F471114

General Info

Members Datasets Scaffolds Average Seq Length
633 343 588 197

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0058074|Ga0501032_0058074_765_1433
Length 222
Sequence VNRRADPESRSEREPAELRMTRTARVERTTGETKVLVEIDLDGTGGADVATGVGFFDHMLNQLAKHGGFGLVVHTVGDLDIDAHHTLEDTAIALGQAFAAALGDKAGIQRFGDAVVPLDEALVQAVVDLSGRAYVVHDEPADLAPMIGPQYPTSMTRHIWESFGNNAKMTLHVNVLRGARPGQRPDAHHVVEAQFKAVARALRQAVTADPRGGGVPSTKGLL

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
3 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
4 2643221561 Nocardioides sp. Root151 Isolate Unclassified
5 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
6 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
7 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
8 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
9 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
10 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
11 2855683550 Micromonospora sp. RP3T Isolate Unclassified
12 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
13 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
14 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
15 2858868258 Micromonospora sp. MH33 Isolate Unclassified
16 2858882152 Micromonospora noduli MED15 Isolate Nodule
17 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
18 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
19 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
20 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
21 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
22 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
23 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
24 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
25 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
26 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
27 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
28 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
29 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
30 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
31 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
32 2902582711 Micromonospora sp. AP08 Isolate Unclassified
33 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
34 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
35 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
36 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
123 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
124 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
125 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
146 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
147 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
148 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
149 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
172 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
173 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
188 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
189 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
190 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
191 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
192 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
193 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
197 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
198 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
199 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
200 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
201 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
202 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
203 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
252 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
260 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
268 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
284 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
285 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
300 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
320 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
323 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
324 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
325 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
326 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
327 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
328 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
329 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
330 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
331 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
332 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
333 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
334 649633069 Micromonospora sp. L5 Isolate Unclassified
335 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
336 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
337 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
338 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
339 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
340 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
341 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
342 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
343 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.58
Metatranscriptomes 0.32
Isolates 7.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.21
Nodule 0.95
Rhizoplane 3.79
Rhizosphere 82.78
Stem 0
Stem Tuber 0
Unclassified 10.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10042849 3300003203 Bacteria 1580
2 JGI25406J46586_10080278 3300003203 Bacteria 1002
3 Ga0068868_100199682 3300005338 Bacteria 1667
4 Ga0068868_100842955 3300005338 Bacteria 830
5 Ga0070668_100009783 3300005347 Bacteria 7107
6 Ga0070671_100184760 3300005355 Bacteria 1766
7 Ga0070673_100514352 3300005364 Bacteria 1084
8 Ga0070667_100059665 3300005367 Bacteria 3228
9 Ga0070709_10012583 3300005434 Bacteria 4738
10 Ga0070709_10671431 3300005434 Bacteria 804
11 Ga0070714_100012596 3300005435 Bacteria 6753
12 Ga0070713_100064606 3300005436 Bacteria 3072
13 Ga0070713_100179727 3300005436 Bacteria 1900
14 Ga0070713_100446719 3300005436 Bacteria 1214
15 Ga0070713_100742457 3300005436 Bacteria 939
16 Ga0070710_10000156 3300005437 Bacteria 31483
17 Ga0070710_10360189 3300005437 Bacteria 965
18 Ga0070711_100001013 3300005439 Bacteria 14930
19 Ga0070705_100108772 3300005440 Bacteria 1766
20 Ga0070708_100004503 3300005445 Bacteria 10962
21 Ga0070708_100009051 3300005445 Bacteria 8031
22 Ga0070708_100010420 3300005445 Bacteria 7534
23 Ga0070708_100022421 3300005445 Bacteria 5357
24 Ga0070708_100508366 3300005445 Bacteria 1136
25 Ga0070708_100622285 3300005445 Bacteria 1018
26 Ga0070663_100784821 3300005455 Bacteria 816
27 Ga0070706_100002251 3300005467 Bacteria 19550
28 Ga0070706_100006796 3300005467 Bacteria 10798
29 Ga0070706_100011378 3300005467 Bacteria 8269
30 Ga0070706_100072927 3300005467 Bacteria 3177
31 Ga0070706_100089714 3300005467 Bacteria 2851
32 Ga0070706_100128241 3300005467 Bacteria 2367
33 Ga0070706_100640857 3300005467 Bacteria 986
34 Ga0070707_100001697 3300005468 Bacteria 21256
35 Ga0070707_100004942 3300005468 Bacteria 12489
36 Ga0070707_100007974 3300005468 Bacteria 9836
37 Ga0070707_100010529 3300005468 Bacteria 8616
38 Ga0070707_100090500 3300005468 Bacteria 2961
39 Ga0070707_100110822 3300005468 Bacteria 2662
40 Ga0070707_100283513 3300005468 Bacteria 1610
41 Ga0070707_100335386 3300005468 Bacteria 1469
42 Ga0070707_100362658 3300005468 Bacteria 1408
43 Ga0070707_101015270 3300005468 Bacteria 795
44 Ga0070698_100003640 3300005471 Bacteria 16926
45 Ga0070698_100102994 3300005471 Bacteria 2825
46 Ga0070698_100123683 3300005471 Bacteria 2545
47 Ga0070699_100059670 3300005518 Bacteria 3304
48 Ga0070699_100216790 3300005518 Bacteria 1705
49 Ga0070699_100858676 3300005518 Bacteria 831
50 Ga0070679_100522648 3300005530 Bacteria 1131
51 Ga0070697_100028376 3300005536 Bacteria 4481
52 Ga0070665_100279072 3300005548 Bacteria 1672
53 Ga0070665_100620283 3300005548 Bacteria 1094
54 Ga0070665_101125307 3300005548 Bacteria 796
55 Ga0068855_100250409 3300005563 Bacteria 1976
56 Ga0068856_100148928 3300005614 Bacteria 2349
57 Ga0068856_100246890 3300005614 Bacteria 1800
58 Ga0068859_100104853 3300005617 Bacteria 2887
59 Ga0068863_100087639 3300005841 Bacteria 2950
60 Ga0068860_100042129 3300005843 Bacteria 4363
61 Ga0068862_100062137 3300005844 Bacteria 3212
62 Ga0081455_10010822 3300005937 Bacteria 9216
63 Ga0081455_10183459 3300005937 Bacteria 1582
64 Ga0081540_1001125 3300005983 Bacteria 23625
65 Ga0081539_10000385 3300005985 Bacteria 95511
66 Ga0081539_10000406 3300005985 Bacteria 91786
67 Ga0081539_10001654 3300005985 Bacteria 36124
68 Ga0081539_10004523 3300005985 Bacteria 15270
69 Ga0081539_10022628 3300005985 Bacteria 4149
70 Ga0081539_10027574 3300005985 Bacteria 3593
71 Ga0070717_10003117 3300006028 Bacteria 11832
72 Ga0075365_10045305 3300006038 Bacteria 2885
73 Ga0070715_10137568 3300006163 Bacteria 1182
74 Ga0070715_10189786 3300006163 Bacteria 1037
75 Ga0070716_100005401 3300006173 Bacteria 6185
76 Ga0070716_100119323 3300006173 Bacteria 1648
77 Ga0097621_100616732 3300006237 Bacteria 993
78 Ga0075428_100000182 3300006844 Bacteria 58871
79 Ga0075431_100042289 3300006847 Bacteria 4699
80 Ga0075431_100438078 3300006847 Bacteria 1304
81 Ga0075433_10025524 3300006852 Bacteria 4996
82 Ga0075433_10173037 3300006852 Bacteria 1921
83 Ga0075434_100076453 3300006871 Bacteria 3343
84 Ga0075434_100496438 3300006871 Bacteria 1241
85 Ga0075436_100062217 3300006914 Bacteria 2580
86 Ga0075436_100095378 3300006914 Bacteria 2069
87 Ga0097620_100104854 3300006931 Bacteria 2887
88 Ga0075435_100002359 3300007076 Bacteria 12518
89 Ga0075435_100107686 3300007076 Bacteria 2315
90 Ga0075435_100389071 3300007076 Bacteria 1198
91 Ga0075435_100506953 3300007076 Bacteria 1043
92 Ga0105250_10214143 3300009092 Bacteria 815
93 Ga0105240_10094884 3300009093 Bacteria 3638
94 Ga0105245_10243814 3300009098 Bacteria 1743
95 Ga0105245_11002780 3300009098 Bacteria 879
96 Ga0105245_11784200 3300009098 Bacteria 668
97 Ga0114129_10000744 3300009147 Bacteria 41358
98 Ga0114129_10009348 3300009147 Bacteria 13979
99 Ga0114129_10119346 3300009147 Bacteria 3632
100 Ga0114129_10640809 3300009147 Bacteria 1372
101 Ga0105241_10126179 3300009174 Bacteria 2067
102 Ga0105237_10065060 3300009545 Bacteria 3643
103 Ga0105237_10836927 3300009545 Bacteria 927
104 Ga0105238_10284675 3300009551 Bacteria 1635
105 Ga0105239_10967987 3300010375 Bacteria 978
106 Ga0157374_11151021 3300013296 Bacteria 797
107 Ga0157378_10293501 3300013297 Bacteria 1571
108 Ga0157379_10347953 3300014968 Bacteria 1356
109 Ga0197907_10198624 3300020069 Bacteria 1484
110 Ga0206353_10600692 3300020082 Bacteria 5401
111 Ga0207692_10046850 3300025898 Bacteria 2169
112 Ga0207692_10123442 3300025898 Bacteria 1453
113 Ga0207710_10018858 3300025900 Bacteria 2937
114 Ga0207647_10077625 3300025904 Bacteria 1996
115 Ga0207685_10061489 3300025905 Bacteria 1489
116 Ga0207699_10000563 3300025906 Bacteria 18306
117 Ga0207699_10042181 3300025906 Bacteria 2641
118 Ga0207643_10301319 3300025908 Bacteria 997
119 Ga0207705_10508098 3300025909 Bacteria 936
120 Ga0207684_10002393 3300025910 Bacteria 18981
121 Ga0207684_10003086 3300025910 Bacteria 16463
122 Ga0207684_10006215 3300025910 Bacteria 10905
123 Ga0207684_10216502 3300025910 Bacteria 1653
124 Ga0207684_10408276 3300025910 Bacteria 1167
125 Ga0207684_10422838 3300025910 Bacteria 1145
126 Ga0207684_10818875 3300025910 Bacteria 786
127 Ga0207654_10237226 3300025911 Bacteria 1217
128 Ga0207695_10254280 3300025913 Bacteria 1656
129 Ga0207663_10000822 3300025916 Bacteria 14036
130 Ga0207663_10001119 3300025916 Bacteria 12327
131 Ga0207662_10232618 3300025918 Bacteria 1204
132 Ga0207646_10000470 3300025922 Bacteria 53859
133 Ga0207646_10015576 3300025922 Bacteria 7177
134 Ga0207646_10048535 3300025922 Bacteria 3805
135 Ga0207646_10061737 3300025922 Bacteria 3345
136 Ga0207646_10074591 3300025922 Bacteria 3030
137 Ga0207646_10110749 3300025922 Bacteria 2463
138 Ga0207646_10120398 3300025922 Bacteria 2358
139 Ga0207646_10202794 3300025922 Bacteria 1792
140 Ga0207646_10214194 3300025922 Bacteria 1740
141 Ga0207650_10612055 3300025925 Bacteria 916
142 Ga0207700_10004933 3300025928 Bacteria 7927
143 Ga0207700_10007308 3300025928 Bacteria 6742
144 Ga0207700_10025045 3300025928 Bacteria 4137
145 Ga0207700_10026702 3300025928 Bacteria 4031
146 Ga0207700_10550123 3300025928 Bacteria 1024
147 Ga0207700_10788596 3300025928 Bacteria 850
148 Ga0207664_10002078 3300025929 Bacteria 13174
149 Ga0207664_10022897 3300025929 Bacteria 4673
150 Ga0207664_10166928 3300025929 Bacteria 1881
151 Ga0207664_10326266 3300025929 Bacteria 1355
152 Ga0207664_10651693 3300025929 Bacteria 946
153 Ga0207665_10000882 3300025939 Bacteria 20246
154 Ga0207665_10007304 3300025939 Bacteria 7308
155 Ga0207667_10126269 3300025949 Bacteria 2635
156 Ga0207667_10258860 3300025949 Bacteria 1779
157 Ga0207651_10919248 3300025960 Bacteria 780
158 Ga0207668_10003312 3300025972 Bacteria 9441
159 Ga0207658_10036320 3300025986 Bacteria 3532
160 Ga0207703_10214162 3300026035 Bacteria 1719
161 Ga0207702_10116688 3300026078 Bacteria 2382
162 Ga0207702_10594613 3300026078 Bacteria 1085
163 Ga0207641_10480478 3300026088 Bacteria 1204
164 Ga0207675_100466336 3300026118 Bacteria 1253
165 Ga0207683_10338448 3300026121 Bacteria 1380
166 Ga0207683_10622235 3300026121 Bacteria 1000
167 Ga0207698_10310033 3300026142 Bacteria 1473
168 Ga0207698_11328389 3300026142 Bacteria 734
169 Ga0268265_10093589 3300028380 Bacteria 2408
170 Ga0268264_10082729 3300028381 Bacteria 2748
171 Ga0307517_10084573 3300028786 Bacteria 2669
172 Ga0307517_10237093 3300028786 Bacteria 1087
173 Ga0307515_10002200 3300028794 Bacteria 42791
174 Ga0307515_10010401 3300028794 Bacteria 17825
175 Ga0307512_10004194 3300030522 Bacteria 15960
176 Ga0307512_10004480 3300030522 Bacteria 15286
177 Ga0316177_1122181 3300030731 Bacteria 1524
178 Ga0314311_1119181 3300030733 Bacteria 1414
179 Ga0316181_1275879 3300030744 Bacteria 3625
180 Ga0307513_10000001 3300031456 Bacteria 1660464
181 Ga0307513_10023131 3300031456 Bacteria 7272
182 Ga0307513_10046108 3300031456 Bacteria 4758
183 Ga0307509_10002147 3300031507 Bacteria 32420
184 Ga0307509_10248430 3300031507 Bacteria 1565
185 Ga0307408_100013342 3300031548 Bacteria 5453
186 Ga0307408_100709644 3300031548 Bacteria 905
187 Ga0307508_10001138 3300031616 Bacteria 30634
188 Ga0307508_10005883 3300031616 Bacteria 11576
189 Ga0307508_10108590 3300031616 Bacteria 2374
190 Ga0316575_10038387 3300031665 Bacteria 1889
191 Ga0307516_10079584 3300031730 Bacteria 3122
192 Ga0307516_10100183 3300031730 Bacteria 2713
193 Ga0307405_10381253 3300031731 Bacteria 1098
194 Ga0307413_10577508 3300031824 Bacteria 916
195 Ga0307410_10111168 3300031852 Bacteria 1983
196 Ga0307410_10179954 3300031852 Bacteria 1600
197 Ga0307410_10279010 3300031852 Bacteria 1310
198 Ga0326468_10000912 3300031889 Bacteria 2874
199 Ga0307406_10275136 3300031901 Bacteria 1281
200 Ga0307407_10491035 3300031903 Bacteria 898
201 Ga0307409_100013557 3300031995 Bacteria 5254
202 Ga0307409_100105371 3300031995 Bacteria 2351
203 Ga0307409_100285593 3300031995 Bacteria 1527
204 Ga0307416_100051915 3300032002 Bacteria 3279
205 Ga0307414_10372629 3300032004 Bacteria 1232
206 Ga0307411_10141253 3300032005 Bacteria 1776
207 Ga0307411_10400730 3300032005 Bacteria 1134
208 Ga0307415_100113398 3300032126 Bacteria 2016
209 Ga0307415_100307273 3300032126 Bacteria 1316
210 Ga0307415_100360078 3300032126 Bacteria 1228
211 Ga0307507_10093132 3300033179 Bacteria 2568
212 Ga0307507_10162155 3300033179 Bacteria 1649
213 Ga0307510_10186421 3300033180 Bacteria 1629
214 Ga0373948_0008068 3300034817 Bacteria 1786
215 Ga0373948_0014954 3300034817 Bacteria 1420
216 Ga0373950_0047944 3300034818 Bacteria 833
217 Ga0373958_0001609 3300034819 Bacteria 3061
218 Ga0373959_0008127 3300034820 Bacteria 1778
219 Ga0373938_0008973 3300034957 Bacteria 1799
220 Ga0373938_0020761 3300034957 Bacteria 1326
221 Ga0373929_0003855 3300035085 Bacteria 2686
222 Ga0373934_0000159 3300035086 Bacteria 24489
223 Ga0373934_0001926 3300035086 Bacteria 7614
224 Ga0373934_0026610 3300035086 Bacteria 2244
225 Ga0373940_0006056 3300035088 Bacteria 2659
226 Ga0373940_0011319 3300035088 Bacteria 2116
227 Ga0373944_0144923 3300035089 Bacteria 833
228 Ga0373949_0014019 3300035090 Bacteria 1782
229 Ga0373951_0000194 3300035091 Bacteria 21927
230 Ga0373951_0013850 3300035091 Bacteria 1813
231 Ga0373952_0001767 3300035092 Bacteria 3931
232 Ga0373923_0006383 3300035111 Bacteria 4072
233 Ga0373923_0188675 3300035111 Bacteria 949
234 Ga0373932_0007636 3300035112 Bacteria 2578
235 Ga0373932_0074181 3300035112 Bacteria 1062
236 Ga0373936_0064662 3300035113 Bacteria 1499
237 Ga0373939_0036425 3300035114 Bacteria 1455
238 Ga0373941_0007261 3300035115 Bacteria 2706
239 Ga0373945_0146034 3300035116 Bacteria 956
240 Ga0373953_0000270 3300035117 Bacteria 14188
241 Ga0373953_0038972 3300035117 Bacteria 1882
242 Ga0373953_0097242 3300035117 Bacteria 1236
243 Ga0373954_0000963 3300035118 Bacteria 11273
244 Ga0373954_0013865 3300035118 Bacteria 3593
245 Ga0373956_0000328 3300035119 Bacteria 19087
246 Ga0373956_0006785 3300035119 Bacteria 4591
247 Ga0373956_0006834 3300035119 Bacteria 4579
248 Ga0373957_0000203 3300035120 Bacteria 15228
249 Ga0373957_0002550 3300035120 Bacteria 5221
250 Ga0373957_0023821 3300035120 Bacteria 2192
251 Ga0373957_0070357 3300035120 Bacteria 1367
252 Ga0373960_0115849 3300035121 Bacteria 884
253 Ga0373943_0073705 3300035170 Bacteria 1734
254 Ga0373946_0008811 3300035171 Bacteria 3702
255 Ga0373955_0000024 3300035172 Bacteria 60102
256 Ga0373955_0028111 3300035172 Bacteria 2913
257 Ga0373955_0032055 3300035172 Bacteria 2755
258 Ga0373955_0039474 3300035172 Bacteria 2520
259 Ga0373942_0000437 3300035207 Bacteria 11648
260 Ga0373942_0040476 3300035207 Bacteria 1271
261 Ga0373961_0004281 3300035241 Bacteria 3456
262 Ga0373962_0066987 3300035242 Bacteria 1065
263 Ga0373924_0000562 3300035410 Bacteria 11432
264 Ga0373924_0015361 3300035410 Bacteria 2910
265 Ga0373924_0088825 3300035410 Bacteria 1320
266 Ga0373931_0207876 3300035691 Bacteria 1172
267 Ga0373935_0017285 3300035692 Bacteria 4374
268 Ga0373935_0029311 3300035692 Bacteria 3406
269 Ga0373935_0131923 3300035692 Bacteria 1679
270 Ga0373935_0353828 3300035692 Bacteria 1047
271 Ga0373933_0000153 3300035724 Bacteria 44821
272 Ga0373933_0006584 3300035724 Bacteria 6330
273 Ga0373947_0154365 3300035725 Bacteria 1480
274 Ga0373937_0000333 3300036401 Bacteria 44782
275 Ga0373937_0004325 3300036401 Bacteria 12051
276 Ga0373937_0094927 3300036401 Bacteria 2765
277 Ga0316584_0210830 3300036712 Bacteria 1430
278 Ga0373925_0010690 3300037068 Bacteria 6655
279 Ga0373925_0011433 3300037068 Bacteria 6428
280 Ga0373925_0144816 3300037068 Bacteria 1862
281 Ga0395899_0064228 3300037312 Bacteria 2699
282 Ga0395899_0097524 3300037312 Bacteria 2125
283 Ga0395900_0024817 3300037418 Bacteria 6136
284 Ga0395900_0033302 3300037418 Bacteria 5304
285 Ga0395900_0346494 3300037418 Bacteria 1460
286 Ga0395898_0038018 3300037466 Bacteria 4772
287 Ga0395898_0094652 3300037466 Bacteria 2871
288 Ga0395898_0120004 3300037466 Bacteria 2519
289 Ga0395905_0040635 3300037471 Bacteria 4363
290 Ga0395901_0045358 3300038443 Bacteria 4561
291 Ga0395901_0157075 3300038443 Bacteria 2389
292 Ga0400484_31873 3300038725 Bacteria 18535
293 Ga0400490_12830 3300038726 Bacteria 2174
294 Ga0400490_33722 3300038726 Bacteria 86861
295 Ga0400491_11198 3300038727 Bacteria 4537
296 Ga0400485_06848 3300038735 Unclassified 3801
297 Ga0400488_25331 3300038741 Bacteria 3002
298 Ga0400488_55730 3300038741 Bacteria 2613
299 Ga0400486_05863 3300038742 Bacteria 74939
300 Ga0400486_16702 3300038742 Bacteria 32581
301 Ga0400489_11382 3300039093 Bacteria 12435
302 Ga0436365_0298795 3300039437 Bacteria 4619
303 Ga0436365_1873403 3300039437 Bacteria 702
304 Ga0436363_0632637 3300039450 Bacteria 725
305 Ga0436363_1208389 3300039450 Bacteria 632
306 Ga0439436_0013256 3300041404 Bacteria 2495
307 Ga0439438_063712 3300041405 Bacteria 920
308 Ga0439449_0002778 3300042007 Bacteria 6804
309 Ga0439457_012549 3300042014 Bacteria 1909
310 Ga0439463_059187 3300042016 Bacteria 979
311 Ga0450906_033896 3300042145 Bacteria 902
312 Ga0450907_005944 3300042146 Bacteria 2048
313 Ga0439459_0021566 3300042438 Bacteria 1239
314 Ga0439459_0081129 3300042438 Bacteria 766
315 Ga0466969_0024280 3300044656 Bacteria 3118
316 Ga0466969_0044942 3300044656 Bacteria 2194
317 Ga0466972_0128237 3300044658 Bacteria 1195
318 Ga0466965_0117141 3300044683 Bacteria 1373
319 Ga0466966_0009536 3300044684 Bacteria 6426
320 Ga0466966_0010743 3300044684 Bacteria 6086
321 Ga0466966_0058635 3300044684 Bacteria 2433
322 Ga0466966_0078083 3300044684 Bacteria 2065
323 Ga0466966_0101495 3300044684 Bacteria 1779
324 Ga0466961_0016747 3300044693 Bacteria 4712
325 Ga0466961_0022970 3300044693 Bacteria 4012
326 Ga0466961_0036797 3300044693 Bacteria 3141
327 Ga0466961_0082949 3300044693 Bacteria 2027
328 Ga0466961_0254791 3300044693 Bacteria 1077
329 Ga0466963_0006979 3300044694 Bacteria 6722
330 Ga0466963_0017699 3300044694 Bacteria 4444
331 Ga0466963_0101707 3300044694 Bacteria 1968
332 Ga0466963_0284208 3300044694 Bacteria 1163
333 Ga0466963_0681429 3300044694 Bacteria 725
334 Ga0466963_0739755 3300044694 Bacteria 694
335 Ga0466964_0002467 3300044706 Bacteria 6574
336 Ga0466964_0064259 3300044706 Bacteria 1535
337 Ga0466964_0543531 3300044706 Bacteria 630
338 Ga0466971_0055535 3300044719 Bacteria 1785
339 Ga0466968_0038287 3300044735 Bacteria 2015
340 Ga0466968_0126894 3300044735 Bacteria 1158
341 Ga0466970_0047309 3300044765 Bacteria 2292
342 Ga0466970_0151682 3300044765 Bacteria 1279
343 Ga0466957_0020934 3300044842 Bacteria 3848
344 Ga0466957_0057509 3300044842 Bacteria 2380
345 Ga0466957_0084190 3300044842 Bacteria 1985
346 Ga0466957_0299103 3300044842 Bacteria 1081
347 Ga0466960_0096369 3300044901 Bacteria 1516
348 Ga0466960_0159690 3300044901 Bacteria 1209
349 Ga0466960_0191558 3300044901 Bacteria 1113
350 Ga0466960_0469049 3300044901 Bacteria 734
351 Ga0466960_0608031 3300044901 Bacteria 649
352 Ga0466959_0015491 3300045049 Bacteria 5555
353 Ga0466959_0096591 3300045049 Bacteria 2118
354 Ga0466959_0130224 3300045049 Bacteria 1783
355 Ga0466959_0186082 3300045049 Bacteria 1451
356 Ga0466959_0599207 3300045049 Bacteria 741
357 Ga0466958_0134424 3300045836 Bacteria 1554
358 Ga0466967_0003844 3300045976 Bacteria 9948
359 Ga0466967_0012928 3300045976 Bacteria 6419
360 Ga0466967_0061841 3300045976 Bacteria 3322
361 Ga0466967_0067289 3300045976 Bacteria 3195
362 Ga0466967_0071026 3300045976 Bacteria 3116
363 Ga0466967_0136212 3300045976 Bacteria 2284
364 Ga0466967_0343112 3300045976 Bacteria 1444
365 Ga0466967_0491417 3300045976 Bacteria 1203
366 Ga0495592_0001610 3300046454 Bacteria 15812
367 Ga0495592_0223785 3300046454 Bacteria 1256
368 Ga0495592_0497776 3300046454 Bacteria 756
369 Ga0495603_0080327 3300046455 Bacteria 1911
370 Ga0495629_0001760 3300046459 Bacteria 16982
371 Ga0495629_0010447 3300046459 Bacteria 6753
372 Ga0495638_0178870 3300046460 Bacteria 1212
373 Ga0495641_0072977 3300046461 Bacteria 1540
374 Ga0495651_0001169 3300046462 Bacteria 20282
375 Ga0495651_0193220 3300046462 Bacteria 1430
376 Ga0495653_0002881 3300046463 Bacteria 13759
377 Ga0495653_0052012 3300046463 Bacteria 3141
378 Ga0495653_0061573 3300046463 Bacteria 2839
379 Ga0495653_0063855 3300046463 Bacteria 2776
380 Ga0495580_0319368 3300046472 Bacteria 1055
381 Ga0495582_0004201 3300046473 Bacteria 8098
382 Ga0495639_0003255 3300046475 Bacteria 7053
383 Ga0495639_0172570 3300046475 Bacteria 1050
384 Ga0495662_0058462 3300046476 Bacteria 1862
385 Ga0495662_0090406 3300046476 Bacteria 1492
386 Ga0495664_0007153 3300046477 Bacteria 6184
387 Ga0495664_0029292 3300046477 Bacteria 3218
388 Ga0495594_0009701 3300046499 Bacteria 4981
389 Ga0495606_0004365 3300046507 Bacteria 14182
390 Ga0495608_0000101 3300046511 Bacteria 61678
391 Ga0495608_0290403 3300046511 Bacteria 1013
392 Ga0495618_0018008 3300046514 Bacteria 4335
393 Ga0495618_0021311 3300046514 Bacteria 3995
394 Ga0495618_0499236 3300046514 Bacteria 733
395 Ga0495628_0000327 3300046516 Bacteria 43068
396 Ga0495628_0018571 3300046516 Bacteria 5757
397 Ga0495628_0021056 3300046516 Bacteria 5370
398 Ga0495628_0130712 3300046516 Bacteria 1920
399 Ga0495630_0014076 3300046517 Bacteria 5821
400 Ga0495630_0101833 3300046517 Bacteria 2172
401 Ga0495630_0218608 3300046517 Bacteria 1454
402 Ga0495632_0013760 3300046519 Bacteria 4604
403 Ga0495666_0076415 3300046526 Bacteria 1587
404 Ga0495652_0000775 3300046529 Bacteria 36861
405 Ga0495652_0014267 3300046529 Bacteria 7133
406 Ga0495652_0237341 3300046529 Bacteria 1359
407 Ga0495652_0577920 3300046529 Bacteria 769
408 Ga0495665_0032561 3300046531 Bacteria 2788
409 Ga0495640_0045893 3300046533 Bacteria 3030
410 Ga0495640_0049188 3300046533 Bacteria 2909
411 Ga0495640_0249959 3300046533 Bacteria 1111
412 Ga0495586_0000770 3300046535 Bacteria 18403
413 Ga0495586_0017828 3300046535 Bacteria 3778
414 Ga0495586_0030252 3300046535 Bacteria 2897
415 Ga0495587_0000861 3300046536 Bacteria 20061
416 Ga0495587_0008620 3300046536 Bacteria 6554
417 Ga0495587_0063562 3300046536 Bacteria 2158
418 Ga0495587_0123226 3300046536 Bacteria 1484
419 Ga0495645_0023381 3300046543 Bacteria 4475
420 Ga0495645_0046362 3300046543 Bacteria 3168
421 Ga0495645_0087227 3300046543 Bacteria 2232
422 Ga0495645_0202481 3300046543 Bacteria 1345
423 Ga0495667_0000742 3300046559 Bacteria 20968
424 Ga0495667_0033214 3300046559 Bacteria 3453
425 Ga0495667_0183337 3300046559 Bacteria 1342
426 Ga0495668_0000464 3300046616 Bacteria 51784
427 Ga0495634_0022516 3300046642 Bacteria 4439
428 Ga0495634_0038005 3300046642 Bacteria 3284
429 Ga0495634_0118666 3300046642 Bacteria 1695
430 Ga0495625_0000677 3300046660 Bacteria 48654
431 Ga0495635_0079034 3300046663 Bacteria 2251
432 Ga0495635_0109729 3300046663 Bacteria 1885
433 Ga0495635_0153347 3300046663 Bacteria 1568
434 Ga0495657_0000156 3300046675 Bacteria 61702
435 Ga0495657_0007855 3300046675 Bacteria 8187
436 Ga0495657_0069628 3300046675 Bacteria 2301
437 Ga0495599_0000097 3300046678 Bacteria 61561
438 Ga0495599_0026425 3300046678 Bacteria 3637
439 Ga0495599_0043674 3300046678 Bacteria 2813
440 Ga0495623_0000471 3300046679 Bacteria 26602
441 Ga0495623_0009399 3300046679 Bacteria 6348
442 Ga0495623_0018208 3300046679 Bacteria 4535
443 Ga0495623_0028141 3300046679 Bacteria 3617
444 Ga0495646_0035868 3300046680 Bacteria 3073
445 Ga0495646_0076900 3300046680 Bacteria 1953
446 Ga0495646_0145612 3300046680 Bacteria 1321
447 Ga0495647_0056653 3300046681 Bacteria 1537
448 Ga0495658_0061558 3300046683 Bacteria 2155
449 Ga0495658_0244854 3300046683 Bacteria 1126
450 Ga0495613_0031742 3300046689 Bacteria 3923
451 Ga0495613_0050844 3300046689 Bacteria 3056
452 Ga0495624_0033878 3300046690 Bacteria 3307
453 Ga0495624_0084727 3300046690 Bacteria 1958
454 Ga0495600_0003272 3300046809 Bacteria 9490
455 Ga0495600_0025545 3300046809 Bacteria 3807
456 Ga0495581_0026136 3300047315 Bacteria 3386
457 Ga0495581_0037274 3300047315 Bacteria 2813
458 Ga0495604_0000196 3300047317 Bacteria 54755
459 Ga0495604_0060756 3300047317 Bacteria 2892
460 Ga0495604_0074011 3300047317 Bacteria 2568
461 Ga0495604_0126016 3300047317 Bacteria 1846
462 Ga0495674_0053174 3300047319 Bacteria 3561
463 Ga0495674_0329856 3300047319 Bacteria 1241
464 Ga0495674_0390578 3300047319 Bacteria 1124
465 Ga0495674_0439321 3300047319 Bacteria 1049
466 Ga0495676_0099553 3300047321 Bacteria 2154
467 Ga0495680_0000226 3300047322 Bacteria 61646
468 Ga0495680_0005150 3300047322 Bacteria 12342
469 Ga0495680_0007648 3300047322 Bacteria 9866
470 Ga0495680_0045310 3300047322 Bacteria 3472
471 Ga0495675_0123406 3300047444 Bacteria 1612
472 Ga0495593_0006917 3300047673 Bacteria 6641
473 Ga0495593_0019260 3300047673 Bacteria 3826
474 Ga0495602_0000172 3300048088 Bacteria 60316
475 Ga0495602_0098455 3300048088 Bacteria 2406
476 Ga0495602_0155447 3300048088 Bacteria 1791
477 Ga0495602_0166094 3300048088 Bacteria 1717
478 Ga0495602_0231577 3300048088 Bacteria 1387
479 Ga0495602_0351018 3300048088 Bacteria 1064
480 Ga0495614_0037965 3300048089 Bacteria 2067
481 Ga0495626_0000184 3300048091 Bacteria 76088
482 Ga0496100_0278882 3300048903 Bacteria 1245
483 Ga0496100_0588745 3300048903 Bacteria 863
484 Ga0496101_0095064 3300048904 Bacteria 2222
485 Ga0496102_0000072 3300048905 Bacteria 150284
486 Ga0496102_0047115 3300048905 Bacteria 3916
487 Ga0496102_0173364 3300048905 Bacteria 2031
488 Ga0496103_0000053 3300048906 Bacteria 148944
489 Ga0496104_0280085 3300048907 Bacteria 1580
490 Ga0496105_0023558 3300048908 Bacteria 4994
491 Ga0496105_0380095 3300048908 Bacteria 1124
492 Ga0496106_0119199 3300048909 Bacteria 2061
493 Ga0496106_0674089 3300048909 Bacteria 825
494 Ga0496107_0087690 3300048910 Bacteria 2272
495 Ga0496108_0000481 3300048911 Bacteria 31977
496 Ga0496108_0024605 3300048911 Bacteria 4958
497 Ga0496108_0098906 3300048911 Bacteria 2486
498 Ga0496108_0191748 3300048911 Bacteria 1771
499 Ga0496110_0381496 3300048913 Bacteria 1284
500 Ga0496111_0314933 3300048914 Bacteria 1159
501 Ga0496112_0539636 3300048915 Bacteria 1100
502 Ga0496114_0067157 3300048917 Bacteria 3008
503 Ga0496114_0071217 3300048917 Bacteria 2921
504 Ga0496115_0019992 3300048918 Bacteria 5159
505 Ga0496115_0036352 3300048918 Bacteria 3899
506 Ga0496117_0158894 3300048920 Bacteria 1327
507 Ga0496118_0019577 3300048921 Bacteria 6043
508 Ga0496119_0041354 3300048922 Bacteria 2936
509 Ga0496121_0028152 3300048924 Bacteria 5238
510 Ga0501031_0032757 3300049568 Bacteria 3389
511 Ga0501031_0203690 3300049568 Bacteria 1291
512 Ga0501032_0011504 3300049569 Bacteria 6356
513 Ga0501032_0058074 3300049569 Bacteria 2598
514 Ga0501033_0144188 3300049570 Bacteria 1721
515 Ga0501033_0177992 3300049570 Bacteria 1525
516 Ga0501034_0013123 3300049571 Bacteria 8539
517 Ga0501034_0083969 3300049571 Bacteria 3187
518 Ga0501036_0196314 3300049572 Bacteria 1698
519 Ga0501036_0308448 3300049572 Bacteria 1323
520 Ga0501037_0034880 3300049573 Bacteria 3711
521 Ga0501037_0122675 3300049573 Bacteria 1867
522 Ga0501038_0008112 3300049574 Bacteria 9665
523 Ga0501038_0076579 3300049574 Bacteria 2825
524 Ga0501039_0037135 3300049575 Bacteria 3760
525 Ga0501043_0017479 3300049579 Bacteria 5622
526 Ga0501043_0134383 3300049579 Bacteria 1938
527 Ga0501046_0047422 3300049580 Bacteria 3406
528 Ga0501046_0094453 3300049580 Bacteria 2298
529 Ga0501047_0013453 3300049581 Bacteria 7757
530 Ga0501047_0064555 3300049581 Bacteria 3531
531 Ga0501048_0000017 3300049582 Bacteria 72572
532 Ga0501048_0141628 3300049582 Bacteria 1700
533 Ga0501067_0272343 3300049583 Bacteria 943
534 Ga0501069_0057226 3300049585 Bacteria 2173
535 Ga0501070_0042575 3300049586 Bacteria 3782
536 Ga0501070_0211775 3300049586 Bacteria 1590
537 Ga0501073_0377847 3300049589 Bacteria 979
538 Ga0501074_0283539 3300049590 Bacteria 1177
539 Ga0501074_0532793 3300049590 Bacteria 832
540 Ga0501249_075606 3300049679 Bacteria 789
541 Ga0501080_0199188 3300049742 Bacteria 1839
542 Ga0501080_0368691 3300049742 Bacteria 1295
543 Ga0501035_0023468 3300049822 Bacteria 5658
544 Ga0501035_0043976 3300049822 Bacteria 4024
545 Ga0501035_0105015 3300049822 Bacteria 2477
546 Ga0501044_0005946 3300049823 Bacteria 13510
547 Ga0501044_0164545 3300049823 Bacteria 2193
548 Ga0501045_0314244 3300049824 Bacteria 1166
549 nmdc:mga0yw44_2602_c1 3300050492 Bacteria 7754
550 nmdc:mga07m45_43084_c1 3300050496 Bacteria 1525
551 nmdc:mga05p37_43016_c1 3300050507 Bacteria 5554
552 nmdc:mga05p37_452_c1 3300050507 Bacteria 44614
553 nmdc:mga05p37_542982_c1 3300050507 Bacteria 1325
554 nmdc:mga05p37_552421_c1 3300050507 Bacteria 1310
555 nmdc:mga06r32_21177_c1 3300050510 Bacteria 6000
556 nmdc:mga08y16_475396_c1 3300050511 Bacteria 1272
557 nmdc:mga0n895_26750_c1 3300050512 Bacteria 5470
558 nmdc:mga0n895_38113_c1 3300050512 Bacteria 4656
559 nmdc:mga0rr50_15996_c1 3300050513 Bacteria 4969
560 nmdc:mga0rr50_183657_c1 3300050513 Bacteria 1711
561 nmdc:mga0rr50_271477_c1 3300050513 Bacteria 1414
562 nmdc:mga08x19_138794_c1 3300050514 Bacteria 1641
563 nmdc:mga08x19_274502_c1 3300050514 Bacteria 1167
564 nmdc:mga08x19_485940_c1 3300050514 Bacteria 871
565 nmdc:mga0a205_141807_c1 3300050515 Bacteria 2303
566 Ga0495601_0013113 3300053077 Bacteria 4982
567 Ga0495612_0006591 3300053078 Bacteria 4765
568 Ga0495612_0016052 3300053078 Bacteria 3000
569 Ga0495612_0089296 3300053078 Bacteria 1302
570 Ga0495595_0010883 3300053084 Bacteria 3794
571 Ga0495595_0015075 3300053084 Bacteria 3291
572 Ga0495595_0026966 3300053084 Bacteria 2556
573 Ga0495619_0026732 3300053085 Bacteria 3714
574 Ga0495619_0124379 3300053085 Bacteria 1769
575 Ga0495619_0928503 3300053085 Bacteria 584
576 Ga0500644_0086478 3300053088 Bacteria 1164
577 Ga0500583_0257831 3300053092 Bacteria 860
578 Ga0500651_0053664 3300053093 Bacteria 2528
579 Ga0500641_0036683 3300053096 Bacteria 1962
580 Ga0500650_0279212 3300053098 Bacteria 743
581 Ga0500556_0054579 3300053104 Bacteria 1456
582 Ga0500559_0056050 3300053136 Bacteria 1749
583 Ga0500588_0211500 3300053146 Bacteria 721
584 Ga0500600_0144881 3300053149 Bacteria 1190
585 Ga0500630_020876 3300053159 Bacteria 3236
586 Ga0500634_0303527 3300053161 Bacteria 632
587 Ga0466962_0012605 3300061719 Bacteria 4067
588 Ga0466962_0250846 3300061719 Bacteria 870

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044706 Ga0466964_0543531 Ga0466964_0543531_114_620 148
2 3300044901 Ga0466960_0608031 Ga0466960_0608031_12_524 158
3 3300044656 Ga0466969_0024280 Ga0466969_0024280_2127_2702 161
4 3300044684 Ga0466966_0010743 Ga0466966_0010743_2617_3192 161
5 3300044693 Ga0466961_0016747 Ga0466961_0016747_1272_1847 161
6 3300045049 Ga0466959_0130224 Ga0466959_0130224_1031_1606 161
7 3300046476 Ga0495662_0058462 Ga0495662_0058462_1349_1849 165
8 3300005434 Ga0070709_10671431 Ga0070709_106714312 167
9 3300037466 Ga0395898_0120004 Ga0395898_0120004_1499_2092 167
10 3300038443 Ga0395901_0157075 Ga0395901_0157075_434_1027 167
11 3300044656 Ga0466969_0044942 Ga0466969_0044942_101_706 167
12 3300044658 Ga0466972_0128237 Ga0466972_0128237_560_1153 167
13 3300044684 Ga0466966_0058635 Ga0466966_0058635_1694_2287 167
14 3300044693 Ga0466961_0036797 Ga0466961_0036797_2515_3120 167
15 3300044694 Ga0466963_0101707 Ga0466963_0101707_127_720 167
16 3300044694 Ga0466963_0284208 Ga0466963_0284208_110_703 167
17 3300044694 Ga0466963_0739755 Ga0466963_0739755_53_646 167
18 3300044842 Ga0466957_0084190 Ga0466957_0084190_421_1014 167
19 3300044842 Ga0466957_0299103 Ga0466957_0299103_128_721 167
20 3300044901 Ga0466960_0191558 Ga0466960_0191558_389_982 167
21 3300044901 Ga0466960_0469049 Ga0466960_0469049_106_705 167
22 3300045049 Ga0466959_0599207 Ga0466959_0599207_44_649 167
23 3300045976 Ga0466967_0071026 Ga0466967_0071026_1341_1934 167
24 3300045976 Ga0466967_0491417 Ga0466967_0491417_219_812 167
25 3300048908 Ga0496105_0380095 Ga0496105_0380095_59_652 167
26 3300048911 Ga0496108_0024605 Ga0496108_0024605_1556_2149 167
27 3300061719 Ga0466962_0250846 Ga0466962_0250846_267_860 167
28 3300031995 Ga0307409_100285593 Ga0307409_1002855932 168
29 3300005338 Ga0068868_100842955 Ga0068868_1008429551 169
30 3300039437 Ga0436365_1873403 Ga0436365_1873403_13_588 169
31 3300045976 Ga0466967_0067289 Ga0466967_0067289_1838_2431 169
32 3300053085 Ga0495619_0928503 Ga0495619_0928503_11_553 169
33 3300044901 Ga0466960_0159690 Ga0466960_0159690_22_585 171
34 3300044684 Ga0466966_0078083 Ga0466966_0078083_1201_1791 174
35 3300005436 Ga0070713_100742457 Ga0070713_1007424572 175
36 3300005937 Ga0081455_10010822 Ga0081455_100108225 175
37 3300025928 Ga0207700_10550123 Ga0207700_105501232 175
38 3300009147 Ga0114129_10640809 Ga0114129_106408092 177
39 3300050507 nmdc:mga05p37_542982_c1 nmdc:mga05p37_542982_c1_103_669 177
40 3300005437 Ga0070710_10360189 Ga0070710_103601892 178
41 3300025928 Ga0207700_10007308 Ga0207700_100073082 178
42 3300035086 Ga0373934_0000159 Ga0373934_0000159_4644_5213 178
43 3300035111 Ga0373923_0006383 Ga0373923_0006383_3090_3659 178
44 3300035111 Ga0373923_0188675 Ga0373923_0188675_321_890 178
45 3300035116 Ga0373945_0146034 Ga0373945_0146034_115_684 178
46 3300035117 Ga0373953_0000270 Ga0373953_0000270_12389_12958 178
47 3300035118 Ga0373954_0000963 Ga0373954_0000963_5141_5710 178
48 3300035119 Ga0373956_0000328 Ga0373956_0000328_18400_18969 178
49 3300035120 Ga0373957_0000203 Ga0373957_0000203_785_1354 178
50 3300035120 Ga0373957_0023821 Ga0373957_0023821_229_798 178
51 3300035172 Ga0373955_0000024 Ga0373955_0000024_16859_17428 178
52 3300035172 Ga0373955_0032055 Ga0373955_0032055_607_1176 178
53 3300035410 Ga0373924_0000562 Ga0373924_0000562_7894_8463 178
54 3300035724 Ga0373933_0000153 Ga0373933_0000153_25852_26421 178
55 3300036401 Ga0373937_0000333 Ga0373937_0000333_1481_2050 178
56 3300037068 Ga0373925_0010690 Ga0373925_0010690_833_1402 178
57 3300038741 Ga0400488_55730 Ga0400488_55730_958_1530 178
58 3300046454 Ga0495592_0001610 Ga0495592_0001610_1361_1930 178
59 3300046454 Ga0495592_0497776 Ga0495592_0497776_81_650 178
60 3300046459 Ga0495629_0001760 Ga0495629_0001760_5250_5819 178
61 3300046462 Ga0495651_0001169 Ga0495651_0001169_1313_1882 178
62 3300046463 Ga0495653_0002881 Ga0495653_0002881_9193_9762 178
63 3300046463 Ga0495653_0063855 Ga0495653_0063855_1395_1964 178
64 3300046473 Ga0495582_0004201 Ga0495582_0004201_4538_5107 178
65 3300046475 Ga0495639_0003255 Ga0495639_0003255_2725_3294 178
66 3300046477 Ga0495664_0029292 Ga0495664_0029292_57_626 178
67 3300046511 Ga0495608_0000101 Ga0495608_0000101_42717_43286 178
68 3300046514 Ga0495618_0499236 Ga0495618_0499236_107_676 178
69 3300046516 Ga0495628_0000327 Ga0495628_0000327_24117_24686 178
70 3300046516 Ga0495628_0018571 Ga0495628_0018571_315_884 178
71 3300046517 Ga0495630_0218608 Ga0495630_0218608_794_1363 178
72 3300046529 Ga0495652_0000775 Ga0495652_0000775_22121_22690 178
73 3300046533 Ga0495640_0045893 Ga0495640_0045893_940_1509 178
74 3300046535 Ga0495586_0000770 Ga0495586_0000770_17018_17587 178
75 3300046536 Ga0495587_0000861 Ga0495587_0000861_1226_1795 178
76 3300046536 Ga0495587_0063562 Ga0495587_0063562_195_764 178
77 3300046543 Ga0495645_0023381 Ga0495645_0023381_464_1033 178
78 3300046559 Ga0495667_0000742 Ga0495667_0000742_5426_5995 178
79 3300046642 Ga0495634_0118666 Ga0495634_0118666_909_1478 178
80 3300046663 Ga0495635_0153347 Ga0495635_0153347_265_834 178
81 3300046675 Ga0495657_0000156 Ga0495657_0000156_18401_18970 178
82 3300046678 Ga0495599_0000097 Ga0495599_0000097_42610_43179 178
83 3300046679 Ga0495623_0000471 Ga0495623_0000471_11018_11587 178
84 3300046679 Ga0495623_0028141 Ga0495623_0028141_1109_1678 178
85 3300046680 Ga0495646_0076900 Ga0495646_0076900_1278_1847 178
86 3300046683 Ga0495658_0061558 Ga0495658_0061558_188_757 178
87 3300046689 Ga0495613_0031742 Ga0495613_0031742_265_834 178
88 3300046809 Ga0495600_0003272 Ga0495600_0003272_1473_2042 178
89 3300046809 Ga0495600_0025545 Ga0495600_0025545_919_1488 178
90 3300047315 Ga0495581_0037274 Ga0495581_0037274_1255_1824 178
91 3300047317 Ga0495604_0000196 Ga0495604_0000196_12702_13271 178
92 3300047317 Ga0495604_0060756 Ga0495604_0060756_1707_2276 178
93 3300047319 Ga0495674_0390578 Ga0495674_0390578_464_1033 178
94 3300047319 Ga0495674_0439321 Ga0495674_0439321_414_983 178
95 3300047322 Ga0495680_0000226 Ga0495680_0000226_18376_18945 178
96 3300047322 Ga0495680_0007648 Ga0495680_0007648_813_1382 178
97 3300047673 Ga0495593_0006917 Ga0495593_0006917_4566_5135 178
98 3300048088 Ga0495602_0000172 Ga0495602_0000172_18245_18814 178
99 3300048088 Ga0495602_0166094 Ga0495602_0166094_414_983 178
100 3300048088 Ga0495602_0351018 Ga0495602_0351018_464_1033 178
101 3300053078 Ga0495612_0006591 Ga0495612_0006591_1262_1831 178
102 3300053084 Ga0495595_0010883 Ga0495595_0010883_2012_2581 178
103 3300053084 Ga0495595_0015075 Ga0495595_0015075_2617_3186 178
104 3300053085 Ga0495619_0026732 Ga0495619_0026732_1337_1906 178
105 3300005468 Ga0070707_100110822 Ga0070707_1001108224 181
106 3300005468 Ga0070707_100335386 Ga0070707_1003353863 181
107 3300005518 Ga0070699_100216790 Ga0070699_1002167902 181
108 3300025910 Ga0207684_10408276 Ga0207684_104082762 181
109 3300025922 Ga0207646_10202794 Ga0207646_102027942 181
110 3300044719 Ga0466971_0055535 Ga0466971_0055535_128_739 181
111 3300045049 Ga0466959_0186082 Ga0466959_0186082_646_1257 181
112 3300005445 Ga0070708_100004503 Ga0070708_1000045039 182
113 3300005445 Ga0070708_100010420 Ga0070708_1000104207 182
114 3300005467 Ga0070706_100128241 Ga0070706_1001282412 182
115 3300025904 Ga0207647_10077625 Ga0207647_100776252 182
116 3300025910 Ga0207684_10216502 Ga0207684_102165022 182
117 3300025910 Ga0207684_10818875 Ga0207684_108188752 182
118 3300025922 Ga0207646_10048535 Ga0207646_100485355 182
119 3300048905 Ga0496102_0173364 Ga0496102_0173364_260_868 182
120 3300048913 Ga0496110_0381496 Ga0496110_0381496_277_885 182
121 3300048914 Ga0496111_0314933 Ga0496111_0314933_303_911 182
122 3300048917 Ga0496114_0067157 Ga0496114_0067157_372_980 182
123 3300048918 Ga0496115_0036352 Ga0496115_0036352_415_1023 182
124 3300049590 Ga0501074_0532793 Ga0501074_0532793_125_745 182
125 iso_pu_bacteria 2643221561 2643825603 182
126 iso_pu_bacteria 8053945823 8053947379 182
127 3300005445 Ga0070708_100022421 Ga0070708_1000224213 183
128 3300005467 Ga0070706_100006796 Ga0070706_1000067963 183
129 3300005467 Ga0070706_100072927 Ga0070706_1000729271 183
130 3300005468 Ga0070707_100010529 Ga0070707_10001052910 183
131 3300005468 Ga0070707_100362658 Ga0070707_1003626582 183
132 3300005468 Ga0070707_101015270 Ga0070707_1010152701 183
133 3300005471 Ga0070698_100123683 Ga0070698_1001236832 183
134 3300005518 Ga0070699_100059670 Ga0070699_1000596702 183
135 3300005548 Ga0070665_100279072 Ga0070665_1002790722 183
136 3300007076 Ga0075435_100107686 Ga0075435_1001076863 183
137 3300025910 Ga0207684_10006215 Ga0207684_100062153 183
138 3300025922 Ga0207646_10061737 Ga0207646_100617373 183
139 3300025922 Ga0207646_10110749 Ga0207646_101107493 183
140 3300025922 Ga0207646_10120398 Ga0207646_101203983 183
141 3300031665 Ga0316575_10038387 Ga0316575_100383872 183
142 3300035692 Ga0373935_0353828 Ga0373935_0353828_304_888 183
143 3300036712 Ga0316584_0210830 Ga0316584_0210830_231_833 183
144 3300038725 Ga0400484_31873 Ga0400484_31873_12376_12963 183
145 3300038726 Ga0400490_12830 Ga0400490_12830_733_1320 183
146 3300038726 Ga0400490_33722 Ga0400490_33722_18974_19606 183
147 3300038727 Ga0400491_11198 Ga0400491_11198_3842_4429 183
148 3300038735 Ga0400485_06848 Ga0400485_06848_1765_2352 183
149 3300038741 Ga0400488_25331 Ga0400488_25331_300_887 183
150 3300038742 Ga0400486_05863 Ga0400486_05863_38567_39157 183
151 3300038742 Ga0400486_16702 Ga0400486_16702_26615_27202 183
152 3300039093 Ga0400489_11382 Ga0400489_11382_7835_8422 183
153 3300046455 Ga0495603_0080327 Ga0495603_0080327_625_1209 183
154 3300046472 Ga0495580_0319368 Ga0495580_0319368_65_649 183
155 3300046499 Ga0495594_0009701 Ga0495594_0009701_2388_2972 183
156 3300046517 Ga0495630_0014076 Ga0495630_0014076_3147_3731 183
157 3300046531 Ga0495665_0032561 Ga0495665_0032561_1251_1835 183
158 3300046642 Ga0495634_0022516 Ga0495634_0022516_257_841 183
159 3300047321 Ga0495676_0099553 Ga0495676_0099553_143_727 183
160 3300047673 Ga0495593_0019260 Ga0495593_0019260_1951_2535 183
161 3300050515 nmdc:mga0a205_141807_c1 nmdc:mga0a205_141807_c1_1652_2275 183
162 3300005364 Ga0070673_100514352 Ga0070673_1005143521 184
163 3300005434 Ga0070709_10012583 Ga0070709_100125832 184
164 3300005435 Ga0070714_100012596 Ga0070714_10001259610 184
165 3300005436 Ga0070713_100064606 Ga0070713_1000646062 184
166 3300005436 Ga0070713_100179727 Ga0070713_1001797272 184
167 3300005436 Ga0070713_100446719 Ga0070713_1004467191 184
168 3300005437 Ga0070710_10000156 Ga0070710_1000015616 184
169 3300005439 Ga0070711_100001013 Ga0070711_1000010137 184
170 3300005440 Ga0070705_100108772 Ga0070705_1001087722 184
171 3300005445 Ga0070708_100009051 Ga0070708_1000090512 184
172 3300005445 Ga0070708_100622285 Ga0070708_1006222851 184
173 3300005467 Ga0070706_100002251 Ga0070706_10000225117 184
174 3300005467 Ga0070706_100011378 Ga0070706_1000113782 184
175 3300005467 Ga0070706_100089714 Ga0070706_1000897142 184
176 3300005468 Ga0070707_100001697 Ga0070707_10000169714 184
177 3300005468 Ga0070707_100004942 Ga0070707_10000494213 184
178 3300005468 Ga0070707_100007974 Ga0070707_1000079743 184
179 3300005471 Ga0070698_100003640 Ga0070698_1000036406 184
180 3300005471 Ga0070698_100102994 Ga0070698_1001029942 184
181 3300005536 Ga0070697_100028376 Ga0070697_1000283762 184
182 3300005563 Ga0068855_100250409 Ga0068855_1002504092 184
183 3300005983 Ga0081540_1001125 Ga0081540_100112515 184
184 3300006028 Ga0070717_10003117 Ga0070717_1000311712 184
185 3300006163 Ga0070715_10137568 Ga0070715_101375681 184
186 3300006163 Ga0070715_10189786 Ga0070715_101897862 184
187 3300006173 Ga0070716_100005401 Ga0070716_1000054011 184
188 3300006173 Ga0070716_100119323 Ga0070716_1001193232 184
189 3300006852 Ga0075433_10025524 Ga0075433_100255246 184
190 3300006852 Ga0075433_10173037 Ga0075433_101730372 184
191 3300006871 Ga0075434_100076453 Ga0075434_1000764533 184
192 3300006871 Ga0075434_100496438 Ga0075434_1004964382 184
193 3300006914 Ga0075436_100062217 Ga0075436_1000622171 184
194 3300006914 Ga0075436_100095378 Ga0075436_1000953782 184
195 3300007076 Ga0075435_100002359 Ga0075435_1000023597 184
196 3300007076 Ga0075435_100389071 Ga0075435_1003890712 184
197 3300007076 Ga0075435_100506953 Ga0075435_1005069532 184
198 3300009098 Ga0105245_10243814 Ga0105245_102438142 184
199 3300009147 Ga0114129_10009348 Ga0114129_100093482 184
200 3300009174 Ga0105241_10126179 Ga0105241_101261791 184
201 3300013296 Ga0157374_11151021 Ga0157374_111510211 184
202 3300025898 Ga0207692_10046850 Ga0207692_100468503 184
203 3300025898 Ga0207692_10123442 Ga0207692_101234422 184
204 3300025905 Ga0207685_10061489 Ga0207685_100614892 184
205 3300025906 Ga0207699_10000563 Ga0207699_1000056312 184
206 3300025906 Ga0207699_10042181 Ga0207699_100421815 184
207 3300025910 Ga0207684_10002393 Ga0207684_100023939 184
208 3300025910 Ga0207684_10003086 Ga0207684_1000308617 184
209 3300025911 Ga0207654_10237226 Ga0207654_102372261 184
210 3300025916 Ga0207663_10000822 Ga0207663_100008227 184
211 3300025916 Ga0207663_10001119 Ga0207663_100011192 184
212 3300025922 Ga0207646_10000470 Ga0207646_100004709 184
213 3300025922 Ga0207646_10015576 Ga0207646_100155765 184
214 3300025928 Ga0207700_10004933 Ga0207700_100049336 184
215 3300025928 Ga0207700_10025045 Ga0207700_100250454 184
216 3300025928 Ga0207700_10026702 Ga0207700_100267023 184
217 3300025928 Ga0207700_10788596 Ga0207700_107885961 184
218 3300025929 Ga0207664_10002078 Ga0207664_100020783 184
219 3300025929 Ga0207664_10022897 Ga0207664_100228971 184
220 3300025929 Ga0207664_10166928 Ga0207664_101669282 184
221 3300025939 Ga0207665_10000882 Ga0207665_100008827 184
222 3300025939 Ga0207665_10007304 Ga0207665_100073048 184
223 3300025949 Ga0207667_10258860 Ga0207667_102588602 184
224 3300026078 Ga0207702_10594613 Ga0207702_105946132 184
225 3300026121 Ga0207683_10622235 Ga0207683_106222351 184
226 3300034817 Ga0373948_0008068 Ga0373948_0008068_439_1026 184
227 3300034819 Ga0373958_0001609 Ga0373958_0001609_31_618 184
228 3300034820 Ga0373959_0008127 Ga0373959_0008127_556_1143 184
229 3300034957 Ga0373938_0008973 Ga0373938_0008973_813_1400 184
230 3300035085 Ga0373929_0003855 Ga0373929_0003855_1414_2001 184
231 3300035086 Ga0373934_0001926 Ga0373934_0001926_6414_7001 184
232 3300035086 Ga0373934_0026610 Ga0373934_0026610_606_1193 184
233 3300035088 Ga0373940_0006056 Ga0373940_0006056_161_748 184
234 3300035089 Ga0373944_0144923 Ga0373944_0144923_67_654 184
235 3300035090 Ga0373949_0014019 Ga0373949_0014019_128_715 184
236 3300035091 Ga0373951_0013850 Ga0373951_0013850_501_1088 184
237 3300035092 Ga0373952_0001767 Ga0373952_0001767_1457_2044 184
238 3300035112 Ga0373932_0007636 Ga0373932_0007636_255_842 184
239 3300035113 Ga0373936_0064662 Ga0373936_0064662_891_1478 184
240 3300035114 Ga0373939_0036425 Ga0373939_0036425_610_1197 184
241 3300035115 Ga0373941_0007261 Ga0373941_0007261_1884_2471 184
242 3300035117 Ga0373953_0038972 Ga0373953_0038972_765_1352 184
243 3300035117 Ga0373953_0097242 Ga0373953_0097242_445_1032 184
244 3300035118 Ga0373954_0013865 Ga0373954_0013865_2822_3409 184
245 3300035119 Ga0373956_0006785 Ga0373956_0006785_3307_3894 184
246 3300035119 Ga0373956_0006834 Ga0373956_0006834_2934_3521 184
247 3300035120 Ga0373957_0002550 Ga0373957_0002550_3749_4336 184
248 3300035120 Ga0373957_0070357 Ga0373957_0070357_600_1187 184
249 3300035121 Ga0373960_0115849 Ga0373960_0115849_33_620 184
250 3300035170 Ga0373943_0073705 Ga0373943_0073705_508_1095 184
251 3300035171 Ga0373946_0008811 Ga0373946_0008811_1853_2440 184
252 3300035172 Ga0373955_0028111 Ga0373955_0028111_949_1536 184
253 3300035172 Ga0373955_0039474 Ga0373955_0039474_1881_2468 184
254 3300035207 Ga0373942_0040476 Ga0373942_0040476_507_1094 184
255 3300035241 Ga0373961_0004281 Ga0373961_0004281_2316_2903 184
256 3300035242 Ga0373962_0066987 Ga0373962_0066987_451_1038 184
257 3300035410 Ga0373924_0015361 Ga0373924_0015361_160_747 184
258 3300035410 Ga0373924_0088825 Ga0373924_0088825_632_1219 184
259 3300035691 Ga0373931_0207876 Ga0373931_0207876_357_944 184
260 3300035692 Ga0373935_0029311 Ga0373935_0029311_1614_2201 184
261 3300035692 Ga0373935_0131923 Ga0373935_0131923_999_1586 184
262 3300035724 Ga0373933_0006584 Ga0373933_0006584_2301_2888 184
263 3300035725 Ga0373947_0154365 Ga0373947_0154365_851_1438 184
264 3300036401 Ga0373937_0004325 Ga0373937_0004325_3824_4411 184
265 3300036401 Ga0373937_0094927 Ga0373937_0094927_1524_2111 184
266 3300037068 Ga0373925_0011433 Ga0373925_0011433_621_1208 184
267 3300037068 Ga0373925_0144816 Ga0373925_0144816_173_760 184
268 3300039437 Ga0436365_0298795 Ga0436365_0298795_2882_3478 184
269 3300039450 Ga0436363_0632637 Ga0436363_0632637_62_649 184
270 3300044735 Ga0466968_0126894 Ga0466968_0126894_370_957 184
271 3300045049 Ga0466959_0096591 Ga0466959_0096591_463_1050 184
272 3300046454 Ga0495592_0223785 Ga0495592_0223785_500_1087 184
273 3300046459 Ga0495629_0010447 Ga0495629_0010447_5003_5590 184
274 3300046461 Ga0495641_0072977 Ga0495641_0072977_513_1100 184
275 3300046462 Ga0495651_0193220 Ga0495651_0193220_504_1091 184
276 3300046463 Ga0495653_0052012 Ga0495653_0052012_1180_1767 184
277 3300046463 Ga0495653_0061573 Ga0495653_0061573_1869_2456 184
278 3300046476 Ga0495662_0090406 Ga0495662_0090406_166_753 184
279 3300046477 Ga0495664_0007153 Ga0495664_0007153_5338_5925 184
280 3300046511 Ga0495608_0290403 Ga0495608_0290403_11_598 184
281 3300046514 Ga0495618_0018008 Ga0495618_0018008_3737_4324 184
282 3300046514 Ga0495618_0021311 Ga0495618_0021311_2221_2808 184
283 3300046516 Ga0495628_0021056 Ga0495628_0021056_2169_2756 184
284 3300046516 Ga0495628_0130712 Ga0495628_0130712_1131_1718 184
285 3300046517 Ga0495630_0101833 Ga0495630_0101833_340_927 184
286 3300046526 Ga0495666_0076415 Ga0495666_0076415_573_1160 184
287 3300046529 Ga0495652_0014267 Ga0495652_0014267_3367_3954 184
288 3300046529 Ga0495652_0237341 Ga0495652_0237341_130_717 184
289 3300046529 Ga0495652_0577920 Ga0495652_0577920_163_750 184
290 3300046533 Ga0495640_0049188 Ga0495640_0049188_1258_1845 184
291 3300046535 Ga0495586_0017828 Ga0495586_0017828_1612_2199 184
292 3300046535 Ga0495586_0030252 Ga0495586_0030252_949_1536 184
293 3300046536 Ga0495587_0008620 Ga0495587_0008620_3538_4125 184
294 3300046536 Ga0495587_0123226 Ga0495587_0123226_476_1063 184
295 3300046543 Ga0495645_0046362 Ga0495645_0046362_720_1307 184
296 3300046543 Ga0495645_0087227 Ga0495645_0087227_1383_1970 184
297 3300046543 Ga0495645_0202481 Ga0495645_0202481_295_882 184
298 3300046559 Ga0495667_0033214 Ga0495667_0033214_520_1107 184
299 3300046559 Ga0495667_0183337 Ga0495667_0183337_416_1003 184
300 3300046642 Ga0495634_0038005 Ga0495634_0038005_1633_2220 184
301 3300046663 Ga0495635_0079034 Ga0495635_0079034_340_927 184
302 3300046663 Ga0495635_0109729 Ga0495635_0109729_1164_1751 184
303 3300046675 Ga0495657_0007855 Ga0495657_0007855_6867_7454 184
304 3300046675 Ga0495657_0069628 Ga0495657_0069628_1375_1962 184
305 3300046678 Ga0495599_0026425 Ga0495599_0026425_2907_3494 184
306 3300046678 Ga0495599_0043674 Ga0495599_0043674_1058_1645 184
307 3300046679 Ga0495623_0009399 Ga0495623_0009399_339_926 184
308 3300046679 Ga0495623_0018208 Ga0495623_0018208_868_1455 184
309 3300046680 Ga0495646_0035868 Ga0495646_0035868_1009_1596 184
310 3300046680 Ga0495646_0145612 Ga0495646_0145612_388_975 184
311 3300046681 Ga0495647_0056653 Ga0495647_0056653_889_1476 184
312 3300046683 Ga0495658_0244854 Ga0495658_0244854_260_847 184
313 3300046689 Ga0495613_0050844 Ga0495613_0050844_1932_2519 184
314 3300046690 Ga0495624_0033878 Ga0495624_0033878_1859_2446 184
315 3300046690 Ga0495624_0084727 Ga0495624_0084727_878_1465 184
316 3300047315 Ga0495581_0026136 Ga0495581_0026136_2151_2738 184
317 3300047317 Ga0495604_0074011 Ga0495604_0074011_504_1091 184
318 3300047317 Ga0495604_0126016 Ga0495604_0126016_520_1107 184
319 3300047319 Ga0495674_0053174 Ga0495674_0053174_2040_2627 184
320 3300047319 Ga0495674_0329856 Ga0495674_0329856_148_735 184
321 3300047322 Ga0495680_0005150 Ga0495680_0005150_1892_2479 184
322 3300047322 Ga0495680_0045310 Ga0495680_0045310_331_918 184
323 3300047444 Ga0495675_0123406 Ga0495675_0123406_765_1352 184
324 3300048088 Ga0495602_0098455 Ga0495602_0098455_289_876 184
325 3300048088 Ga0495602_0155447 Ga0495602_0155447_575_1162 184
326 3300048088 Ga0495602_0231577 Ga0495602_0231577_515_1102 184
327 3300048089 Ga0495614_0037965 Ga0495614_0037965_659_1246 184
328 3300048903 Ga0496100_0278882 Ga0496100_0278882_587_1174 184
329 3300048904 Ga0496101_0095064 Ga0496101_0095064_410_997 184
330 3300048905 Ga0496102_0047115 Ga0496102_0047115_1269_1856 184
331 3300048907 Ga0496104_0280085 Ga0496104_0280085_848_1435 184
332 3300048908 Ga0496105_0023558 Ga0496105_0023558_505_1092 184
333 3300048909 Ga0496106_0119199 Ga0496106_0119199_1075_1662 184
334 3300048910 Ga0496107_0087690 Ga0496107_0087690_743_1330 184
335 3300048911 Ga0496108_0098906 Ga0496108_0098906_634_1221 184
336 3300048915 Ga0496112_0539636 Ga0496112_0539636_251_838 184
337 3300048917 Ga0496114_0071217 Ga0496114_0071217_1028_1615 184
338 3300048918 Ga0496115_0019992 Ga0496115_0019992_1609_2196 184
339 3300050507 nmdc:mga05p37_43016_c1 nmdc:mga05p37_43016_c1_565_1185 184
340 3300050511 nmdc:mga08y16_475396_c1 nmdc:mga08y16_475396_c1_347_967 184
341 3300050512 nmdc:mga0n895_26750_c1 nmdc:mga0n895_26750_c1_1379_1966 184
342 3300050512 nmdc:mga0n895_38113_c1 nmdc:mga0n895_38113_c1_219_806 184
343 3300050513 nmdc:mga0rr50_15996_c1 nmdc:mga0rr50_15996_c1_2245_2832 184
344 3300050513 nmdc:mga0rr50_183657_c1 nmdc:mga0rr50_183657_c1_483_1070 184
345 3300050513 nmdc:mga0rr50_271477_c1 nmdc:mga0rr50_271477_c1_216_836 184
346 3300050514 nmdc:mga08x19_138794_c1 nmdc:mga08x19_138794_c1_613_1233 184
347 3300050514 nmdc:mga08x19_274502_c1 nmdc:mga08x19_274502_c1_309_896 184
348 3300050514 nmdc:mga08x19_485940_c1 nmdc:mga08x19_485940_c1_171_758 184
349 3300053077 Ga0495601_0013113 Ga0495601_0013113_1735_2322 184
350 3300053078 Ga0495612_0016052 Ga0495612_0016052_421_1008 184
351 3300053078 Ga0495612_0089296 Ga0495612_0089296_569_1156 184
352 3300053084 Ga0495595_0026966 Ga0495595_0026966_47_634 184
353 3300053085 Ga0495619_0124379 Ga0495619_0124379_223_810 184
354 3300005445 Ga0070708_100508366 Ga0070708_1005083662 186
355 3300005467 Ga0070706_100640857 Ga0070706_1006408571 186
356 3300005468 Ga0070707_100090500 Ga0070707_1000905003 186
357 3300005468 Ga0070707_100283513 Ga0070707_1002835132 186
358 3300005518 Ga0070699_100858676 Ga0070699_1008586761 186
359 3300005614 Ga0068856_100148928 Ga0068856_1001489284 186
360 3300005614 Ga0068856_100246890 Ga0068856_1002468902 186
361 3300006038 Ga0075365_10045305 Ga0075365_100453053 186
362 3300009093 Ga0105240_10094884 Ga0105240_100948842 186
363 3300009147 Ga0114129_10119346 Ga0114129_101193464 186
364 3300009545 Ga0105237_10065060 Ga0105237_100650603 186
365 3300009551 Ga0105238_10284675 Ga0105238_102846751 186
366 3300020069 Ga0197907_10198624 Ga0197907_101986242 186
367 3300020082 Ga0206353_10600692 Ga0206353_106006924 186
368 3300025910 Ga0207684_10422838 Ga0207684_104228382 186
369 3300025913 Ga0207695_10254280 Ga0207695_102542801 186
370 3300025922 Ga0207646_10074591 Ga0207646_100745914 186
371 3300025922 Ga0207646_10214194 Ga0207646_102141943 186
372 3300025929 Ga0207664_10326266 Ga0207664_103262662 186
373 3300025929 Ga0207664_10651693 Ga0207664_106516932 186
374 3300025949 Ga0207667_10126269 Ga0207667_101262693 186
375 3300026078 Ga0207702_10116688 Ga0207702_101166882 186
376 3300026142 Ga0207698_10310033 Ga0207698_103100332 186
377 3300026142 Ga0207698_11328389 Ga0207698_113283891 186
378 3300031548 Ga0307408_100709644 Ga0307408_1007096442 186
379 3300031731 Ga0307405_10381253 Ga0307405_103812532 186
380 3300031824 Ga0307413_10577508 Ga0307413_105775081 186
381 3300031852 Ga0307410_10279010 Ga0307410_102790102 186
382 3300031901 Ga0307406_10275136 Ga0307406_102751362 186
383 3300031903 Ga0307407_10491035 Ga0307407_104910352 186
384 3300031995 Ga0307409_100105371 Ga0307409_1001053712 186
385 3300032004 Ga0307414_10372629 Ga0307414_103726292 186
386 3300032005 Ga0307411_10400730 Ga0307411_104007302 186
387 3300032126 Ga0307415_100307273 Ga0307415_1003072732 186
388 3300037418 Ga0395900_0346494 Ga0395900_0346494_724_1317 186
389 3300039450 Ga0436363_1208389 Ga0436363_1208389_16_609 186
390 3300044683 Ga0466965_0117141 Ga0466965_0117141_567_1178 186
391 3300044684 Ga0466966_0009536 Ga0466966_0009536_1692_2285 186
392 3300044684 Ga0466966_0101495 Ga0466966_0101495_766_1359 186
393 3300044693 Ga0466961_0022970 Ga0466961_0022970_3314_3907 186
394 3300044693 Ga0466961_0082949 Ga0466961_0082949_765_1358 186
395 3300044693 Ga0466961_0254791 Ga0466961_0254791_341_934 186
396 3300044694 Ga0466963_0006979 Ga0466963_0006979_269_868 186
397 3300044694 Ga0466963_0017699 Ga0466963_0017699_1420_2013 186
398 3300044694 Ga0466963_0681429 Ga0466963_0681429_22_615 186
399 3300044706 Ga0466964_0002467 Ga0466964_0002467_4043_4636 186
400 3300044706 Ga0466964_0064259 Ga0466964_0064259_283_876 186
401 3300044735 Ga0466968_0038287 Ga0466968_0038287_765_1358 186
402 3300044765 Ga0466970_0047309 Ga0466970_0047309_571_1164 186
403 3300044765 Ga0466970_0151682 Ga0466970_0151682_251_844 186
404 3300044842 Ga0466957_0020934 Ga0466957_0020934_2847_3440 186
405 3300044901 Ga0466960_0096369 Ga0466960_0096369_467_1060 186
406 3300045049 Ga0466959_0015491 Ga0466959_0015491_4622_5215 186
407 3300045836 Ga0466958_0134424 Ga0466958_0134424_298_891 186
408 3300045976 Ga0466967_0003844 Ga0466967_0003844_4569_5168 186
409 3300045976 Ga0466967_0012928 Ga0466967_0012928_830_1423 186
410 3300045976 Ga0466967_0061841 Ga0466967_0061841_195_788 186
411 3300045976 Ga0466967_0343112 Ga0466967_0343112_437_1030 186
412 3300046533 Ga0495640_0249959 Ga0495640_0249959_326_919 186
413 3300048911 Ga0496108_0191748 Ga0496108_0191748_492_1094 186
414 3300049568 Ga0501031_0032757 Ga0501031_0032757_1564_2157 186
415 3300049568 Ga0501031_0203690 Ga0501031_0203690_665_1276 186
416 3300049569 Ga0501032_0011504 Ga0501032_0011504_3591_4184 186
417 3300049570 Ga0501033_0144188 Ga0501033_0144188_1036_1641 186
418 3300049570 Ga0501033_0177992 Ga0501033_0177992_728_1321 186
419 3300049571 Ga0501034_0013123 Ga0501034_0013123_3643_4236 186
420 3300049572 Ga0501036_0308448 Ga0501036_0308448_42_635 186
421 3300049573 Ga0501037_0034880 Ga0501037_0034880_2488_3081 186
422 3300049574 Ga0501038_0008112 Ga0501038_0008112_2472_3065 186
423 3300049579 Ga0501043_0017479 Ga0501043_0017479_1746_2339 186
424 3300049580 Ga0501046_0094453 Ga0501046_0094453_256_849 186
425 3300049581 Ga0501047_0013453 Ga0501047_0013453_2892_3485 186
426 3300049582 Ga0501048_0000017 Ga0501048_0000017_64922_65515 186
427 3300049583 Ga0501067_0272343 Ga0501067_0272343_224_817 186
428 3300049586 Ga0501070_0042575 Ga0501070_0042575_396_989 186
429 3300049586 Ga0501070_0211775 Ga0501070_0211775_587_1201 186
430 3300049742 Ga0501080_0368691 Ga0501080_0368691_511_1104 186
431 3300049822 Ga0501035_0023468 Ga0501035_0023468_1139_1732 186
432 3300049822 Ga0501035_0105015 Ga0501035_0105015_461_1066 186
433 3300049823 Ga0501044_0005946 Ga0501044_0005946_2228_2821 186
434 3300049823 Ga0501044_0164545 Ga0501044_0164545_216_821 186
435 3300049824 Ga0501045_0314244 Ga0501045_0314244_329_922 186
436 3300050492 nmdc:mga0yw44_2602_c1 nmdc:mga0yw44_2602_c1_1858_2469 186
437 3300050496 nmdc:mga07m45_43084_c1 nmdc:mga07m45_43084_c1_254_865 186
438 3300061719 Ga0466962_0012605 Ga0466962_0012605_824_1417 186
439 iso_pu_bacteria 8056054917 8056055041 186
440 3300025900 Ga0207710_10018858 Ga0207710_100188582 187
441 3300048903 Ga0496100_0588745 Ga0496100_0588745_219_815 187
442 3300048905 Ga0496102_0000072 Ga0496102_0000072_67726_68322 187
443 3300048906 Ga0496103_0000053 Ga0496103_0000053_144529_145125 187
444 3300048909 Ga0496106_0674089 Ga0496106_0674089_175_771 187
445 3300048920 Ga0496117_0158894 Ga0496117_0158894_16_612 187
446 3300048921 Ga0496118_0019577 Ga0496118_0019577_936_1532 187
447 3300048922 Ga0496119_0041354 Ga0496119_0041354_2287_2883 187
448 3300048924 Ga0496121_0028152 Ga0496121_0028152_4537_5133 187
449 3300049679 Ga0501249_075606 Ga0501249_075606_163_756 187
450 3300053161 Ga0500634_0303527 Ga0500634_0303527_27_620 187
451 iso_pu_bacteria 2861520306 2861520943 187
452 iso_pu_bacteria 8057568493 8057568659 187
453 3300006847 Ga0075431_100042289 Ga0075431_1000422892 189
454 3300050510 nmdc:mga06r32_21177_c1 nmdc:mga06r32_21177_c1_1185_1787 189
455 iso_pu_bacteria 2501939600 2501944214 189
456 iso_pu_bacteria 2515154129 2515719166 189
457 iso_pu_bacteria 2515154202 2516083373 189
458 iso_pu_bacteria 2751185782 2753268277 189
459 iso_pu_bacteria 2831935698 2831936260 189
460 iso_pu_bacteria 2832004796 2832010483 189
461 iso_pu_bacteria 2855670206 2855676467 189
462 iso_pu_bacteria 2855676851 2855678611 189
463 iso_pu_bacteria 2855683550 2855684694 189
464 iso_pu_bacteria 2856858025 2856864452 189
465 iso_pu_bacteria 2857288857 2857294571 189
466 iso_pu_bacteria 2858848962 2858852049 189
467 iso_pu_bacteria 2858868258 2858872932 189
468 iso_pu_bacteria 2858882152 2858888695 189
469 iso_pu_bacteria 2858888857 2858888949 189
470 iso_pu_bacteria 2858895516 2858897457 189
471 iso_pu_bacteria 2858902515 2858905724 189
472 iso_pu_bacteria 2866065130 2866070292 189
473 iso_pu_bacteria 2867302475 2867303569 189
474 iso_pu_bacteria 2867312974 2867316078 189
475 iso_pu_bacteria 2867319477 2867320944 189
476 iso_pu_bacteria 2867507094 2867511803 189
477 iso_pu_bacteria 2869048445 2869050969 189
478 iso_pu_bacteria 2869061728 2869063641 189
479 iso_pu_bacteria 2869068681 2869074187 189
480 iso_pu_bacteria 2880489317 2880489713 189
481 iso_pu_bacteria 2880495981 2880495989 189
482 iso_pu_bacteria 2887478801 2887481173 189
483 iso_pu_bacteria 2902582711 2902583467 189
484 iso_pu_bacteria 2929219909 2929224663 189
485 iso_pu_bacteria 2929226422 2929232396 189
486 iso_pu_bacteria 2996221748 2996227602 189
487 iso_pu_bacteria 649633069 649814020 189
488 iso_pu_bacteria 8003830390 8003836143 189
489 iso_pu_bacteria 8003870546 8003873565 189
490 iso_pu_bacteria 8054704163 8054707802 189
491 iso_pu_bacteria 8054727385 8054732754 189
492 iso_pu_bacteria 8054734606 8054737972 189
493 iso_pu_bacteria 8055412473 8055413475 189
494 3300006844 Ga0075428_100000182 Ga0075428_10000018223 190
495 3300030731 Ga0316177_1122181 Ga0316177_11221812 190
496 3300030733 Ga0314311_1119181 Ga0314311_11191812 190
497 3300030744 Ga0316181_1275879 Ga0316181_12758793 190
498 3300031456 Ga0307513_10000001 Ga0307513_100000011296 190
499 3300041404 Ga0439436_0013256 Ga0439436_0013256_1086_1694 190
500 3300041405 Ga0439438_063712 Ga0439438_063712_138_746 190
501 3300042007 Ga0439449_0002778 Ga0439449_0002778_4822_5430 190
502 3300042014 Ga0439457_012549 Ga0439457_012549_573_1181 190
503 3300042145 Ga0450906_033896 Ga0450906_033896_65_673 190
504 3300042146 Ga0450907_005944 Ga0450907_005944_355_963 190
505 iso_pu_bacteria 2675903059 2676483589 190
506 3300005347 Ga0070668_100009783 Ga0070668_1000097834 192
507 3300009098 Ga0105245_11784200 Ga0105245_117842001 192
508 3300025972 Ga0207668_10003312 Ga0207668_100033126 192
509 3300037312 Ga0395899_0064228 Ga0395899_0064228_1875_2483 192
510 3300037418 Ga0395900_0024817 Ga0395900_0024817_5213_5821 192
511 3300037466 Ga0395898_0038018 Ga0395898_0038018_3463_4071 192
512 3300037471 Ga0395905_0040635 Ga0395905_0040635_2888_3496 192
513 3300038443 Ga0395901_0045358 Ga0395901_0045358_2823_3431 192
514 3300044842 Ga0466957_0057509 Ga0466957_0057509_774_1385 192
515 3300046507 Ga0495606_0004365 Ga0495606_0004365_1767_2390 192
516 3300046616 Ga0495668_0000464 Ga0495668_0000464_23821_24444 192
517 3300046660 Ga0495625_0000677 Ga0495625_0000677_27450_28073 192
518 3300048091 Ga0495626_0000184 Ga0495626_0000184_55246_55869 192
519 3300049569 Ga0501032_0058074 Ga0501032_0058074_765_1433 192
520 3300049571 Ga0501034_0083969 Ga0501034_0083969_1145_1813 192
521 3300049572 Ga0501036_0196314 Ga0501036_0196314_512_1180 192
522 3300049573 Ga0501037_0122675 Ga0501037_0122675_483_1151 192
523 3300049574 Ga0501038_0076579 Ga0501038_0076579_1279_1947 192
524 3300049575 Ga0501039_0037135 Ga0501039_0037135_2468_3136 192
525 3300049579 Ga0501043_0134383 Ga0501043_0134383_1055_1723 192
526 3300049580 Ga0501046_0047422 Ga0501046_0047422_1041_1709 192
527 3300049581 Ga0501047_0064555 Ga0501047_0064555_1115_1783 192
528 3300049582 Ga0501048_0141628 Ga0501048_0141628_149_817 192
529 3300049585 Ga0501069_0057226 Ga0501069_0057226_340_1008 192
530 3300049589 Ga0501073_0377847 Ga0501073_0377847_16_684 192
531 3300049590 Ga0501074_0283539 Ga0501074_0283539_132_800 192
532 3300049742 Ga0501080_0199188 Ga0501080_0199188_145_813 192
533 3300049822 Ga0501035_0043976 Ga0501035_0043976_1203_1871 192
534 3300003203 JGI25406J46586_10042849 JGI25406J46586_100428491 193
535 3300003203 JGI25406J46586_10080278 JGI25406J46586_100802782 193
536 3300005338 Ga0068868_100199682 Ga0068868_1001996822 193
537 3300005355 Ga0070671_100184760 Ga0070671_1001847601 193
538 3300005367 Ga0070667_100059665 Ga0070667_1000596655 193
539 3300005455 Ga0070663_100784821 Ga0070663_1007848211 193
540 3300005530 Ga0070679_100522648 Ga0070679_1005226481 193
541 3300005548 Ga0070665_100620283 Ga0070665_1006202832 193
542 3300005548 Ga0070665_101125307 Ga0070665_1011253072 193
543 3300005617 Ga0068859_100104853 Ga0068859_1001048534 193
544 3300005841 Ga0068863_100087639 Ga0068863_1000876393 193
545 3300005843 Ga0068860_100042129 Ga0068860_1000421295 193
546 3300005844 Ga0068862_100062137 Ga0068862_1000621376 193
547 3300005937 Ga0081455_10183459 Ga0081455_101834591 193
548 3300005985 Ga0081539_10000385 Ga0081539_1000038579 193
549 3300005985 Ga0081539_10000406 Ga0081539_1000040631 193
550 3300005985 Ga0081539_10001654 Ga0081539_1000165421 193
551 3300005985 Ga0081539_10004523 Ga0081539_100045235 193
552 3300005985 Ga0081539_10022628 Ga0081539_100226281 193
553 3300005985 Ga0081539_10027574 Ga0081539_100275744 193
554 3300006237 Ga0097621_100616732 Ga0097621_1006167322 193
555 3300006847 Ga0075431_100438078 Ga0075431_1004380782 193
556 3300006931 Ga0097620_100104854 Ga0097620_1001048544 193
557 3300009092 Ga0105250_10214143 Ga0105250_102141432 193
558 3300009098 Ga0105245_11002780 Ga0105245_110027802 193
559 3300009147 Ga0114129_10000744 Ga0114129_1000074436 193
560 3300009545 Ga0105237_10836927 Ga0105237_108369273 193
561 3300010375 Ga0105239_10967987 Ga0105239_109679873 193
562 3300013297 Ga0157378_10293501 Ga0157378_102935013 193
563 3300014968 Ga0157379_10347953 Ga0157379_103479533 193
564 3300025908 Ga0207643_10301319 Ga0207643_103013192 193
565 3300025909 Ga0207705_10508098 Ga0207705_105080982 193
566 3300025918 Ga0207662_10232618 Ga0207662_102326182 193
567 3300025925 Ga0207650_10612055 Ga0207650_106120552 193
568 3300025960 Ga0207651_10919248 Ga0207651_109192481 193
569 3300025986 Ga0207658_10036320 Ga0207658_100363202 193
570 3300026035 Ga0207703_10214162 Ga0207703_102141622 193
571 3300026088 Ga0207641_10480478 Ga0207641_104804782 193
572 3300026118 Ga0207675_100466336 Ga0207675_1004663362 193
573 3300026121 Ga0207683_10338448 Ga0207683_103384482 193
574 3300028380 Ga0268265_10093589 Ga0268265_100935892 193
575 3300028381 Ga0268264_10082729 Ga0268264_100827293 193
576 3300028786 Ga0307517_10084573 Ga0307517_100845736 193
577 3300028786 Ga0307517_10237093 Ga0307517_102370932 193
578 3300028794 Ga0307515_10002200 Ga0307515_1000220033 193
579 3300028794 Ga0307515_10010401 Ga0307515_100104013 193
580 3300030522 Ga0307512_10004194 Ga0307512_100041946 193
581 3300030522 Ga0307512_10004480 Ga0307512_100044806 193
582 3300031456 Ga0307513_10023131 Ga0307513_100231314 193
583 3300031456 Ga0307513_10046108 Ga0307513_100461084 193
584 3300031507 Ga0307509_10002147 Ga0307509_100021476 193
585 3300031507 Ga0307509_10248430 Ga0307509_102484302 193
586 3300031548 Ga0307408_100013342 Ga0307408_1000133424 193
587 3300031616 Ga0307508_10001138 Ga0307508_1000113813 193
588 3300031616 Ga0307508_10005883 Ga0307508_100058834 193
589 3300031616 Ga0307508_10108590 Ga0307508_101085902 193
590 3300031730 Ga0307516_10079584 Ga0307516_100795843 193
591 3300031730 Ga0307516_10100183 Ga0307516_101001831 193
592 3300031852 Ga0307410_10111168 Ga0307410_101111684 193
593 3300031852 Ga0307410_10179954 Ga0307410_101799542 193
594 3300031889 Ga0326468_10000912 Ga0326468_100009122 193
595 3300031995 Ga0307409_100013557 Ga0307409_1000135577 193
596 3300032002 Ga0307416_100051915 Ga0307416_1000519153 193
597 3300032005 Ga0307411_10141253 Ga0307411_101412533 193
598 3300032126 Ga0307415_100113398 Ga0307415_1001133982 193
599 3300032126 Ga0307415_100360078 Ga0307415_1003600782 193
600 3300033179 Ga0307507_10093132 Ga0307507_100931323 193
601 3300033179 Ga0307507_10162155 Ga0307507_101621552 193
602 3300033180 Ga0307510_10186421 Ga0307510_101864214 193
603 3300034817 Ga0373948_0014954 Ga0373948_0014954_220_831 193
604 3300034818 Ga0373950_0047944 Ga0373950_0047944_95_706 193
605 3300034957 Ga0373938_0020761 Ga0373938_0020761_304_915 193
606 3300035088 Ga0373940_0011319 Ga0373940_0011319_527_1138 193
607 3300035091 Ga0373951_0000194 Ga0373951_0000194_13163_13774 193
608 3300035112 Ga0373932_0074181 Ga0373932_0074181_66_677 193
609 3300035207 Ga0373942_0000437 Ga0373942_0000437_1375_1986 193
610 3300035692 Ga0373935_0017285 Ga0373935_0017285_3751_4362 193
611 3300037312 Ga0395899_0097524 Ga0395899_0097524_756_1367 193
612 3300037418 Ga0395900_0033302 Ga0395900_0033302_790_1401 193
613 3300037466 Ga0395898_0094652 Ga0395898_0094652_1021_1632 193
614 3300042016 Ga0439463_059187 Ga0439463_059187_39_650 193
615 3300042438 Ga0439459_0021566 Ga0439459_0021566_115_726 193
616 3300042438 Ga0439459_0081129 Ga0439459_0081129_119_733 193
617 3300045976 Ga0466967_0136212 Ga0466967_0136212_432_1043 193
618 3300046460 Ga0495638_0178870 Ga0495638_0178870_117_728 193
619 3300046475 Ga0495639_0172570 Ga0495639_0172570_386_997 193
620 3300046519 Ga0495632_0013760 Ga0495632_0013760_1221_1832 193
621 3300048911 Ga0496108_0000481 Ga0496108_0000481_3489_4100 193
622 3300050507 nmdc:mga05p37_452_c1 nmdc:mga05p37_452_c1_3166_3777 193
623 3300050507 nmdc:mga05p37_552421_c1 nmdc:mga05p37_552421_c1_13_639 193
624 3300053088 Ga0500644_0086478 Ga0500644_0086478_223_834 193
625 3300053092 Ga0500583_0257831 Ga0500583_0257831_76_687 193
626 3300053093 Ga0500651_0053664 Ga0500651_0053664_440_1051 193
627 3300053096 Ga0500641_0036683 Ga0500641_0036683_336_947 193
628 3300053098 Ga0500650_0279212 Ga0500650_0279212_48_659 193
629 3300053104 Ga0500556_0054579 Ga0500556_0054579_166_777 193
630 3300053136 Ga0500559_0056050 Ga0500559_0056050_295_906 193
631 3300053146 Ga0500588_0211500 Ga0500588_0211500_15_626 193
632 3300053149 Ga0500600_0144881 Ga0500600_0144881_500_1111 193
633 3300053159 Ga0500630_020876 Ga0500630_020876_922_1533 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

51

202

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ae8-assembly1.cif.gz_B crystal structure of imidazoleglycerol-phosphate dehydratase from staphylococcus aureus subsp. aureus n315 0.8472 5 178
2ae8-assembly1.cif.gz_E crystal structure of imidazoleglycerol-phosphate dehydratase from staphylococcus aureus subsp. aureus n315 0.8413 5 178
2ae8-assembly1.cif.gz_B crystal structure of imidazoleglycerol-phosphate dehydratase from staphylococcus aureus subsp. aureus n315 0.8376 5 178
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.835 3 180
2ae8-assembly1.cif.gz_E crystal structure of imidazoleglycerol-phosphate dehydratase from staphylococcus aureus subsp. aureus n315 0.8317 5 178
ID Description Score Start End Superfamily
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9389 81 180 3.30.230.40
2ae8A02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.935 81 178 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9293 81 180 3.30.230.40
2ae8A02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9251 81 178 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9011 81 175 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A7R8WT62-F1-model_v4 Uncharacterized protein 0.9777 68 147 GO:0000105
GO:0004424
AF-A0A7C6DMZ1-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9776 22 140 GO:0000105
GO:0004424
AF-A0A534ZHA0-F1-model_v4 Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) 0.9747 45 143 GO:0000105
GO:0004424
AF-A0A378VWE9-F1-model_v4 Imidazoleglycerol-phosphate dehydratase (IGPD) (EC 4.2.1.19) 0.9741 31 137 GO:0000105
GO:0004424
AF-A0A3D2R5Q6-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9739 28 137 GO:0000105
GO:0004424

Feature Viewer

pLDDT pTM Quality
84.03 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map