso_pu_bacteria | 2945972063 | 2945977394 | 320 |
| 94 | iso_pu_bacteria | 2954767861 | 2954772065 | 320 |
| 95 | iso_pu_bacteria | 2974320154 | 2974323104 | 320 |
| 96 | iso_pu_bacteria | 2990710928 | 2990712666 | 320 |
| 97 | 3300003187 | JGI25151J46595_10003392 | JGI25151J46595_100033926 | 321 |
| 98 | 3300003187 | JGI25151J46595_10048496 | JGI25151J46595_100484961 | 321 |
| 99 | 3300003759 | Ga0055525_1000026 | Ga0055525_100002680 | 321 |
| 100 | 3300003775 | Ga0055524_1004862 | Ga0055524_10048624 | 321 |
| 101 | 3300003775 | Ga0055524_1005810 | Ga0055524_10058105 | 321 |
| 102 | 3300025230 | Ga0209563_100005 | Ga0209563_1000051514 | 321 |
| 103 | 3300025263 | Ga0209565_1000066 | Ga0209565_1000066123 | 321 |
| 104 | 3300025263 | Ga0209565_1004849 | Ga0209565_10048492 | 321 |
| 105 | 3300025273 | Ga0209673_1009554 | Ga0209673_10095544 | 321 |
| 106 | 3300025291 | Ga0209675_1000930 | Ga0209675_100093017 | 321 |
| 107 | 3300025294 | Ga0209025_1001607 | Ga0209025_100160718 | 321 |
| 108 | 3300025294 | Ga0209025_1012270 | Ga0209025_10122705 | 321 |
| 109 | 3300025295 | Ga0209564_1000539 | Ga0209564_100053912 | 321 |
| 110 | 3300025297 | Ga0209758_1015243 | Ga0209758_10152434 | 321 |
| 111 | 3300025299 | Ga0209256_1000600 | Ga0209256_100060027 | 321 |
| 112 | 3300025299 | Ga0209256_1001560 | Ga0209256_100156022 | 321 |
| 113 | 3300025303 | Ga0209051_1058649 | Ga0209051_10586492 | 321 |
| 114 | 3300047318 | Ga0495636_0033130 | Ga0495636_0033130_527_1537 | 321 |
| 115 | iso_pu_bacteria | 2643221544 | 2643746206 | 321 |
| 116 | iso_pu_bacteria | 2643221656 | 2644314675 | 321 |
| 117 | iso_pu_bacteria | 2643221660 | 2644337930 | 321 |
| 118 | iso_pu_bacteria | 2831864461 | 2831866207 | 321 |
| 119 | 3300025933 | Ga0207706_10004063 | Ga0207706_100040637 | 322 |
| 120 | 3300031239 | Ga0265328_10014254 | Ga0265328_100142543 | 322 |
| 121 | 3300031250 | Ga0265331_10001642 | Ga0265331_100016423 | 322 |
| 122 | 3300031251 | Ga0265327_10000012 | Ga0265327_10000012481 | 322 |
| 123 | 3300031456 | Ga0307513_10146513 | Ga0307513_101465132 | 322 |
| 124 | 3300032002 | Ga0307416_100130931 | Ga0307416_1001309311 | 322 |
| 125 | 3300037471 | Ga0395905_0018032 | Ga0395905_0018032_3183_4196 | 322 |
| 126 | 3300038443 | Ga0395901_0086684 | Ga0395901_0086684_716_1732 | 322 |
| 127 | 3300044658 | Ga0466972_0001454 | Ga0466972_0001454_10145_11158 | 322 |
| 128 | 3300005327 | Ga0070658_10031424 | Ga0070658_100314244 | 323 |
| 129 | 3300006195 | Ga0075366_10000743 | Ga0075366_100007436 | 323 |
| 130 | 3300009093 | Ga0105240_10044801 | Ga0105240_100448013 | 323 |
| 131 | 3300009147 | Ga0114129_10023730 | Ga0114129_100237304 | 323 |
| 132 | 3300013308 | Ga0157375_10330902 | Ga0157375_103309021 | 323 |
| 133 | 3300025909 | Ga0207705_10153859 | Ga0207705_101538591 | 323 |
| 134 | 3300025913 | Ga0207695_10033270 | Ga0207695_100332703 | 323 |
| 135 | 3300025914 | Ga0207671_10237480 | Ga0207671_102374801 | 323 |
| 136 | 3300025960 | Ga0207651_10391894 | Ga0207651_103918942 | 323 |
| 137 | 3300027907 | Ga0207428_10020006 | Ga0207428_100200061 | 323 |
| 138 | 3300035691 | Ga0373931_0010219 | Ga0373931_0010219_2804_3820 | 323 |
| 139 | 3300044656 | Ga0466969_0000002 | Ga0466969_0000002_63811_64827 | 323 |
| 140 | 3300044684 | Ga0466966_0023879 | Ga0466966_0023879_1797_2813 | 323 |
| 141 | 3300044693 | Ga0466961_0066092 | Ga0466961_0066092_432_1448 | 323 |
| 142 | 3300045049 | Ga0466959_0040490 | Ga0466959_0040490_1561_2577 | 323 |
| 143 | 3300046506 | Ga0495583_0001567 | Ga0495583_0001567_968_1984 | 323 |
| 144 | 3300046507 | Ga0495606_0000606 | Ga0495606_0000606_39678_40694 | 323 |
| 145 | 3300046616 | Ga0495668_0008144 | Ga0495668_0008144_3274_4290 | 323 |
| 146 | 3300046684 | Ga0495669_0013029 | Ga0495669_0013029_2338_3354 | 323 |
| 147 | 3300046694 | Ga0495649_0001268 | Ga0495649_0001268_10813_11829 | 323 |
| 148 | 3300050507 | nmdc:mga05p37_29220_c1 | nmdc:mga05p37_29220_c1_1921_2937 | 323 |
| 149 | 3300053156 | Ga0500622_0024292 | Ga0500622_0024292_1835_2893 | 323 |
| 150 | 3300002704 | JGI25155J39150_1000002 | JGI25155J39150_100000223 | 324 |
| 151 | 3300002705 | JGI25156J39149_1000003 | JGI25156J39149_1000003282 | 324 |
| 152 | 3300002705 | JGI25156J39149_1000360 | JGI25156J39149_100036013 | 324 |
| 153 | 3300002705 | JGI25156J39149_1013969 | JGI25156J39149_10139693 | 324 |
| 154 | 3300002738 | JGI25154J39366_1000009 | JGI25154J39366_100000923 | 324 |
| 155 | 3300002738 | JGI25154J39366_1001294 | JGI25154J39366_10012946 | 324 |
| 156 | 3300002741 | JGI25157J39369_1000002 | JGI25157J39369_100000223 | 324 |
| 157 | 3300002741 | JGI25157J39369_1000039 | JGI25157J39369_100003918 | 324 |
| 158 | 3300002773 | JGI25152J39213_1007790 | JGI25152J39213_10077902 | 324 |
| 159 | 3300002774 | JGI25150J39212_1000299 | JGI25150J39212_10002996 | 324 |
| 160 | 3300002987 | JGI25159J45721_1000302 | JGI25159J45721_10003025 | 324 |
| 161 | 3300002987 | JGI25159J45721_1000502 | JGI25159J45721_10005025 | 324 |
| 162 | 3300003187 | JGI25151J46595_10027581 | JGI25151J46595_100275812 | 324 |
| 163 | 3300003215 | JGI25153J46596_10010784 | JGI25153J46596_100107846 | 324 |
| 164 | 3300003316 | rootH1_10003791 | rootH1_100037914 | 324 |
| 165 | 3300003320 | rootH2_10044844 | rootH2_100448443 | 324 |
| 166 | 3300003354 | JGI25160J50197_1000145 | JGI25160J50197_100014569 | 324 |
| 167 | 3300003374 | JGI25161J50226_1000032 | JGI25161J50226_1000032104 | 324 |
| 168 | 3300003374 | JGI25161J50226_1000064 | JGI25161J50226_100006413 | 324 |
| 169 | 3300003578 | Ga0006562J51391_1053800 | Ga0006562J51391_10538004 | 324 |
| 170 | 3300003578 | Ga0006562J51391_1057153 | Ga0006562J51391_10571532 | 324 |
| 171 | 3300003578 | Ga0006562J51391_1057155 | Ga0006562J51391_10571553 | 324 |
| 172 | 3300003752 | Ga0055539_1000553 | Ga0055539_10005534 | 324 |
| 173 | 3300003752 | Ga0055539_1000654 | Ga0055539_10006546 | 324 |
| 174 | 3300003752 | Ga0055539_1004700 | Ga0055539_10047003 | 324 |
| 175 | 3300003756 | Ga0055533_1000028 | Ga0055533_1000028208 | 324 |
| 176 | 3300003756 | Ga0055533_1000057 | Ga0055533_100005763 | 324 |
| 177 | 3300003759 | Ga0055525_1000696 | Ga0055525_10006964 | 324 |
| 178 | 3300003761 | Ga0055535_1000438 | Ga0055535_10004388 | 324 |
| 179 | 3300003761 | Ga0055535_1000449 | Ga0055535_100044934 | 324 |
| 180 | 3300003761 | Ga0055535_1012328 | Ga0055535_10123281 | 324 |
| 181 | 3300003762 | Ga0055542_1000021 | Ga0055542_1000021192 | 324 |
| 182 | 3300003763 | Ga0055529_1000331 | Ga0055529_100033141 | 324 |
| 183 | 3300003771 | Ga0055526_1003563 | Ga0055526_10035635 | 324 |
| 184 | 3300003771 | Ga0055526_1007942 | Ga0055526_10079425 | 324 |
| 185 | 3300003771 | Ga0055526_1009226 | Ga0055526_10092262 | 324 |
| 186 | 3300003771 | Ga0055526_1009233 | Ga0055526_10092332 | 324 |
| 187 | 3300003771 | Ga0055526_1009997 | Ga0055526_10099975 | 324 |
| 188 | 3300003773 | Ga0055537_1000036 | Ga0055537_100003627 | 324 |
| 189 | 3300003773 | Ga0055537_1000043 | Ga0055537_10000437 | 324 |
| 190 | 3300003773 | Ga0055537_1000537 | Ga0055537_100053722 | 324 |
| 191 | 3300003775 | Ga0055524_1000012 | Ga0055524_1000012120 | 324 |
| 192 | 3300003775 | Ga0055524_1000888 | Ga0055524_100088813 | 324 |
| 193 | 3300003781 | Ga0055536_1000858 | Ga0055536_100085814 | 324 |
| 194 | 3300003781 | Ga0055536_1003402 | Ga0055536_10034026 | 324 |
| 195 | 3300003781 | Ga0055536_1004794 | Ga0055536_10047947 | 324 |
| 196 | 3300003784 | Ga0055534_1000018 | Ga0055534_100001857 | 324 |
| 197 | 3300003790 | Ga0055528_1000717 | Ga0055528_10007178 | 324 |
| 198 | 3300003790 | Ga0055528_1005325 | Ga0055528_10053254 | 324 |
| 199 | 3300003790 | Ga0055528_1007566 | Ga0055528_10075662 | 324 |
| 200 | 3300003791 | Ga0055530_10000015 | Ga0055530_10000015121 | 324 |
| 201 | 3300003791 | Ga0055530_10001441 | Ga0055530_1000144112 | 324 |
| 202 | 3300003791 | Ga0055530_10003937 | Ga0055530_100039378 | 324 |
| 203 | 3300003792 | Ga0055540_1000012 | Ga0055540_1000012239 | 324 |
| 204 | 3300003792 | Ga0055540_1000039 | Ga0055540_100003921 | 324 |
| 205 | 3300003792 | Ga0055540_1000800 | Ga0055540_100080012 | 324 |
| 206 | 3300003792 | Ga0055540_1000917 | Ga0055540_10009175 | 324 |
| 207 | 3300003792 | Ga0055540_1000922 | Ga0055540_100092214 | 324 |
| 208 | 3300003792 | Ga0055540_1007984 | Ga0055540_10079843 | 324 |
| 209 | 3300003792 | Ga0055540_1015055 | Ga0055540_10150552 | 324 |
| 210 | 3300003794 | Ga0055531_10000783 | Ga0055531_1000078317 | 324 |
| 211 | 3300003794 | Ga0055531_10006340 | Ga0055531_100063404 | 324 |
| 212 | 3300003794 | Ga0055531_10023607 | Ga0055531_100236072 | 324 |
| 213 | 3300003794 | Ga0055531_10024056 | Ga0055531_100240562 | 324 |
| 214 | 3300003794 | Ga0055531_10026534 | Ga0055531_100265343 | 324 |
| 215 | 3300004625 | Ga0055543_1000445 | Ga0055543_10004456 | 324 |
| 216 | 3300004625 | Ga0055543_1000516 | Ga0055543_10005163 | 324 |
| 217 | 3300004625 | Ga0055543_1000752 | Ga0055543_100075212 | 324 |
| 218 | 3300005262 | Ga0065165_1000184 | Ga0065165_10001846 | 324 |
| 219 | 3300005262 | Ga0065165_1000354 | Ga0065165_100035453 | 324 |
| 220 | 3300005262 | Ga0065165_1001466 | Ga0065165_100146622 | 324 |
| 221 | 3300005262 | Ga0065165_1007478 | Ga0065165_10074785 | 324 |
| 222 | 3300005262 | Ga0065165_1016049 | Ga0065165_10160492 | 324 |
| 223 | 3300005262 | Ga0065165_1016671 | Ga0065165_10166713 | 324 |
| 224 | 3300005288 | Ga0065714_10068241 | Ga0065714_100682413 | 324 |
| 225 | 3300005289 | Ga0065704_10089162 | Ga0065704_100891622 | 324 |
| 226 | 3300005327 | Ga0070658_10022204 | Ga0070658_100222044 | 324 |
| 227 | 3300005328 | Ga0070676_10027403 | Ga0070676_100274032 | 324 |
| 228 | 3300005330 | Ga0070690_100068422 | Ga0070690_1000684223 | 324 |
| 229 | 3300005331 | Ga0070670_100158873 | Ga0070670_1001588732 | 324 |
| 230 | 3300005334 | Ga0068869_100193131 | Ga0068869_1001931312 | 324 |
| 231 | 3300005335 | Ga0070666_10017093 | Ga0070666_100170934 | 324 |
| 232 | 3300005336 | Ga0070680_100194800 | Ga0070680_1001948002 | 324 |
| 233 | 3300005338 | Ga0068868_100012222 | Ga0068868_1000122226 | 324 |
| 234 | 3300005339 | Ga0070660_100018535 | Ga0070660_1000185355 | 324 |
| 235 | 3300005339 | Ga0070660_100172637 | Ga0070660_1001726372 | 324 |
| 236 | 3300005339 | Ga0070660_100208910 | Ga0070660_1002089101 | 324 |
| 237 | 3300005340 | Ga0070689_100040224 | Ga0070689_1000402242 | 324 |
| 238 | 3300005341 | Ga0070691_10046864 | Ga0070691_100468642 | 324 |
| 239 | 3300005347 | Ga0070668_100202604 | Ga0070668_1002026041 | 324 |
| 240 | 3300005353 | Ga0070669_100091172 | Ga0070669_1000911723 | 324 |
| 241 | 3300005354 | Ga0070675_100000269 | Ga0070675_10000026919 | 324 |
| 242 | 3300005355 | Ga0070671_100005667 | Ga0070671_1000056673 | 324 |
| 243 | 3300005355 | Ga0070671_100044215 | Ga0070671_1000442152 | 324 |
| 244 | 3300005364 | Ga0070673_100009535 | Ga0070673_1000095358 | 324 |
| 245 | 3300005364 | Ga0070673_100277824 | Ga0070673_1002778241 | 324 |
| 246 | 3300005366 | Ga0070659_100435246 | Ga0070659_1004352461 | 324 |
| 247 | 3300005367 | Ga0070667_100009497 | Ga0070667_1000094978 | 324 |
| 248 | 3300005456 | Ga0070678_100010796 | Ga0070678_1000107963 | 324 |
| 249 | 3300005457 | Ga0070662_100053787 | Ga0070662_1000537874 | 324 |
| 250 | 3300005459 | Ga0068867_100114586 | Ga0068867_1001145861 | 324 |
| 251 | 3300005530 | Ga0070679_100032501 | Ga0070679_1000325016 | 324 |
| 252 | 3300005530 | Ga0070679_100048853 | Ga0070679_1000488536 | 324 |
| 253 | 3300005539 | Ga0068853_100051532 | Ga0068853_1000515322 | 324 |
| 254 | 3300005543 | Ga0070672_100414253 | Ga0070672_1004142531 | 324 |
| 255 | 3300005563 | Ga0068855_100028023 | Ga0068855_1000280236 | 324 |
| 256 | 3300005563 | Ga0068855_100128814 | Ga0068855_1001288143 | 324 |
| 257 | 3300005563 | Ga0068855_100143829 | Ga0068855_1001438293 | 324 |
| 258 | 3300005563 | Ga0068855_100334645 | Ga0068855_1003346452 | 324 |
| 259 | 3300005577 | Ga0068857_100009357 | Ga0068857_1000093574 | 324 |
| 260 | 3300005578 | Ga0068854_100002736 | Ga0068854_1000027364 | 324 |
| 261 | 3300005578 | Ga0068854_100023819 | Ga0068854_1000238193 | 324 |
| 262 | 3300005614 | Ga0068856_100121801 | Ga0068856_1001218013 | 324 |
| 263 | 3300005617 | Ga0068859_100006353 | Ga0068859_10000635312 | 324 |
| 264 | 3300005618 | Ga0068864_100001695 | Ga0068864_10000169515 | 324 |
| 265 | 3300005719 | Ga0068861_100021943 | Ga0068861_1000219434 | 324 |
| 266 | 3300005841 | Ga0068863_100002152 | Ga0068863_1000021521 | 324 |
| 267 | 3300005842 | Ga0068858_100013023 | Ga0068858_1000130237 | 324 |
| 268 | 3300005843 | Ga0068860_100069043 | Ga0068860_1000690432 | 324 |
| 269 | 3300005844 | Ga0068862_100134226 | Ga0068862_1001342263 | 324 |
| 270 | 3300006038 | Ga0075365_10057383 | Ga0075365_100573832 | 324 |
| 271 | 3300006038 | Ga0075365_10145674 | Ga0075365_101456742 | 324 |
| 272 | 3300006048 | Ga0075363_100047715 | Ga0075363_1000477151 | 324 |
| 273 | 3300006051 | Ga0075364_10036191 | Ga0075364_100361913 | 324 |
| 274 | 3300006058 | Ga0075432_10015641 | Ga0075432_100156412 | 324 |
| 275 | 3300006177 | Ga0075362_10008792 | Ga0075362_100087922 | 324 |
| 276 | 3300006195 | Ga0075366_10005108 | Ga0075366_100051087 | 324 |
| 277 | 3300006195 | Ga0075366_10074755 | Ga0075366_100747552 | 324 |
| 278 | 3300006353 | Ga0075370_10000255 | Ga0075370_100002554 | 324 |
| 279 | 3300006353 | Ga0075370_10010934 | Ga0075370_100109345 | 324 |
| 280 | 3300006353 | Ga0075370_10015240 | Ga0075370_100152401 | 324 |
| 281 | 3300006353 | Ga0075370_10030148 | Ga0075370_100301482 | 324 |
| 282 | 3300006880 | Ga0075429_100001889 | Ga0075429_10000188912 | 324 |
| 283 | 3300006881 | Ga0068865_100211970 | Ga0068865_1002119701 | 324 |
| 284 | 3300006931 | Ga0097620_100006353 | Ga0097620_1000063532 | 324 |
| 285 | 3300006946 | Ga0079104_1000011 | Ga0079104_1000011214 | 324 |
| 286 | 3300006948 | Ga0099826_10003934 | Ga0099826_100039348 | 324 |
| 287 | 3300006948 | Ga0099826_10155344 | Ga0099826_101553442 | 324 |
| 288 | 3300009036 | Ga0105244_10004770 | Ga0105244_100047707 | 324 |
| 289 | 3300009092 | Ga0105250_10009489 | Ga0105250_100094895 | 324 |
| 290 | 3300009093 | Ga0105240_10001089 | Ga0105240_1000108932 | 324 |
| 291 | 3300009148 | Ga0105243_10000246 | Ga0105243_100002461 | 324 |
| 292 | 3300009148 | Ga0105243_10001827 | Ga0105243_100018278 | 324 |
| 293 | 3300009148 | Ga0105243_10002130 | Ga0105243_1000213012 | 324 |
| 294 | 3300009148 | Ga0105243_10227182 | Ga0105243_102271821 | 324 |
| 295 | 3300009177 | Ga0105248_10136036 | Ga0105248_101360362 | 324 |
| 296 | 3300009545 | Ga0105237_10353161 | Ga0105237_103531612 | 324 |
| 297 | 3300009553 | Ga0105249_10179357 | Ga0105249_101793573 | 324 |
| 298 | 3300012497 | Ga0157319_1000009 | Ga0157319_100000935 | 324 |
| 299 | 3300013104 | Ga0157370_10086305 | Ga0157370_100863054 | 324 |
| 300 | 3300013105 | Ga0157369_10005851 | Ga0157369_100058514 | 324 |
| 301 | 3300013105 | Ga0157369_10009093 | Ga0157369_100090936 | 324 |
| 302 | 3300013296 | Ga0157374_10011952 | Ga0157374_100119525 | 324 |
| 303 | 3300013297 | Ga0157378_10284231 | Ga0157378_102842312 | 324 |
| 304 | 3300013306 | Ga0163162_10162615 | Ga0163162_101626153 | 324 |
| 305 | 3300014325 | Ga0163163_10000864 | Ga0163163_1000086411 | 324 |
| 306 | 3300014326 | Ga0157380_10415154 | Ga0157380_104151541 | 324 |
| 307 | 3300014497 | Ga0182008_10001753 | Ga0182008_100017536 | 324 |
| 308 | 3300014497 | Ga0182008_10020103 | Ga0182008_100201033 | 324 |
| 309 | 3300014968 | Ga0157379_10023287 | Ga0157379_100232874 | 324 |
| 310 | 3300015261 | Ga0182006_1001664 | Ga0182006_10016649 | 324 |
| 311 | 3300015261 | Ga0182006_1023000 | Ga0182006_10230003 | 324 |
| 312 | 3300015262 | Ga0182007_10000524 | Ga0182007_1000052415 | 324 |
| 313 | 3300017792 | Ga0163161_10000139 | Ga0163161_1000013963 | 324 |
| 314 | 3300017792 | Ga0163161_10010958 | Ga0163161_100109581 | 324 |
| 315 | 3300017792 | Ga0163161_10328816 | Ga0163161_103288161 | 324 |
| 316 | 3300021361 | Ga0213872_10000099 | Ga0213872_1000009917 | 324 |
| 317 | 3300021361 | Ga0213872_10013435 | Ga0213872_100134353 | 324 |
| 318 | 3300025206 | Ga0209435_100001 | Ga0209435_100001693 | 324 |
| 319 | 3300025226 | Ga0209674_100007 | Ga0209674_100007837 | 324 |
| 320 | 3300025229 | Ga0209147_101671 | Ga0209147_1016716 | 324 |
| 321 | 3300025230 | Ga0209563_100033 | Ga0209563_100033204 | 324 |
| 322 | 3300025231 | Ga0207427_101424 | Ga0207427_1014243 | 324 |
| 323 | 3300025242 | Ga0209258_100058 | Ga0209258_100058192 | 324 |
| 324 | 3300025242 | Ga0209258_100353 | Ga0209258_10035342 | 324 |
| 325 | 3300025242 | Ga0209258_100475 | Ga0209258_10047518 | 324 |
| 326 | 3300025245 | Ga0207425_1000157 | Ga0207425_100015748 | 324 |
| 327 | 3300025245 | Ga0207425_1001936 | Ga0207425_10019362 | 324 |
| 328 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000011062 | 324 |
| 329 | 3300025246 | Ga0209646_1000053 | Ga0209646_100005397 | 324 |
| 330 | 3300025250 | Ga0209026_1000003 | Ga0209026_1000003693 | 324 |
| 331 | 3300025250 | Ga0209026_1000020 | Ga0209026_1000020222 | 324 |
| 332 | 3300025253 | Ga0209677_100132 | Ga0209677_10013248 | 324 |
| 333 | 3300025253 | Ga0209677_100161 | Ga0209677_10016134 | 324 |
| 334 | 3300025253 | Ga0209677_100999 | Ga0209677_1009994 | 324 |
| 335 | 3300025254 | Ga0209148_1000071 | Ga0209148_1000071192 | 324 |
| 336 | 3300025256 | Ga0209759_1000001 | Ga0209759_1000001693 | 324 |
| 337 | 3300025256 | Ga0209759_1000017 | Ga0209759_100001797 | 324 |
| 338 | 3300025256 | Ga0209759_1002547 | Ga0209759_10025474 | 324 |
| 339 | 3300025256 | Ga0209759_1004959 | Ga0209759_10049594 | 324 |
| 340 | 3300025256 | Ga0209759_1010156 | Ga0209759_10101562 | 324 |
| 341 | 3300025256 | Ga0209759_1019775 | Ga0209759_10197751 | 324 |
| 342 | 3300025258 | Ga0209129_1000494 | Ga0209129_100049425 | 324 |
| 343 | 3300025258 | Ga0209129_1007584 | Ga0209129_10075842 | 324 |
| 344 | 3300025258 | Ga0209129_1008644 | Ga0209129_10086442 | 324 |
| 345 | 3300025263 | Ga0209565_1000004 | Ga0209565_1000004515 | 324 |
| 346 | 3300025263 | Ga0209565_1000038 | Ga0209565_10000386 | 324 |
| 347 | 3300025263 | Ga0209565_1000075 | Ga0209565_1000075100 | 324 |
| 348 | 3300025263 | Ga0209565_1001286 | Ga0209565_10012865 | 324 |
| 349 | 3300025272 | Ga0209455_1000136 | Ga0209455_100013699 | 324 |
| 350 | 3300025273 | Ga0209673_1000066 | Ga0209673_1000066132 | 324 |
| 351 | 3300025273 | Ga0209673_1000289 | Ga0209673_100028977 | 324 |
| 352 | 3300025273 | Ga0209673_1000357 | Ga0209673_100035733 | 324 |
| 353 | 3300025273 | Ga0209673_1000362 | Ga0209673_100036225 | 324 |
| 354 | 3300025273 | Ga0209673_1014452 | Ga0209673_10144522 | 324 |
| 355 | 3300025273 | Ga0209673_1036032 | Ga0209673_10360322 | 324 |
| 356 | 3300025284 | Ga0209130_1000082 | Ga0209130_100008245 | 324 |
| 357 | 3300025284 | Ga0209130_1000094 | Ga0209130_100009452 | 324 |
| 358 | 3300025284 | Ga0209130_1000131 | Ga0209130_100013112 | 324 |
| 359 | 3300025284 | Ga0209130_1000929 | Ga0209130_10009292 | 324 |
| 360 | 3300025291 | Ga0209675_1000061 | Ga0209675_1000061115 | 324 |
| 361 | 3300025291 | Ga0209675_1000074 | Ga0209675_1000074100 | 324 |
| 362 | 3300025291 | Ga0209675_1000177 | Ga0209675_100017725 | 324 |
| 363 | 3300025291 | Ga0209675_1004048 | Ga0209675_10040485 | 324 |
| 364 | 3300025291 | Ga0209675_1006569 | Ga0209675_10065693 | 324 |
| 365 | 3300025291 | Ga0209675_1008579 | Ga0209675_10085794 | 324 |
| 366 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005834 | 324 |
| 367 | 3300025292 | Ga0209676_1000029 | Ga0209676_1000029388 | 324 |
| 368 | 3300025292 | Ga0209676_1000142 | Ga0209676_100014264 | 324 |
| 369 | 3300025292 | Ga0209676_1000186 | Ga0209676_100018620 | 324 |
| 370 | 3300025292 | Ga0209676_1001149 | Ga0209676_100114917 | 324 |
| 371 | 3300025292 | Ga0209676_1003547 | Ga0209676_10035472 | 324 |
| 372 | 3300025292 | Ga0209676_1003883 | Ga0209676_10038835 | 324 |
| 373 | 3300025294 | Ga0209025_1000056 | Ga0209025_1000056278 | 324 |
| 374 | 3300025294 | Ga0209025_1000088 | Ga0209025_1000088228 | 324 |
| 375 | 3300025294 | Ga0209025_1004754 | Ga0209025_100475410 | 324 |
| 376 | 3300025294 | Ga0209025_1007422 | Ga0209025_10074227 | 324 |
| 377 | 3300025294 | Ga0209025_1042395 | Ga0209025_10423952 | 324 |
| 378 | 3300025295 | Ga0209564_1000003 | Ga0209564_1000003386 | 324 |
| 379 | 3300025295 | Ga0209564_1000090 | Ga0209564_1000090115 | 324 |
| 380 | 3300025295 | Ga0209564_1000542 | Ga0209564_10005429 | 324 |
| 381 | 3300025295 | Ga0209564_1000969 | Ga0209564_100096932 | 324 |
| 382 | 3300025295 | Ga0209564_1002810 | Ga0209564_10028107 | 324 |
| 383 | 3300025297 | Ga0209758_1000044 | Ga0209758_1000044265 | 324 |
| 384 | 3300025297 | Ga0209758_1002642 | Ga0209758_100264212 | 324 |
| 385 | 3300025297 | Ga0209758_1003972 | Ga0209758_10039722 | 324 |
| 386 | 3300025298 | Ga0209050_1000003 | Ga0209050_1000003450 | 324 |
| 387 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007263 | 324 |
| 388 | 3300025298 | Ga0209050_1001266 | Ga0209050_10012664 | 324 |
| 389 | 3300025298 | Ga0209050_1001371 | Ga0209050_100137110 | 324 |
| 390 | 3300025298 | Ga0209050_1005923 | Ga0209050_10059232 | 324 |
| 391 | 3300025298 | Ga0209050_1015438 | Ga0209050_10154383 | 324 |
| 392 | 3300025299 | Ga0209256_1000001 | Ga0209256_1000001452 | 324 |
| 393 | 3300025299 | Ga0209256_1000020 | Ga0209256_1000020268 | 324 |
| 394 | 3300025299 | Ga0209256_1000022 | Ga0209256_1000022177 | 324 |
| 395 | 3300025299 | Ga0209256_1001777 | Ga0209256_100177713 | 324 |
| 396 | 3300025302 | Ga0207426_1000001 | Ga0207426_1000001903 | 324 |
| 397 | 3300025302 | Ga0207426_1000025 | Ga0207426_1000025507 | 324 |
| 398 | 3300025302 | Ga0207426_1000031 | Ga0207426_1000031334 | 324 |
| 399 | 3300025303 | Ga0209051_1000003 | Ga0209051_1000003450 | 324 |
| 400 | 3300025303 | Ga0209051_1000036 | Ga0209051_1000036185 | 324 |
| 401 | 3300025303 | Ga0209051_1000213 | Ga0209051_100021372 | 324 |
| 402 | 3300025303 | Ga0209051_1000243 | Ga0209051_100024364 | 324 |
| 403 | 3300025303 | Ga0209051_1000455 | Ga0209051_100045517 | 324 |
| 404 | 3300025303 | Ga0209051_1000987 | Ga0209051_100098710 | 324 |
| 405 | 3300025303 | Ga0209051_1018683 | Ga0209051_10186832 | 324 |
| 406 | 3300025303 | Ga0209051_1021258 | Ga0209051_10212582 | 324 |
| 407 | 3300025303 | Ga0209051_1022261 | Ga0209051_10222612 | 324 |
| 408 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011808 | 324 |
| 409 | 3300025304 | Ga0209257_1000018 | Ga0209257_1000018450 | 324 |
| 410 | 3300025304 | Ga0209257_1000021 | Ga0209257_1000021733 | 324 |
| 411 | 3300025304 | Ga0209257_1000226 | Ga0209257_1000226109 | 324 |
| 412 | 3300025304 | Ga0209257_1000980 | Ga0209257_100098016 | 324 |
| 413 | 3300025304 | Ga0209257_1002939 | Ga0209257_10029393 | 324 |
| 414 | 3300025304 | Ga0209257_1009850 | Ga0209257_10098502 | 324 |
| 415 | 3300025304 | Ga0209257_1014547 | Ga0209257_10145473 | 324 |
| 416 | 3300025321 | Ga0207656_10030898 | Ga0207656_100308982 | 324 |
| 417 | 3300025903 | Ga0207680_10005735 | Ga0207680_100057356 | 324 |
| 418 | 3300025904 | Ga0207647_10213424 | Ga0207647_102134241 | 324 |
| 419 | 3300025907 | Ga0207645_10010065 | Ga0207645_100100655 | 324 |
| 420 | 3300025913 | Ga0207695_10049144 | Ga0207695_100491442 | 324 |
| 421 | 3300025917 | Ga0207660_10203173 | Ga0207660_102031732 | 324 |
| 422 | 3300025919 | Ga0207657_10054433 | Ga0207657_100544332 | 324 |
| 423 | 3300025919 | Ga0207657_10128056 | Ga0207657_101280563 | 324 |
| 424 | 3300025919 | Ga0207657_10191632 | Ga0207657_101916322 | 324 |
| 425 | 3300025921 | Ga0207652_10073160 | Ga0207652_100731605 | 324 |
| 426 | 3300025924 | Ga0207694_10008847 | Ga0207694_100088473 | 324 |
| 427 | 3300025926 | Ga0207659_10000412 | Ga0207659_100004129 | 324 |
| 428 | 3300025933 | Ga0207706_10315156 | Ga0207706_103151562 | 324 |
| 429 | 3300025934 | Ga0207686_10009207 | Ga0207686_100092072 | 324 |
| 430 | 3300025935 | Ga0207709_10000074 | Ga0207709_1000007498 | 324 |
| 431 | 3300025935 | Ga0207709_10000147 | Ga0207709_1000014717 | 324 |
| 432 | 3300025935 | Ga0207709_10002508 | Ga0207709_100025085 | 324 |
| 433 | 3300025936 | Ga0207670_10094212 | Ga0207670_100942122 | 324 |
| 434 | 3300025940 | Ga0207691_10044008 | Ga0207691_100440085 | 324 |
| 435 | 3300025941 | Ga0207711_10399669 | Ga0207711_103996692 | 324 |
| 436 | 3300025942 | Ga0207689_10061799 | Ga0207689_100617993 | 324 |
| 437 | 3300025945 | Ga0207679_10055673 | Ga0207679_100556733 | 324 |
| 438 | 3300025945 | Ga0207679_10272712 | Ga0207679_102727122 | 324 |
| 439 | 3300025949 | Ga0207667_10059702 | Ga0207667_100597022 | 324 |
| 440 | 3300025949 | Ga0207667_10072624 | Ga0207667_100726246 | 324 |
| 441 | 3300025960 | Ga0207651_10011381 | Ga0207651_100113814 | 324 |
| 442 | 3300025960 | Ga0207651_10018452 | Ga0207651_100184525 | 324 |
| 443 | 3300025981 | Ga0207640_10007869 | Ga0207640_100078694 | 324 |
| 444 | 3300025986 | Ga0207658_10010935 | Ga0207658_100109355 | 324 |
| 445 | 3300026023 | Ga0207677_10248196 | Ga0207677_102481961 | 324 |
| 446 | 3300026035 | Ga0207703_10001097 | Ga0207703_1000109719 | 324 |
| 447 | 3300026041 | Ga0207639_10070432 | Ga0207639_100704323 | 324 |
| 448 | 3300026078 | Ga0207702_10001077 | Ga0207702_100010778 | 324 |
| 449 | 3300026088 | Ga0207641_10004871 | Ga0207641_1000487112 | 324 |
| 450 | 3300026089 | Ga0207648_10028147 | Ga0207648_100281473 | 324 |
| 451 | 3300026095 | Ga0207676_10001370 | Ga0207676_100013706 | 324 |
| 452 | 3300026116 | Ga0207674_10009929 | Ga0207674_100099292 | 324 |
| 453 | 3300026118 | Ga0207675_100063752 | Ga0207675_1000637522 | 324 |
| 454 | 3300026121 | Ga0207683_10008385 | Ga0207683_100083853 | 324 |
| 455 | 3300026142 | Ga0207698_10030616 | Ga0207698_100306165 | 324 |
| 456 | 3300027111 | Ga0209281_1000005 | Ga0209281_1000005727 | 324 |
| 457 | 3300027614 | Ga0209970_1002284 | Ga0209970_10022842 | 324 |
| 458 | 3300027666 | Ga0209282_1001367 | Ga0209282_10013679 | 324 |
| 459 | 3300027682 | Ga0209971_1008632 | Ga0209971_10086322 | 324 |
| 460 | 3300028381 | Ga0268264_10031665 | Ga0268264_100316652 | 324 |
| 461 | 3300028666 | Ga0265336_10000012 | Ga0265336_10000012128 | 324 |
| 462 | 3300028794 | Ga0307515_10205530 | Ga0307515_102055302 | 324 |
| 463 | 3300029957 | Ga0265324_10001796 | Ga0265324_100017964 | 324 |
| 464 | 3300029957 | Ga0265324_10008792 | Ga0265324_100087923 | 324 |
| 465 | 3300030521 | Ga0307511_10061197 | Ga0307511_100611972 | 324 |
| 466 | 3300030736 | Ga0316180_1157121 | Ga0316180_11571213 | 324 |
| 467 | 3300030742 | Ga0316183_1116801 | Ga0316183_11168016 | 324 |
| 468 | 3300030745 | Ga0316182_1399623 | Ga0316182_13996232 | 324 |
| 469 | 3300031456 | Ga0307513_10000019 | Ga0307513_1000001984 | 324 |
| 470 | 3300031456 | Ga0307513_10000051 | Ga0307513_1000005156 | 324 |
| 471 | 3300031456 | Ga0307513_10357525 | Ga0307513_103575251 | 324 |
| 472 | 3300031507 | Ga0307509_10325640 | Ga0307509_103256401 | 324 |
| 473 | 3300031548 | Ga0307408_100000010 | Ga0307408_100000010298 | 324 |
| 474 | 3300031548 | Ga0307408_100005073 | Ga0307408_1000050738 | 324 |
| 475 | 3300031649 | Ga0307514_10001730 | Ga0307514_1000173011 | 324 |
| 476 | 3300031649 | Ga0307514_10063221 | Ga0307514_100632212 | 324 |
| 477 | 3300031730 | Ga0307516_10000268 | Ga0307516_1000026833 | 324 |
| 478 | 3300031730 | Ga0307516_10000910 | Ga0307516_1000091021 | 324 |
| 479 | 3300031730 | Ga0307516_10009769 | Ga0307516_100097694 | 324 |
| 480 | 3300031730 | Ga0307516_10207558 | Ga0307516_102075582 | 324 |
| 481 | 3300031731 | Ga0307405_10038176 | Ga0307405_100381763 | 324 |
| 482 | 3300031824 | Ga0307413_10012999 | Ga0307413_100129992 | 324 |
| 483 | 3300031901 | Ga0307406_10005046 | Ga0307406_100050462 | 324 |
| 484 | 3300031901 | Ga0307406_10006192 | Ga0307406_100061925 | 324 |
| 485 | 3300031901 | Ga0307406_10072159 | Ga0307406_100721593 | 324 |
| 486 | 3300031903 | Ga0307407_10083218 | Ga0307407_100832182 | 324 |
| 487 | 3300031911 | Ga0307412_10003417 | Ga0307412_100034173 | 324 |
| 488 | 3300031911 | Ga0307412_10059241 | Ga0307412_100592413 | 324 |
| 489 | 3300032002 | Ga0307416_100083501 | Ga0307416_1000835012 | 324 |
| 490 | 3300032005 | Ga0307411_10003262 | Ga0307411_100032628 | 324 |
| 491 | 3300032005 | Ga0307411_10009327 | Ga0307411_100093273 | 324 |
| 492 | 3300035086 | Ga0373934_0014201 | Ga0373934_0014201_1158_2177 | 324 |
| 493 | 3300035114 | Ga0373939_0000118 | Ga0373939_0000118_16410_17429 | 324 |
| 494 | 3300035121 | Ga0373960_0002289 | Ga0373960_0002289_118_1137 | 324 |
| 495 | 3300035241 | Ga0373961_0023755 | Ga0373961_0023755_203_1222 | 324 |
| 496 | 3300035242 | Ga0373962_0008010 | Ga0373962_0008010_363_1382 | 324 |
| 497 | 3300035691 | Ga0373931_0000873 | Ga0373931_0000873_1732_2751 | 324 |
| 498 | 3300037312 | Ga0395899_0001240 | Ga0395899_0001240_19556_20572 | 324 |
| 499 | 3300037312 | Ga0395899_0002622 | Ga0395899_0002622_8779_9798 | 324 |
| 500 | 3300037312 | Ga0395899_0029980 | Ga0395899_0029980_1288_2304 | 324 |
| 501 | 3300037418 | Ga0395900_0000535 | Ga0395900_0000535_25426_26445 | 324 |
| 502 | 3300037418 | Ga0395900_0036004 | Ga0395900_0036004_610_1626 | 324 |
| 503 | 3300037466 | Ga0395898_0000485 | Ga0395898_0000485_14612_15634 | 324 |
| 504 | 3300037466 | Ga0395898_0120811 | Ga0395898_0120811_87_1106 | 324 |
| 505 | 3300037466 | Ga0395898_0285188 | Ga0395898_0285188_479_1495 | 324 |
| 506 | 3300037471 | Ga0395905_0007305 | Ga0395905_0007305_2444_3484 | 324 |
| 507 | 3300037471 | Ga0395905_0027898 | Ga0395905_0027898_2295_3311 | 324 |
| 508 | 3300037471 | Ga0395905_0046926 | Ga0395905_0046926_2970_3986 | 324 |
| 509 | 3300038443 | Ga0395901_0037371 | Ga0395901_0037371_414_1433 | 324 |
| 510 | 3300038443 | Ga0395901_0139747 | Ga0395901_0139747_694_1713 | 324 |
| 511 | 3300038443 | Ga0395901_0408365 | Ga0395901_0408365_299_1315 | 324 |
| 512 | 3300039447 | Ga0436361_0166276 | Ga0436361_0166276_1087_2106 | 324 |
| 513 | 3300039447 | Ga0436361_0720979 | Ga0436361_0720979_55771_56796 | 324 |
| 514 | 3300039447 | Ga0436361_0848510 | Ga0436361_0848510_18016_19038 | 324 |
| 515 | 3300041404 | Ga0439436_0012948 | Ga0439436_0012948_417_1439 | 324 |
| 516 | 3300042000 | Ga0439437_002470 | Ga0439437_002470_29_1048 | 324 |
| 517 | 3300042007 | Ga0439449_0001507 | Ga0439449_0001507_4054_5070 | 324 |
| 518 | 3300042125 | Ga0450923_000170 | Ga0450923_000170_1821_2837 | 324 |
| 519 | 3300042127 | Ga0450890_000362 | Ga0450890_000362_3991_5010 | 324 |
| 520 | 3300042127 | Ga0450890_002768 | Ga0450890_002768_1239_2258 | 324 |
| 521 | 3300042129 | Ga0450891_004720 | Ga0450891_004720_129_1148 | 324 |
| 522 | 3300042130 | Ga0450892_001375 | Ga0450892_001375_122_1141 | 324 |
| 523 | 3300042138 | Ga0450903_015923 | Ga0450903_015923_29_1048 | 324 |
| 524 | 3300042139 | Ga0450904_007673 | Ga0450904_007673_19_1035 | 324 |
| 525 | 3300042145 | Ga0450906_001542 | Ga0450906_001542_902_1918 | 324 |
| 526 | 3300042438 | Ga0439459_0001763 | Ga0439459_0001763_648_1667 | 324 |
| 527 | 3300042532 | Ga0450893_0000221 | Ga0450893_0000221_4365_5384 | 324 |
| 528 | 3300042876 | Ga0451577_0000114 | Ga0451577_0000114_137853_138869 | 324 |
| 529 | 3300044656 | Ga0466969_0006006 | Ga0466969_0006006_148_1167 | 324 |
| 530 | 3300044656 | Ga0466969_0006376 | Ga0466969_0006376_3315_4334 | 324 |
| 531 | 3300044656 | Ga0466969_0016312 | Ga0466969_0016312_140_1156 | 324 |
| 532 | 3300044683 | Ga0466965_0079510 | Ga0466965_0079510_328_1347 | 324 |
| 533 | 3300044684 | Ga0466966_0036473 | Ga0466966_0036473_1887_2906 | 324 |
| 534 | 3300044684 | Ga0466966_0037188 | Ga0466966_0037188_904_1923 | 324 |
| 535 | 3300044693 | Ga0466961_0026070 | Ga0466961_0026070_737_1753 | 324 |
| 536 | 3300044693 | Ga0466961_0052112 | Ga0466961_0052112_1432_2451 | 324 |
| 537 | 3300044694 | Ga0466963_0035083 | Ga0466963_0035083_1906_2925 | 324 |
| 538 | 3300044706 | Ga0466964_0017097 | Ga0466964_0017097_1612_2631 | 324 |
| 539 | 3300044706 | Ga0466964_0038470 | Ga0466964_0038470_591_1610 | 324 |
| 540 | 3300044712 | Ga0453684_0000606 | Ga0453684_0000606_51914_52930 | 324 |
| 541 | 3300044712 | Ga0453684_0049647 | Ga0453684_0049647_485_1504 | 324 |
| 542 | 3300044719 | Ga0466971_0036776 | Ga0466971_0036776_388_1407 | 324 |
| 543 | 3300044765 | Ga0466970_0024329 | Ga0466970_0024329_1107_2126 | 324 |
| 544 | 3300044765 | Ga0466970_0040206 | Ga0466970_0040206_304_1323 | 324 |
| 545 | 3300044765 | Ga0466970_0093791 | Ga0466970_0093791_140_1156 | 324 |
| 546 | 3300044842 | Ga0466957_0025407 | Ga0466957_0025407_1703_2722 | 324 |
| 547 | 3300044842 | Ga0466957_0058309 | Ga0466957_0058309_261_1280 | 324 |
| 548 | 3300045049 | Ga0466959_0008985 | Ga0466959_0008985_4292_5311 | 324 |
| 549 | 3300045049 | Ga0466959_0014711 | Ga0466959_0014711_3937_4956 | 324 |
| 550 | 3300045051 | Ga0451576_0019867 | Ga0451576_0019867_1845_2864 | 324 |
| 551 | 3300045051 | Ga0451576_0086654 | Ga0451576_0086654_1930_2949 | 324 |
| 552 | 3300045051 | Ga0451576_0087179 | Ga0451576_0087179_673_1689 | 324 |
| 553 | 3300045836 | Ga0466958_0052840 | Ga0466958_0052840_358_1377 | 324 |
| 554 | 3300045836 | Ga0466958_0056548 | Ga0466958_0056548_212_1231 | 324 |
| 555 | 3300045976 | Ga0466967_0008599 | Ga0466967_0008599_6329_7348 | 324 |
| 556 | 3300045976 | Ga0466967_0045641 | Ga0466967_0045641_2203_3222 | 324 |
| 557 | 3300046453 | Ga0495627_009890 | Ga0495627_009890_489_1505 | 324 |
| 558 | 3300046471 | Ga0495650_0033678 | Ga0495650_0033678_752_1771 | 324 |
| 559 | 3300046512 | Ga0495610_0018664 | Ga0495610_0018664_438_1454 | 324 |
| 560 | 3300046513 | Ga0495616_0006275 | Ga0495616_0006275_531_1547 | 324 |
| 561 | 3300046515 | Ga0495620_0057388 | Ga0495620_0057388_259_1278 | 324 |
| 562 | 3300046518 | Ga0495631_0000441 | Ga0495631_0000441_22881_23897 | 324 |
| 563 | 3300046520 | Ga0495637_0001468 | Ga0495637_0001468_6056_7072 | 324 |
| 564 | 3300046528 | Ga0495642_0010858 | Ga0495642_0010858_1499_2515 | 324 |
| 565 | 3300046530 | Ga0495654_0008489 | Ga0495654_0008489_3918_4934 | 324 |
| 566 | 3300046537 | Ga0495598_0004858 | Ga0495598_0004858_1375_2397 | 324 |
| 567 | 3300046539 | Ga0495621_0021938 | Ga0495621_0021938_423_1445 | 324 |
| 568 | 3300046542 | Ga0495597_0000065 | Ga0495597_0000065_76492_77529 | 324 |
| 569 | 3300046615 | Ga0495656_0008104 | Ga0495656_0008104_697_1713 | 324 |
| 570 | 3300046660 | Ga0495625_0000044 | Ga0495625_0000044_76770_77786 | 324 |
| 571 | 3300046660 | Ga0495625_0084918 | Ga0495625_0084918_673_1689 | 324 |
| 572 | 3300046692 | Ga0495671_0001710 | Ga0495671_0001710_723_1739 | 324 |
| 573 | 3300047321 | Ga0495676_0069842 | Ga0495676_0069842_568_1584 | 324 |
| 574 | 3300047472 | Ga0495686_0041824 | Ga0495686_0041824_869_1888 | 324 |
| 575 | 3300048089 | Ga0495614_0011922 | Ga0495614_0011922_656_1672 | 324 |
| 576 | 3300048904 | Ga0496101_0023990 | Ga0496101_0023990_2957_3973 | 324 |
| 577 | 3300048907 | Ga0496104_0086093 | Ga0496104_0086093_688_1710 | 324 |
| 578 | 3300048911 | Ga0496108_0066411 | Ga0496108_0066411_1072_2094 | 324 |
| 579 | 3300048912 | Ga0496109_0224898 | Ga0496109_0224898_270_1292 | 324 |
| 580 | 3300048919 | Ga0496116_0074194 | Ga0496116_0074194_823_1839 | 324 |
| 581 | 3300048920 | Ga0496117_0035489 | Ga0496117_0035489_172_1188 | 324 |
| 582 | 3300048920 | Ga0496117_0074983 | Ga0496117_0074983_152_1168 | 324 |
| 583 | 3300048921 | Ga0496118_0009730 | Ga0496118_0009730_2641_3657 | 324 |
| 584 | 3300048925 | Ga0496122_0019248 | Ga0496122_0019248_1625_2641 | 324 |
| 585 | 3300048926 | Ga0496123_0028920 | Ga0496123_0028920_2494_3510 | 324 |
| 586 | 3300048928 | Ga0496125_0024712 | Ga0496125_0024712_516_1532 | 324 |
| 587 | 3300048928 | Ga0496125_0060343 | Ga0496125_0060343_991_2007 | 324 |
| 588 | 3300048929 | Ga0496126_0197794 | Ga0496126_0197794_51_1067 | 324 |
| 589 | 3300049130 | Ga0501310_001584 | Ga0501310_001584_280_1299 | 324 |
| 590 | 3300049161 | Ga0501305_004765 | Ga0501305_004765_222_1241 | 324 |
| 591 | 3300049162 | Ga0501307_003263 | Ga0501307_003263_190_1209 | 324 |
| 592 | 3300049523 | Ga0501300_001969 | Ga0501300_001969_2013_3032 | 324 |
| 593 | 3300049527 | Ga0501311_002504 | Ga0501311_002504_738_1757 | 324 |
| 594 | 3300049528 | Ga0501312_012436 | Ga0501312_012436_140_1159 | 324 |
| 595 | 3300049530 | Ga0501314_001588 | Ga0501314_001588_274_1293 | 324 |
| 596 | 3300049531 | Ga0501315_001393 | Ga0501315_001393_139_1158 | 324 |
| 597 | 3300049568 | Ga0501031_0009899 | Ga0501031_0009899_4717_5733 | 324 |
| 598 | 3300049651 | Ga0501201_001519 | Ga0501201_001519_952_1971 | 324 |
| 599 | 3300049658 | Ga0501211_000538 | Ga0501211_000538_611_1630 | 324 |
| 600 | 3300049669 | Ga0501235_017532 | Ga0501235_017532_37_1056 | 324 |
| 601 | 3300049679 | Ga0501249_012730 | Ga0501249_012730_229_1248 | 324 |
| 602 | 3300049705 | Ga0501225_0003751 | Ga0501225_0003751_3416_4432 | 324 |
| 603 | 3300049706 | Ga0501229_004139 | Ga0501229_004139_552_1571 | 324 |
| 604 | 3300049759 | Ga0501262_000052 | Ga0501262_000052_12456_13472 | 324 |
| 605 | 3300049762 | Ga0501265_002343 | Ga0501265_002343_423_1442 | 324 |
| 606 | 3300050491 | nmdc:mga00v17_49238_c1 | nmdc:mga00v17_49238_c1_1377_2393 | 324 |
| 607 | 3300050492 | nmdc:mga0yw44_4196_c1 | nmdc:mga0yw44_4196_c1_1922_2938 | 324 |
| 608 | 3300050493 | nmdc:mga0k408_97917_c1 | nmdc:mga0k408_97917_c1_376_1395 | 324 |
| 609 | 3300050494 | nmdc:mga06z11_156924_c1 | nmdc:mga06z11_156924_c1_249_1265 | 324 |
| 610 | 3300050496 | nmdc:mga07m45_198529_c1 | nmdc:mga07m45_198529_c1_100_1116 | 324 |
| 611 | 3300050496 | nmdc:mga07m45_238_c1 | nmdc:mga07m45_238_c1_215_1234 | 324 |
| 612 | 3300050496 | nmdc:mga07m45_92600_c2 | nmdc:mga07m45_92600_c2_204_1220 | 324 |
| 613 | 3300050508 | nmdc:mga09592_4640_c1 | nmdc:mga09592_4640_c1_4898_5923 | 324 |
| 614 | 3300053079 | Ga0500610_0001062 | Ga0500610_0001062_927_1943 | 324 |
| 615 | 3300053079 | Ga0500610_0001287 | Ga0500610_0001287_6154_7170 | 324 |
| 616 | 3300053080 | Ga0500635_0000233 | Ga0500635_0000233_7989_9008 | 324 |
| 617 | 3300053087 | Ga0500643_015386 | Ga0500643_015386_981_1997 | 324 |
| 618 | 3300053088 | Ga0500644_0016039 | Ga0500644_0016039_433_1449 | 324 |
| 619 | 3300053093 | Ga0500651_0000053 | Ga0500651_0000053_51472_52488 | 324 |
| 620 | 3300053110 | Ga0500571_000136 | Ga0500571_000136_990_2006 | 324 |
| 621 | 3300053117 | Ga0500593_000482 | Ga0500593_000482_5466_6494 | 324 |
| 622 | 3300053117 | Ga0500593_016489 | Ga0500593_016489_903_1919 | 324 |
| 623 | 3300053118 | Ga0500594_0011564 | Ga0500594_0011564_25_1041 | 324 |
| 624 | 3300053122 | Ga0500608_086963 | Ga0500608_086963_324_1343 | 324 |
| 625 | 3300053134 | Ga0500658_0000385 | Ga0500658_0000385_1237_2253 | 324 |
| 626 | 3300053136 | Ga0500559_0014489 | Ga0500559_0014489_1747_2802 | 324 |
| 627 | 3300053139 | Ga0500568_0002715 | Ga0500568_0002715_1734_2750 | 324 |
| 628 | 3300053141 | Ga0500574_043332 | Ga0500574_043332_152_1168 | 324 |
| 629 | 3300053162 | Ga0500638_056152 | Ga0500638_056152_810_1826 | 324 |
| 630 | 3300053730 | Ga0500645_001435 | Ga0500645_001435_845_1861 | 324 |
| 631 | 3300053730 | Ga0500645_002264 | Ga0500645_002264_2633_3649 | 324 |
| 632 | 3300055283 | Ga0500661_001087 | Ga0500661_001087_568_1584 | 324 |
| 633 | 3300055283 | Ga0500661_005496 | Ga0500661_005496_124_1143 | 324 |
| 634 | 3300061719 | Ga0466962_0038583 | Ga0466962_0038583_617_1636 | 324 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2j3j-assembly1.cif.gz_B | crystal structure of arabidopsis thaliana double bond reductase (at5g16970)-ternary complex i | 0.9303 | 2 | 323 |
| 6ysb-assembly2.cif.gz_A | crystal structure of malus domestica double bond reductase (mddbr) apo form | 0.9247 | 2 | 323 |
| 6eow-assembly1.cif.gz_A | structure of raspberry ketone synthase with hydroxybenzalacetone | 0.9244 | 1 | 323 |
| 7vr4-assembly1.cif.gz_A | crystal structure of (-)-pulegone reductase pr1294 from nepeta tenuifolia in complex with nadph | 0.9228 | 2 | 324 |
| 6ytz-assembly1.cif.gz_A-2 | crystal structure of malus domestica double bond reductase (mddbr) in complex with nadph | 0.9223 | 2 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76113_7_128_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9498 | 4 | 127 | 3.90.180.10 |
| af_Q2G2D7_2_124_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9421 | 4 | 126 | 3.90.180.10 |
| 4b7cA01 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9358 | 2 | 323 | 3.90.180.10 |
| af_Q39173_2_340_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9356 | 2 | 323 | 3.90.180.10 |
| af_P76113_7_128_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9349 | 4 | 127 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C8BLI3-F1-model_v4 | deleted | 0.9767 | 2 | 324 |
|
| AF-A0A6N0ZHK2-F1-model_v4 | NADP-dependent oxidoreductase | 0.9747 | 159 | 324 |
GO:0016628
|
| AF-A0A1H7ZE42-F1-model_v4 | NADPH-dependent curcumin reductase CurA | 0.9744 | 1 | 323 |
GO:0016628
GO:0016740 |
| AF-A0A5C8BLI3-F1-model_v4 | deleted | 0.9707 | 2 | 324 |
|
| AF-A0A1H7ZE42-F1-model_v4 | NADPH-dependent curcumin reductase CurA | 0.9685 | 1 | 323 |
GO:0016628
GO:0016740 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar