F471114
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 633 | 343 | 588 | 197 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0058074|Ga0501032_0058074_765_1433 |
| Length | 222 |
| Sequence | VNRRADPESRSEREPAELRMTRTARVERTTGETKVLVEIDLDGTGGADVATGVGFFDHMLNQLAKHGGFGLVVHTVGDLDIDAHHTLEDTAIALGQAFAAALGDKAGIQRFGDAVVPLDEALVQAVVDLSGRAYVVHDEPADLAPMIGPQYPTSMTRHIWESFGNNAKMTLHVNVLRGARPGQRPDAHHVVEAQFKAVARALRQAVTADPRGGGVPSTKGLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 3 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 4 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 5 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 6 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 7 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 8 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 9 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 10 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 11 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 12 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 13 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 14 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 15 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 16 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 17 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 18 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 19 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 20 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 21 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 22 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 23 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 24 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 25 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 26 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 27 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 28 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 29 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 30 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 31 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 32 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 33 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 34 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 35 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 36 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 121 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 122 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 123 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 124 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 125 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 126 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 127 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 128 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 129 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 130 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 131 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 132 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 134 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 135 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 136 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 137 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 138 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 139 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 140 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 141 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 142 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 143 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 144 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 145 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 146 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 147 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 148 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 149 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 150 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 151 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 155 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 156 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 157 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 160 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 161 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 167 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 174 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 188 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 189 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 190 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 191 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 192 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 193 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 196 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 197 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 198 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 199 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 200 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 201 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 202 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 203 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 204 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 205 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 206 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 207 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 208 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 209 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 210 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 211 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 212 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 213 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 216 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 217 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 284 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 285 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 286 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 287 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 324 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 325 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 326 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 327 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 328 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 329 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 330 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 331 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 332 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 333 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 334 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 335 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 336 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 337 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 338 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 339 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 340 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 341 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 342 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 343 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.58 |
| Metatranscriptomes | 0.32 |
| Isolates | 7.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.21 |
| Nodule | 0.95 |
| Rhizoplane | 3.79 |
| Rhizosphere | 82.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10042849 | 3300003203 | Bacteria | 1580 |
| 2 | JGI25406J46586_10080278 | 3300003203 | Bacteria | 1002 |
| 3 | Ga0068868_100199682 | 3300005338 | Bacteria | 1667 |
| 4 | Ga0068868_100842955 | 3300005338 | Bacteria | 830 |
| 5 | Ga0070668_100009783 | 3300005347 | Bacteria | 7107 |
| 6 | Ga0070671_100184760 | 3300005355 | Bacteria | 1766 |
| 7 | Ga0070673_100514352 | 3300005364 | Bacteria | 1084 |
| 8 | Ga0070667_100059665 | 3300005367 | Bacteria | 3228 |
| 9 | Ga0070709_10012583 | 3300005434 | Bacteria | 4738 |
| 10 | Ga0070709_10671431 | 3300005434 | Bacteria | 804 |
| 11 | Ga0070714_100012596 | 3300005435 | Bacteria | 6753 |
| 12 | Ga0070713_100064606 | 3300005436 | Bacteria | 3072 |
| 13 | Ga0070713_100179727 | 3300005436 | Bacteria | 1900 |
| 14 | Ga0070713_100446719 | 3300005436 | Bacteria | 1214 |
| 15 | Ga0070713_100742457 | 3300005436 | Bacteria | 939 |
| 16 | Ga0070710_10000156 | 3300005437 | Bacteria | 31483 |
| 17 | Ga0070710_10360189 | 3300005437 | Bacteria | 965 |
| 18 | Ga0070711_100001013 | 3300005439 | Bacteria | 14930 |
| 19 | Ga0070705_100108772 | 3300005440 | Bacteria | 1766 |
| 20 | Ga0070708_100004503 | 3300005445 | Bacteria | 10962 |
| 21 | Ga0070708_100009051 | 3300005445 | Bacteria | 8031 |
| 22 | Ga0070708_100010420 | 3300005445 | Bacteria | 7534 |
| 23 | Ga0070708_100022421 | 3300005445 | Bacteria | 5357 |
| 24 | Ga0070708_100508366 | 3300005445 | Bacteria | 1136 |
| 25 | Ga0070708_100622285 | 3300005445 | Bacteria | 1018 |
| 26 | Ga0070663_100784821 | 3300005455 | Bacteria | 816 |
| 27 | Ga0070706_100002251 | 3300005467 | Bacteria | 19550 |
| 28 | Ga0070706_100006796 | 3300005467 | Bacteria | 10798 |
| 29 | Ga0070706_100011378 | 3300005467 | Bacteria | 8269 |
| 30 | Ga0070706_100072927 | 3300005467 | Bacteria | 3177 |
| 31 | Ga0070706_100089714 | 3300005467 | Bacteria | 2851 |
| 32 | Ga0070706_100128241 | 3300005467 | Bacteria | 2367 |
| 33 | Ga0070706_100640857 | 3300005467 | Bacteria | 986 |
| 34 | Ga0070707_100001697 | 3300005468 | Bacteria | 21256 |
| 35 | Ga0070707_100004942 | 3300005468 | Bacteria | 12489 |
| 36 | Ga0070707_100007974 | 3300005468 | Bacteria | 9836 |
| 37 | Ga0070707_100010529 | 3300005468 | Bacteria | 8616 |
| 38 | Ga0070707_100090500 | 3300005468 | Bacteria | 2961 |
| 39 | Ga0070707_100110822 | 3300005468 | Bacteria | 2662 |
| 40 | Ga0070707_100283513 | 3300005468 | Bacteria | 1610 |
| 41 | Ga0070707_100335386 | 3300005468 | Bacteria | 1469 |
| 42 | Ga0070707_100362658 | 3300005468 | Bacteria | 1408 |
| 43 | Ga0070707_101015270 | 3300005468 | Bacteria | 795 |
| 44 | Ga0070698_100003640 | 3300005471 | Bacteria | 16926 |
| 45 | Ga0070698_100102994 | 3300005471 | Bacteria | 2825 |
| 46 | Ga0070698_100123683 | 3300005471 | Bacteria | 2545 |
| 47 | Ga0070699_100059670 | 3300005518 | Bacteria | 3304 |
| 48 | Ga0070699_100216790 | 3300005518 | Bacteria | 1705 |
| 49 | Ga0070699_100858676 | 3300005518 | Bacteria | 831 |
| 50 | Ga0070679_100522648 | 3300005530 | Bacteria | 1131 |
| 51 | Ga0070697_100028376 | 3300005536 | Bacteria | 4481 |
| 52 | Ga0070665_100279072 | 3300005548 | Bacteria | 1672 |
| 53 | Ga0070665_100620283 | 3300005548 | Bacteria | 1094 |
| 54 | Ga0070665_101125307 | 3300005548 | Bacteria | 796 |
| 55 | Ga0068855_100250409 | 3300005563 | Bacteria | 1976 |
| 56 | Ga0068856_100148928 | 3300005614 | Bacteria | 2349 |
| 57 | Ga0068856_100246890 | 3300005614 | Bacteria | 1800 |
| 58 | Ga0068859_100104853 | 3300005617 | Bacteria | 2887 |
| 59 | Ga0068863_100087639 | 3300005841 | Bacteria | 2950 |
| 60 | Ga0068860_100042129 | 3300005843 | Bacteria | 4363 |
| 61 | Ga0068862_100062137 | 3300005844 | Bacteria | 3212 |
| 62 | Ga0081455_10010822 | 3300005937 | Bacteria | 9216 |
| 63 | Ga0081455_10183459 | 3300005937 | Bacteria | 1582 |
| 64 | Ga0081540_1001125 | 3300005983 | Bacteria | 23625 |
| 65 | Ga0081539_10000385 | 3300005985 | Bacteria | 95511 |
| 66 | Ga0081539_10000406 | 3300005985 | Bacteria | 91786 |
| 67 | Ga0081539_10001654 | 3300005985 | Bacteria | 36124 |
| 68 | Ga0081539_10004523 | 3300005985 | Bacteria | 15270 |
| 69 | Ga0081539_10022628 | 3300005985 | Bacteria | 4149 |
| 70 | Ga0081539_10027574 | 3300005985 | Bacteria | 3593 |
| 71 | Ga0070717_10003117 | 3300006028 | Bacteria | 11832 |
| 72 | Ga0075365_10045305 | 3300006038 | Bacteria | 2885 |
| 73 | Ga0070715_10137568 | 3300006163 | Bacteria | 1182 |
| 74 | Ga0070715_10189786 | 3300006163 | Bacteria | 1037 |
| 75 | Ga0070716_100005401 | 3300006173 | Bacteria | 6185 |
| 76 | Ga0070716_100119323 | 3300006173 | Bacteria | 1648 |
| 77 | Ga0097621_100616732 | 3300006237 | Bacteria | 993 |
| 78 | Ga0075428_100000182 | 3300006844 | Bacteria | 58871 |
| 79 | Ga0075431_100042289 | 3300006847 | Bacteria | 4699 |
| 80 | Ga0075431_100438078 | 3300006847 | Bacteria | 1304 |
| 81 | Ga0075433_10025524 | 3300006852 | Bacteria | 4996 |
| 82 | Ga0075433_10173037 | 3300006852 | Bacteria | 1921 |
| 83 | Ga0075434_100076453 | 3300006871 | Bacteria | 3343 |
| 84 | Ga0075434_100496438 | 3300006871 | Bacteria | 1241 |
| 85 | Ga0075436_100062217 | 3300006914 | Bacteria | 2580 |
| 86 | Ga0075436_100095378 | 3300006914 | Bacteria | 2069 |
| 87 | Ga0097620_100104854 | 3300006931 | Bacteria | 2887 |
| 88 | Ga0075435_100002359 | 3300007076 | Bacteria | 12518 |
| 89 | Ga0075435_100107686 | 3300007076 | Bacteria | 2315 |
| 90 | Ga0075435_100389071 | 3300007076 | Bacteria | 1198 |
| 91 | Ga0075435_100506953 | 3300007076 | Bacteria | 1043 |
| 92 | Ga0105250_10214143 | 3300009092 | Bacteria | 815 |
| 93 | Ga0105240_10094884 | 3300009093 | Bacteria | 3638 |
| 94 | Ga0105245_10243814 | 3300009098 | Bacteria | 1743 |
| 95 | Ga0105245_11002780 | 3300009098 | Bacteria | 879 |
| 96 | Ga0105245_11784200 | 3300009098 | Bacteria | 668 |
| 97 | Ga0114129_10000744 | 3300009147 | Bacteria | 41358 |
| 98 | Ga0114129_10009348 | 3300009147 | Bacteria | 13979 |
| 99 | Ga0114129_10119346 | 3300009147 | Bacteria | 3632 |
| 100 | Ga0114129_10640809 | 3300009147 | Bacteria | 1372 |
| 101 | Ga0105241_10126179 | 3300009174 | Bacteria | 2067 |
| 102 | Ga0105237_10065060 | 3300009545 | Bacteria | 3643 |
| 103 | Ga0105237_10836927 | 3300009545 | Bacteria | 927 |
| 104 | Ga0105238_10284675 | 3300009551 | Bacteria | 1635 |
| 105 | Ga0105239_10967987 | 3300010375 | Bacteria | 978 |
| 106 | Ga0157374_11151021 | 3300013296 | Bacteria | 797 |
| 107 | Ga0157378_10293501 | 3300013297 | Bacteria | 1571 |
| 108 | Ga0157379_10347953 | 3300014968 | Bacteria | 1356 |
| 109 | Ga0197907_10198624 | 3300020069 | Bacteria | 1484 |
| 110 | Ga0206353_10600692 | 3300020082 | Bacteria | 5401 |
| 111 | Ga0207692_10046850 | 3300025898 | Bacteria | 2169 |
| 112 | Ga0207692_10123442 | 3300025898 | Bacteria | 1453 |
| 113 | Ga0207710_10018858 | 3300025900 | Bacteria | 2937 |
| 114 | Ga0207647_10077625 | 3300025904 | Bacteria | 1996 |
| 115 | Ga0207685_10061489 | 3300025905 | Bacteria | 1489 |
| 116 | Ga0207699_10000563 | 3300025906 | Bacteria | 18306 |
| 117 | Ga0207699_10042181 | 3300025906 | Bacteria | 2641 |
| 118 | Ga0207643_10301319 | 3300025908 | Bacteria | 997 |
| 119 | Ga0207705_10508098 | 3300025909 | Bacteria | 936 |
| 120 | Ga0207684_10002393 | 3300025910 | Bacteria | 18981 |
| 121 | Ga0207684_10003086 | 3300025910 | Bacteria | 16463 |
| 122 | Ga0207684_10006215 | 3300025910 | Bacteria | 10905 |
| 123 | Ga0207684_10216502 | 3300025910 | Bacteria | 1653 |
| 124 | Ga0207684_10408276 | 3300025910 | Bacteria | 1167 |
| 125 | Ga0207684_10422838 | 3300025910 | Bacteria | 1145 |
| 126 | Ga0207684_10818875 | 3300025910 | Bacteria | 786 |
| 127 | Ga0207654_10237226 | 3300025911 | Bacteria | 1217 |
| 128 | Ga0207695_10254280 | 3300025913 | Bacteria | 1656 |
| 129 | Ga0207663_10000822 | 3300025916 | Bacteria | 14036 |
| 130 | Ga0207663_10001119 | 3300025916 | Bacteria | 12327 |
| 131 | Ga0207662_10232618 | 3300025918 | Bacteria | 1204 |
| 132 | Ga0207646_10000470 | 3300025922 | Bacteria | 53859 |
| 133 | Ga0207646_10015576 | 3300025922 | Bacteria | 7177 |
| 134 | Ga0207646_10048535 | 3300025922 | Bacteria | 3805 |
| 135 | Ga0207646_10061737 | 3300025922 | Bacteria | 3345 |
| 136 | Ga0207646_10074591 | 3300025922 | Bacteria | 3030 |
| 137 | Ga0207646_10110749 | 3300025922 | Bacteria | 2463 |
| 138 | Ga0207646_10120398 | 3300025922 | Bacteria | 2358 |
| 139 | Ga0207646_10202794 | 3300025922 | Bacteria | 1792 |
| 140 | Ga0207646_10214194 | 3300025922 | Bacteria | 1740 |
| 141 | Ga0207650_10612055 | 3300025925 | Bacteria | 916 |
| 142 | Ga0207700_10004933 | 3300025928 | Bacteria | 7927 |
| 143 | Ga0207700_10007308 | 3300025928 | Bacteria | 6742 |
| 144 | Ga0207700_10025045 | 3300025928 | Bacteria | 4137 |
| 145 | Ga0207700_10026702 | 3300025928 | Bacteria | 4031 |
| 146 | Ga0207700_10550123 | 3300025928 | Bacteria | 1024 |
| 147 | Ga0207700_10788596 | 3300025928 | Bacteria | 850 |
| 148 | Ga0207664_10002078 | 3300025929 | Bacteria | 13174 |
| 149 | Ga0207664_10022897 | 3300025929 | Bacteria | 4673 |
| 150 | Ga0207664_10166928 | 3300025929 | Bacteria | 1881 |
| 151 | Ga0207664_10326266 | 3300025929 | Bacteria | 1355 |
| 152 | Ga0207664_10651693 | 3300025929 | Bacteria | 946 |
| 153 | Ga0207665_10000882 | 3300025939 | Bacteria | 20246 |
| 154 | Ga0207665_10007304 | 3300025939 | Bacteria | 7308 |
| 155 | Ga0207667_10126269 | 3300025949 | Bacteria | 2635 |
| 156 | Ga0207667_10258860 | 3300025949 | Bacteria | 1779 |
| 157 | Ga0207651_10919248 | 3300025960 | Bacteria | 780 |
| 158 | Ga0207668_10003312 | 3300025972 | Bacteria | 9441 |
| 159 | Ga0207658_10036320 | 3300025986 | Bacteria | 3532 |
| 160 | Ga0207703_10214162 | 3300026035 | Bacteria | 1719 |
| 161 | Ga0207702_10116688 | 3300026078 | Bacteria | 2382 |
| 162 | Ga0207702_10594613 | 3300026078 | Bacteria | 1085 |
| 163 | Ga0207641_10480478 | 3300026088 | Bacteria | 1204 |
| 164 | Ga0207675_100466336 | 3300026118 | Bacteria | 1253 |
| 165 | Ga0207683_10338448 | 3300026121 | Bacteria | 1380 |
| 166 | Ga0207683_10622235 | 3300026121 | Bacteria | 1000 |
| 167 | Ga0207698_10310033 | 3300026142 | Bacteria | 1473 |
| 168 | Ga0207698_11328389 | 3300026142 | Bacteria | 734 |
| 169 | Ga0268265_10093589 | 3300028380 | Bacteria | 2408 |
| 170 | Ga0268264_10082729 | 3300028381 | Bacteria | 2748 |
| 171 | Ga0307517_10084573 | 3300028786 | Bacteria | 2669 |
| 172 | Ga0307517_10237093 | 3300028786 | Bacteria | 1087 |
| 173 | Ga0307515_10002200 | 3300028794 | Bacteria | 42791 |
| 174 | Ga0307515_10010401 | 3300028794 | Bacteria | 17825 |
| 175 | Ga0307512_10004194 | 3300030522 | Bacteria | 15960 |
| 176 | Ga0307512_10004480 | 3300030522 | Bacteria | 15286 |
| 177 | Ga0316177_1122181 | 3300030731 | Bacteria | 1524 |
| 178 | Ga0314311_1119181 | 3300030733 | Bacteria | 1414 |
| 179 | Ga0316181_1275879 | 3300030744 | Bacteria | 3625 |
| 180 | Ga0307513_10000001 | 3300031456 | Bacteria | 1660464 |
| 181 | Ga0307513_10023131 | 3300031456 | Bacteria | 7272 |
| 182 | Ga0307513_10046108 | 3300031456 | Bacteria | 4758 |
| 183 | Ga0307509_10002147 | 3300031507 | Bacteria | 32420 |
| 184 | Ga0307509_10248430 | 3300031507 | Bacteria | 1565 |
| 185 | Ga0307408_100013342 | 3300031548 | Bacteria | 5453 |
| 186 | Ga0307408_100709644 | 3300031548 | Bacteria | 905 |
| 187 | Ga0307508_10001138 | 3300031616 | Bacteria | 30634 |
| 188 | Ga0307508_10005883 | 3300031616 | Bacteria | 11576 |
| 189 | Ga0307508_10108590 | 3300031616 | Bacteria | 2374 |
| 190 | Ga0316575_10038387 | 3300031665 | Bacteria | 1889 |
| 191 | Ga0307516_10079584 | 3300031730 | Bacteria | 3122 |
| 192 | Ga0307516_10100183 | 3300031730 | Bacteria | 2713 |
| 193 | Ga0307405_10381253 | 3300031731 | Bacteria | 1098 |
| 194 | Ga0307413_10577508 | 3300031824 | Bacteria | 916 |
| 195 | Ga0307410_10111168 | 3300031852 | Bacteria | 1983 |
| 196 | Ga0307410_10179954 | 3300031852 | Bacteria | 1600 |
| 197 | Ga0307410_10279010 | 3300031852 | Bacteria | 1310 |
| 198 | Ga0326468_10000912 | 3300031889 | Bacteria | 2874 |
| 199 | Ga0307406_10275136 | 3300031901 | Bacteria | 1281 |
| 200 | Ga0307407_10491035 | 3300031903 | Bacteria | 898 |
| 201 | Ga0307409_100013557 | 3300031995 | Bacteria | 5254 |
| 202 | Ga0307409_100105371 | 3300031995 | Bacteria | 2351 |
| 203 | Ga0307409_100285593 | 3300031995 | Bacteria | 1527 |
| 204 | Ga0307416_100051915 | 3300032002 | Bacteria | 3279 |
| 205 | Ga0307414_10372629 | 3300032004 | Bacteria | 1232 |
| 206 | Ga0307411_10141253 | 3300032005 | Bacteria | 1776 |
| 207 | Ga0307411_10400730 | 3300032005 | Bacteria | 1134 |
| 208 | Ga0307415_100113398 | 3300032126 | Bacteria | 2016 |
| 209 | Ga0307415_100307273 | 3300032126 | Bacteria | 1316 |
| 210 | Ga0307415_100360078 | 3300032126 | Bacteria | 1228 |
| 211 | Ga0307507_10093132 | 3300033179 | Bacteria | 2568 |
| 212 | Ga0307507_10162155 | 3300033179 | Bacteria | 1649 |
| 213 | Ga0307510_10186421 | 3300033180 | Bacteria | 1629 |
| 214 | Ga0373948_0008068 | 3300034817 | Bacteria | 1786 |
| 215 | Ga0373948_0014954 | 3300034817 | Bacteria | 1420 |
| 216 | Ga0373950_0047944 | 3300034818 | Bacteria | 833 |
| 217 | Ga0373958_0001609 | 3300034819 | Bacteria | 3061 |
| 218 | Ga0373959_0008127 | 3300034820 | Bacteria | 1778 |
| 219 | Ga0373938_0008973 | 3300034957 | Bacteria | 1799 |
| 220 | Ga0373938_0020761 | 3300034957 | Bacteria | 1326 |
| 221 | Ga0373929_0003855 | 3300035085 | Bacteria | 2686 |
| 222 | Ga0373934_0000159 | 3300035086 | Bacteria | 24489 |
| 223 | Ga0373934_0001926 | 3300035086 | Bacteria | 7614 |
| 224 | Ga0373934_0026610 | 3300035086 | Bacteria | 2244 |
| 225 | Ga0373940_0006056 | 3300035088 | Bacteria | 2659 |
| 226 | Ga0373940_0011319 | 3300035088 | Bacteria | 2116 |
| 227 | Ga0373944_0144923 | 3300035089 | Bacteria | 833 |
| 228 | Ga0373949_0014019 | 3300035090 | Bacteria | 1782 |
| 229 | Ga0373951_0000194 | 3300035091 | Bacteria | 21927 |
| 230 | Ga0373951_0013850 | 3300035091 | Bacteria | 1813 |
| 231 | Ga0373952_0001767 | 3300035092 | Bacteria | 3931 |
| 232 | Ga0373923_0006383 | 3300035111 | Bacteria | 4072 |
| 233 | Ga0373923_0188675 | 3300035111 | Bacteria | 949 |
| 234 | Ga0373932_0007636 | 3300035112 | Bacteria | 2578 |
| 235 | Ga0373932_0074181 | 3300035112 | Bacteria | 1062 |
| 236 | Ga0373936_0064662 | 3300035113 | Bacteria | 1499 |
| 237 | Ga0373939_0036425 | 3300035114 | Bacteria | 1455 |
| 238 | Ga0373941_0007261 | 3300035115 | Bacteria | 2706 |
| 239 | Ga0373945_0146034 | 3300035116 | Bacteria | 956 |
| 240 | Ga0373953_0000270 | 3300035117 | Bacteria | 14188 |
| 241 | Ga0373953_0038972 | 3300035117 | Bacteria | 1882 |
| 242 | Ga0373953_0097242 | 3300035117 | Bacteria | 1236 |
| 243 | Ga0373954_0000963 | 3300035118 | Bacteria | 11273 |
| 244 | Ga0373954_0013865 | 3300035118 | Bacteria | 3593 |
| 245 | Ga0373956_0000328 | 3300035119 | Bacteria | 19087 |
| 246 | Ga0373956_0006785 | 3300035119 | Bacteria | 4591 |
| 247 | Ga0373956_0006834 | 3300035119 | Bacteria | 4579 |
| 248 | Ga0373957_0000203 | 3300035120 | Bacteria | 15228 |
| 249 | Ga0373957_0002550 | 3300035120 | Bacteria | 5221 |
| 250 | Ga0373957_0023821 | 3300035120 | Bacteria | 2192 |
| 251 | Ga0373957_0070357 | 3300035120 | Bacteria | 1367 |
| 252 | Ga0373960_0115849 | 3300035121 | Bacteria | 884 |
| 253 | Ga0373943_0073705 | 3300035170 | Bacteria | 1734 |
| 254 | Ga0373946_0008811 | 3300035171 | Bacteria | 3702 |
| 255 | Ga0373955_0000024 | 3300035172 | Bacteria | 60102 |
| 256 | Ga0373955_0028111 | 3300035172 | Bacteria | 2913 |
| 257 | Ga0373955_0032055 | 3300035172 | Bacteria | 2755 |
| 258 | Ga0373955_0039474 | 3300035172 | Bacteria | 2520 |
| 259 | Ga0373942_0000437 | 3300035207 | Bacteria | 11648 |
| 260 | Ga0373942_0040476 | 3300035207 | Bacteria | 1271 |
| 261 | Ga0373961_0004281 | 3300035241 | Bacteria | 3456 |
| 262 | Ga0373962_0066987 | 3300035242 | Bacteria | 1065 |
| 263 | Ga0373924_0000562 | 3300035410 | Bacteria | 11432 |
| 264 | Ga0373924_0015361 | 3300035410 | Bacteria | 2910 |
| 265 | Ga0373924_0088825 | 3300035410 | Bacteria | 1320 |
| 266 | Ga0373931_0207876 | 3300035691 | Bacteria | 1172 |
| 267 | Ga0373935_0017285 | 3300035692 | Bacteria | 4374 |
| 268 | Ga0373935_0029311 | 3300035692 | Bacteria | 3406 |
| 269 | Ga0373935_0131923 | 3300035692 | Bacteria | 1679 |
| 270 | Ga0373935_0353828 | 3300035692 | Bacteria | 1047 |
| 271 | Ga0373933_0000153 | 3300035724 | Bacteria | 44821 |
| 272 | Ga0373933_0006584 | 3300035724 | Bacteria | 6330 |
| 273 | Ga0373947_0154365 | 3300035725 | Bacteria | 1480 |
| 274 | Ga0373937_0000333 | 3300036401 | Bacteria | 44782 |
| 275 | Ga0373937_0004325 | 3300036401 | Bacteria | 12051 |
| 276 | Ga0373937_0094927 | 3300036401 | Bacteria | 2765 |
| 277 | Ga0316584_0210830 | 3300036712 | Bacteria | 1430 |
| 278 | Ga0373925_0010690 | 3300037068 | Bacteria | 6655 |
| 279 | Ga0373925_0011433 | 3300037068 | Bacteria | 6428 |
| 280 | Ga0373925_0144816 | 3300037068 | Bacteria | 1862 |
| 281 | Ga0395899_0064228 | 3300037312 | Bacteria | 2699 |
| 282 | Ga0395899_0097524 | 3300037312 | Bacteria | 2125 |
| 283 | Ga0395900_0024817 | 3300037418 | Bacteria | 6136 |
| 284 | Ga0395900_0033302 | 3300037418 | Bacteria | 5304 |
| 285 | Ga0395900_0346494 | 3300037418 | Bacteria | 1460 |
| 286 | Ga0395898_0038018 | 3300037466 | Bacteria | 4772 |
| 287 | Ga0395898_0094652 | 3300037466 | Bacteria | 2871 |
| 288 | Ga0395898_0120004 | 3300037466 | Bacteria | 2519 |
| 289 | Ga0395905_0040635 | 3300037471 | Bacteria | 4363 |
| 290 | Ga0395901_0045358 | 3300038443 | Bacteria | 4561 |
| 291 | Ga0395901_0157075 | 3300038443 | Bacteria | 2389 |
| 292 | Ga0400484_31873 | 3300038725 | Bacteria | 18535 |
| 293 | Ga0400490_12830 | 3300038726 | Bacteria | 2174 |
| 294 | Ga0400490_33722 | 3300038726 | Bacteria | 86861 |
| 295 | Ga0400491_11198 | 3300038727 | Bacteria | 4537 |
| 296 | Ga0400485_06848 | 3300038735 | Unclassified | 3801 |
| 297 | Ga0400488_25331 | 3300038741 | Bacteria | 3002 |
| 298 | Ga0400488_55730 | 3300038741 | Bacteria | 2613 |
| 299 | Ga0400486_05863 | 3300038742 | Bacteria | 74939 |
| 300 | Ga0400486_16702 | 3300038742 | Bacteria | 32581 |
| 301 | Ga0400489_11382 | 3300039093 | Bacteria | 12435 |
| 302 | Ga0436365_0298795 | 3300039437 | Bacteria | 4619 |
| 303 | Ga0436365_1873403 | 3300039437 | Bacteria | 702 |
| 304 | Ga0436363_0632637 | 3300039450 | Bacteria | 725 |
| 305 | Ga0436363_1208389 | 3300039450 | Bacteria | 632 |
| 306 | Ga0439436_0013256 | 3300041404 | Bacteria | 2495 |
| 307 | Ga0439438_063712 | 3300041405 | Bacteria | 920 |
| 308 | Ga0439449_0002778 | 3300042007 | Bacteria | 6804 |
| 309 | Ga0439457_012549 | 3300042014 | Bacteria | 1909 |
| 310 | Ga0439463_059187 | 3300042016 | Bacteria | 979 |
| 311 | Ga0450906_033896 | 3300042145 | Bacteria | 902 |
| 312 | Ga0450907_005944 | 3300042146 | Bacteria | 2048 |
| 313 | Ga0439459_0021566 | 3300042438 | Bacteria | 1239 |
| 314 | Ga0439459_0081129 | 3300042438 | Bacteria | 766 |
| 315 | Ga0466969_0024280 | 3300044656 | Bacteria | 3118 |
| 316 | Ga0466969_0044942 | 3300044656 | Bacteria | 2194 |
| 317 | Ga0466972_0128237 | 3300044658 | Bacteria | 1195 |
| 318 | Ga0466965_0117141 | 3300044683 | Bacteria | 1373 |
| 319 | Ga0466966_0009536 | 3300044684 | Bacteria | 6426 |
| 320 | Ga0466966_0010743 | 3300044684 | Bacteria | 6086 |
| 321 | Ga0466966_0058635 | 3300044684 | Bacteria | 2433 |
| 322 | Ga0466966_0078083 | 3300044684 | Bacteria | 2065 |
| 323 | Ga0466966_0101495 | 3300044684 | Bacteria | 1779 |
| 324 | Ga0466961_0016747 | 3300044693 | Bacteria | 4712 |
| 325 | Ga0466961_0022970 | 3300044693 | Bacteria | 4012 |
| 326 | Ga0466961_0036797 | 3300044693 | Bacteria | 3141 |
| 327 | Ga0466961_0082949 | 3300044693 | Bacteria | 2027 |
| 328 | Ga0466961_0254791 | 3300044693 | Bacteria | 1077 |
| 329 | Ga0466963_0006979 | 3300044694 | Bacteria | 6722 |
| 330 | Ga0466963_0017699 | 3300044694 | Bacteria | 4444 |
| 331 | Ga0466963_0101707 | 3300044694 | Bacteria | 1968 |
| 332 | Ga0466963_0284208 | 3300044694 | Bacteria | 1163 |
| 333 | Ga0466963_0681429 | 3300044694 | Bacteria | 725 |
| 334 | Ga0466963_0739755 | 3300044694 | Bacteria | 694 |
| 335 | Ga0466964_0002467 | 3300044706 | Bacteria | 6574 |
| 336 | Ga0466964_0064259 | 3300044706 | Bacteria | 1535 |
| 337 | Ga0466964_0543531 | 3300044706 | Bacteria | 630 |
| 338 | Ga0466971_0055535 | 3300044719 | Bacteria | 1785 |
| 339 | Ga0466968_0038287 | 3300044735 | Bacteria | 2015 |
| 340 | Ga0466968_0126894 | 3300044735 | Bacteria | 1158 |
| 341 | Ga0466970_0047309 | 3300044765 | Bacteria | 2292 |
| 342 | Ga0466970_0151682 | 3300044765 | Bacteria | 1279 |
| 343 | Ga0466957_0020934 | 3300044842 | Bacteria | 3848 |
| 344 | Ga0466957_0057509 | 3300044842 | Bacteria | 2380 |
| 345 | Ga0466957_0084190 | 3300044842 | Bacteria | 1985 |
| 346 | Ga0466957_0299103 | 3300044842 | Bacteria | 1081 |
| 347 | Ga0466960_0096369 | 3300044901 | Bacteria | 1516 |
| 348 | Ga0466960_0159690 | 3300044901 | Bacteria | 1209 |
| 349 | Ga0466960_0191558 | 3300044901 | Bacteria | 1113 |
| 350 | Ga0466960_0469049 | 3300044901 | Bacteria | 734 |
| 351 | Ga0466960_0608031 | 3300044901 | Bacteria | 649 |
| 352 | Ga0466959_0015491 | 3300045049 | Bacteria | 5555 |
| 353 | Ga0466959_0096591 | 3300045049 | Bacteria | 2118 |
| 354 | Ga0466959_0130224 | 3300045049 | Bacteria | 1783 |
| 355 | Ga0466959_0186082 | 3300045049 | Bacteria | 1451 |
| 356 | Ga0466959_0599207 | 3300045049 | Bacteria | 741 |
| 357 | Ga0466958_0134424 | 3300045836 | Bacteria | 1554 |
| 358 | Ga0466967_0003844 | 3300045976 | Bacteria | 9948 |
| 359 | Ga0466967_0012928 | 3300045976 | Bacteria | 6419 |
| 360 | Ga0466967_0061841 | 3300045976 | Bacteria | 3322 |
| 361 | Ga0466967_0067289 | 3300045976 | Bacteria | 3195 |
| 362 | Ga0466967_0071026 | 3300045976 | Bacteria | 3116 |
| 363 | Ga0466967_0136212 | 3300045976 | Bacteria | 2284 |
| 364 | Ga0466967_0343112 | 3300045976 | Bacteria | 1444 |
| 365 | Ga0466967_0491417 | 3300045976 | Bacteria | 1203 |
| 366 | Ga0495592_0001610 | 3300046454 | Bacteria | 15812 |
| 367 | Ga0495592_0223785 | 3300046454 | Bacteria | 1256 |
| 368 | Ga0495592_0497776 | 3300046454 | Bacteria | 756 |
| 369 | Ga0495603_0080327 | 3300046455 | Bacteria | 1911 |
| 370 | Ga0495629_0001760 | 3300046459 | Bacteria | 16982 |
| 371 | Ga0495629_0010447 | 3300046459 | Bacteria | 6753 |
| 372 | Ga0495638_0178870 | 3300046460 | Bacteria | 1212 |
| 373 | Ga0495641_0072977 | 3300046461 | Bacteria | 1540 |
| 374 | Ga0495651_0001169 | 3300046462 | Bacteria | 20282 |
| 375 | Ga0495651_0193220 | 3300046462 | Bacteria | 1430 |
| 376 | Ga0495653_0002881 | 3300046463 | Bacteria | 13759 |
| 377 | Ga0495653_0052012 | 3300046463 | Bacteria | 3141 |
| 378 | Ga0495653_0061573 | 3300046463 | Bacteria | 2839 |
| 379 | Ga0495653_0063855 | 3300046463 | Bacteria | 2776 |
| 380 | Ga0495580_0319368 | 3300046472 | Bacteria | 1055 |
| 381 | Ga0495582_0004201 | 3300046473 | Bacteria | 8098 |
| 382 | Ga0495639_0003255 | 3300046475 | Bacteria | 7053 |
| 383 | Ga0495639_0172570 | 3300046475 | Bacteria | 1050 |
| 384 | Ga0495662_0058462 | 3300046476 | Bacteria | 1862 |
| 385 | Ga0495662_0090406 | 3300046476 | Bacteria | 1492 |
| 386 | Ga0495664_0007153 | 3300046477 | Bacteria | 6184 |
| 387 | Ga0495664_0029292 | 3300046477 | Bacteria | 3218 |
| 388 | Ga0495594_0009701 | 3300046499 | Bacteria | 4981 |
| 389 | Ga0495606_0004365 | 3300046507 | Bacteria | 14182 |
| 390 | Ga0495608_0000101 | 3300046511 | Bacteria | 61678 |
| 391 | Ga0495608_0290403 | 3300046511 | Bacteria | 1013 |
| 392 | Ga0495618_0018008 | 3300046514 | Bacteria | 4335 |
| 393 | Ga0495618_0021311 | 3300046514 | Bacteria | 3995 |
| 394 | Ga0495618_0499236 | 3300046514 | Bacteria | 733 |
| 395 | Ga0495628_0000327 | 3300046516 | Bacteria | 43068 |
| 396 | Ga0495628_0018571 | 3300046516 | Bacteria | 5757 |
| 397 | Ga0495628_0021056 | 3300046516 | Bacteria | 5370 |
| 398 | Ga0495628_0130712 | 3300046516 | Bacteria | 1920 |
| 399 | Ga0495630_0014076 | 3300046517 | Bacteria | 5821 |
| 400 | Ga0495630_0101833 | 3300046517 | Bacteria | 2172 |
| 401 | Ga0495630_0218608 | 3300046517 | Bacteria | 1454 |
| 402 | Ga0495632_0013760 | 3300046519 | Bacteria | 4604 |
| 403 | Ga0495666_0076415 | 3300046526 | Bacteria | 1587 |
| 404 | Ga0495652_0000775 | 3300046529 | Bacteria | 36861 |
| 405 | Ga0495652_0014267 | 3300046529 | Bacteria | 7133 |
| 406 | Ga0495652_0237341 | 3300046529 | Bacteria | 1359 |
| 407 | Ga0495652_0577920 | 3300046529 | Bacteria | 769 |
| 408 | Ga0495665_0032561 | 3300046531 | Bacteria | 2788 |
| 409 | Ga0495640_0045893 | 3300046533 | Bacteria | 3030 |
| 410 | Ga0495640_0049188 | 3300046533 | Bacteria | 2909 |
| 411 | Ga0495640_0249959 | 3300046533 | Bacteria | 1111 |
| 412 | Ga0495586_0000770 | 3300046535 | Bacteria | 18403 |
| 413 | Ga0495586_0017828 | 3300046535 | Bacteria | 3778 |
| 414 | Ga0495586_0030252 | 3300046535 | Bacteria | 2897 |
| 415 | Ga0495587_0000861 | 3300046536 | Bacteria | 20061 |
| 416 | Ga0495587_0008620 | 3300046536 | Bacteria | 6554 |
| 417 | Ga0495587_0063562 | 3300046536 | Bacteria | 2158 |
| 418 | Ga0495587_0123226 | 3300046536 | Bacteria | 1484 |
| 419 | Ga0495645_0023381 | 3300046543 | Bacteria | 4475 |
| 420 | Ga0495645_0046362 | 3300046543 | Bacteria | 3168 |
| 421 | Ga0495645_0087227 | 3300046543 | Bacteria | 2232 |
| 422 | Ga0495645_0202481 | 3300046543 | Bacteria | 1345 |
| 423 | Ga0495667_0000742 | 3300046559 | Bacteria | 20968 |
| 424 | Ga0495667_0033214 | 3300046559 | Bacteria | 3453 |
| 425 | Ga0495667_0183337 | 3300046559 | Bacteria | 1342 |
| 426 | Ga0495668_0000464 | 3300046616 | Bacteria | 51784 |
| 427 | Ga0495634_0022516 | 3300046642 | Bacteria | 4439 |
| 428 | Ga0495634_0038005 | 3300046642 | Bacteria | 3284 |
| 429 | Ga0495634_0118666 | 3300046642 | Bacteria | 1695 |
| 430 | Ga0495625_0000677 | 3300046660 | Bacteria | 48654 |
| 431 | Ga0495635_0079034 | 3300046663 | Bacteria | 2251 |
| 432 | Ga0495635_0109729 | 3300046663 | Bacteria | 1885 |
| 433 | Ga0495635_0153347 | 3300046663 | Bacteria | 1568 |
| 434 | Ga0495657_0000156 | 3300046675 | Bacteria | 61702 |
| 435 | Ga0495657_0007855 | 3300046675 | Bacteria | 8187 |
| 436 | Ga0495657_0069628 | 3300046675 | Bacteria | 2301 |
| 437 | Ga0495599_0000097 | 3300046678 | Bacteria | 61561 |
| 438 | Ga0495599_0026425 | 3300046678 | Bacteria | 3637 |
| 439 | Ga0495599_0043674 | 3300046678 | Bacteria | 2813 |
| 440 | Ga0495623_0000471 | 3300046679 | Bacteria | 26602 |
| 441 | Ga0495623_0009399 | 3300046679 | Bacteria | 6348 |
| 442 | Ga0495623_0018208 | 3300046679 | Bacteria | 4535 |
| 443 | Ga0495623_0028141 | 3300046679 | Bacteria | 3617 |
| 444 | Ga0495646_0035868 | 3300046680 | Bacteria | 3073 |
| 445 | Ga0495646_0076900 | 3300046680 | Bacteria | 1953 |
| 446 | Ga0495646_0145612 | 3300046680 | Bacteria | 1321 |
| 447 | Ga0495647_0056653 | 3300046681 | Bacteria | 1537 |
| 448 | Ga0495658_0061558 | 3300046683 | Bacteria | 2155 |
| 449 | Ga0495658_0244854 | 3300046683 | Bacteria | 1126 |
| 450 | Ga0495613_0031742 | 3300046689 | Bacteria | 3923 |
| 451 | Ga0495613_0050844 | 3300046689 | Bacteria | 3056 |
| 452 | Ga0495624_0033878 | 3300046690 | Bacteria | 3307 |
| 453 | Ga0495624_0084727 | 3300046690 | Bacteria | 1958 |
| 454 | Ga0495600_0003272 | 3300046809 | Bacteria | 9490 |
| 455 | Ga0495600_0025545 | 3300046809 | Bacteria | 3807 |
| 456 | Ga0495581_0026136 | 3300047315 | Bacteria | 3386 |
| 457 | Ga0495581_0037274 | 3300047315 | Bacteria | 2813 |
| 458 | Ga0495604_0000196 | 3300047317 | Bacteria | 54755 |
| 459 | Ga0495604_0060756 | 3300047317 | Bacteria | 2892 |
| 460 | Ga0495604_0074011 | 3300047317 | Bacteria | 2568 |
| 461 | Ga0495604_0126016 | 3300047317 | Bacteria | 1846 |
| 462 | Ga0495674_0053174 | 3300047319 | Bacteria | 3561 |
| 463 | Ga0495674_0329856 | 3300047319 | Bacteria | 1241 |
| 464 | Ga0495674_0390578 | 3300047319 | Bacteria | 1124 |
| 465 | Ga0495674_0439321 | 3300047319 | Bacteria | 1049 |
| 466 | Ga0495676_0099553 | 3300047321 | Bacteria | 2154 |
| 467 | Ga0495680_0000226 | 3300047322 | Bacteria | 61646 |
| 468 | Ga0495680_0005150 | 3300047322 | Bacteria | 12342 |
| 469 | Ga0495680_0007648 | 3300047322 | Bacteria | 9866 |
| 470 | Ga0495680_0045310 | 3300047322 | Bacteria | 3472 |
| 471 | Ga0495675_0123406 | 3300047444 | Bacteria | 1612 |
| 472 | Ga0495593_0006917 | 3300047673 | Bacteria | 6641 |
| 473 | Ga0495593_0019260 | 3300047673 | Bacteria | 3826 |
| 474 | Ga0495602_0000172 | 3300048088 | Bacteria | 60316 |
| 475 | Ga0495602_0098455 | 3300048088 | Bacteria | 2406 |
| 476 | Ga0495602_0155447 | 3300048088 | Bacteria | 1791 |
| 477 | Ga0495602_0166094 | 3300048088 | Bacteria | 1717 |
| 478 | Ga0495602_0231577 | 3300048088 | Bacteria | 1387 |
| 479 | Ga0495602_0351018 | 3300048088 | Bacteria | 1064 |
| 480 | Ga0495614_0037965 | 3300048089 | Bacteria | 2067 |
| 481 | Ga0495626_0000184 | 3300048091 | Bacteria | 76088 |
| 482 | Ga0496100_0278882 | 3300048903 | Bacteria | 1245 |
| 483 | Ga0496100_0588745 | 3300048903 | Bacteria | 863 |
| 484 | Ga0496101_0095064 | 3300048904 | Bacteria | 2222 |
| 485 | Ga0496102_0000072 | 3300048905 | Bacteria | 150284 |
| 486 | Ga0496102_0047115 | 3300048905 | Bacteria | 3916 |
| 487 | Ga0496102_0173364 | 3300048905 | Bacteria | 2031 |
| 488 | Ga0496103_0000053 | 3300048906 | Bacteria | 148944 |
| 489 | Ga0496104_0280085 | 3300048907 | Bacteria | 1580 |
| 490 | Ga0496105_0023558 | 3300048908 | Bacteria | 4994 |
| 491 | Ga0496105_0380095 | 3300048908 | Bacteria | 1124 |
| 492 | Ga0496106_0119199 | 3300048909 | Bacteria | 2061 |
| 493 | Ga0496106_0674089 | 3300048909 | Bacteria | 825 |
| 494 | Ga0496107_0087690 | 3300048910 | Bacteria | 2272 |
| 495 | Ga0496108_0000481 | 3300048911 | Bacteria | 31977 |
| 496 | Ga0496108_0024605 | 3300048911 | Bacteria | 4958 |
| 497 | Ga0496108_0098906 | 3300048911 | Bacteria | 2486 |
| 498 | Ga0496108_0191748 | 3300048911 | Bacteria | 1771 |
| 499 | Ga0496110_0381496 | 3300048913 | Bacteria | 1284 |
| 500 | Ga0496111_0314933 | 3300048914 | Bacteria | 1159 |
| 501 | Ga0496112_0539636 | 3300048915 | Bacteria | 1100 |
| 502 | Ga0496114_0067157 | 3300048917 | Bacteria | 3008 |
| 503 | Ga0496114_0071217 | 3300048917 | Bacteria | 2921 |
| 504 | Ga0496115_0019992 | 3300048918 | Bacteria | 5159 |
| 505 | Ga0496115_0036352 | 3300048918 | Bacteria | 3899 |
| 506 | Ga0496117_0158894 | 3300048920 | Bacteria | 1327 |
| 507 | Ga0496118_0019577 | 3300048921 | Bacteria | 6043 |
| 508 | Ga0496119_0041354 | 3300048922 | Bacteria | 2936 |
| 509 | Ga0496121_0028152 | 3300048924 | Bacteria | 5238 |
| 510 | Ga0501031_0032757 | 3300049568 | Bacteria | 3389 |
| 511 | Ga0501031_0203690 | 3300049568 | Bacteria | 1291 |
| 512 | Ga0501032_0011504 | 3300049569 | Bacteria | 6356 |
| 513 | Ga0501032_0058074 | 3300049569 | Bacteria | 2598 |
| 514 | Ga0501033_0144188 | 3300049570 | Bacteria | 1721 |
| 515 | Ga0501033_0177992 | 3300049570 | Bacteria | 1525 |
| 516 | Ga0501034_0013123 | 3300049571 | Bacteria | 8539 |
| 517 | Ga0501034_0083969 | 3300049571 | Bacteria | 3187 |
| 518 | Ga0501036_0196314 | 3300049572 | Bacteria | 1698 |
| 519 | Ga0501036_0308448 | 3300049572 | Bacteria | 1323 |
| 520 | Ga0501037_0034880 | 3300049573 | Bacteria | 3711 |
| 521 | Ga0501037_0122675 | 3300049573 | Bacteria | 1867 |
| 522 | Ga0501038_0008112 | 3300049574 | Bacteria | 9665 |
| 523 | Ga0501038_0076579 | 3300049574 | Bacteria | 2825 |
| 524 | Ga0501039_0037135 | 3300049575 | Bacteria | 3760 |
| 525 | Ga0501043_0017479 | 3300049579 | Bacteria | 5622 |
| 526 | Ga0501043_0134383 | 3300049579 | Bacteria | 1938 |
| 527 | Ga0501046_0047422 | 3300049580 | Bacteria | 3406 |
| 528 | Ga0501046_0094453 | 3300049580 | Bacteria | 2298 |
| 529 | Ga0501047_0013453 | 3300049581 | Bacteria | 7757 |
| 530 | Ga0501047_0064555 | 3300049581 | Bacteria | 3531 |
| 531 | Ga0501048_0000017 | 3300049582 | Bacteria | 72572 |
| 532 | Ga0501048_0141628 | 3300049582 | Bacteria | 1700 |
| 533 | Ga0501067_0272343 | 3300049583 | Bacteria | 943 |
| 534 | Ga0501069_0057226 | 3300049585 | Bacteria | 2173 |
| 535 | Ga0501070_0042575 | 3300049586 | Bacteria | 3782 |
| 536 | Ga0501070_0211775 | 3300049586 | Bacteria | 1590 |
| 537 | Ga0501073_0377847 | 3300049589 | Bacteria | 979 |
| 538 | Ga0501074_0283539 | 3300049590 | Bacteria | 1177 |
| 539 | Ga0501074_0532793 | 3300049590 | Bacteria | 832 |
| 540 | Ga0501249_075606 | 3300049679 | Bacteria | 789 |
| 541 | Ga0501080_0199188 | 3300049742 | Bacteria | 1839 |
| 542 | Ga0501080_0368691 | 3300049742 | Bacteria | 1295 |
| 543 | Ga0501035_0023468 | 3300049822 | Bacteria | 5658 |
| 544 | Ga0501035_0043976 | 3300049822 | Bacteria | 4024 |
| 545 | Ga0501035_0105015 | 3300049822 | Bacteria | 2477 |
| 546 | Ga0501044_0005946 | 3300049823 | Bacteria | 13510 |
| 547 | Ga0501044_0164545 | 3300049823 | Bacteria | 2193 |
| 548 | Ga0501045_0314244 | 3300049824 | Bacteria | 1166 |
| 549 | nmdc:mga0yw44_2602_c1 | 3300050492 | Bacteria | 7754 |
| 550 | nmdc:mga07m45_43084_c1 | 3300050496 | Bacteria | 1525 |
| 551 | nmdc:mga05p37_43016_c1 | 3300050507 | Bacteria | 5554 |
| 552 | nmdc:mga05p37_452_c1 | 3300050507 | Bacteria | 44614 |
| 553 | nmdc:mga05p37_542982_c1 | 3300050507 | Bacteria | 1325 |
| 554 | nmdc:mga05p37_552421_c1 | 3300050507 | Bacteria | 1310 |
| 555 | nmdc:mga06r32_21177_c1 | 3300050510 | Bacteria | 6000 |
| 556 | nmdc:mga08y16_475396_c1 | 3300050511 | Bacteria | 1272 |
| 557 | nmdc:mga0n895_26750_c1 | 3300050512 | Bacteria | 5470 |
| 558 | nmdc:mga0n895_38113_c1 | 3300050512 | Bacteria | 4656 |
| 559 | nmdc:mga0rr50_15996_c1 | 3300050513 | Bacteria | 4969 |
| 560 | nmdc:mga0rr50_183657_c1 | 3300050513 | Bacteria | 1711 |
| 561 | nmdc:mga0rr50_271477_c1 | 3300050513 | Bacteria | 1414 |
| 562 | nmdc:mga08x19_138794_c1 | 3300050514 | Bacteria | 1641 |
| 563 | nmdc:mga08x19_274502_c1 | 3300050514 | Bacteria | 1167 |
| 564 | nmdc:mga08x19_485940_c1 | 3300050514 | Bacteria | 871 |
| 565 | nmdc:mga0a205_141807_c1 | 3300050515 | Bacteria | 2303 |
| 566 | Ga0495601_0013113 | 3300053077 | Bacteria | 4982 |
| 567 | Ga0495612_0006591 | 3300053078 | Bacteria | 4765 |
| 568 | Ga0495612_0016052 | 3300053078 | Bacteria | 3000 |
| 569 | Ga0495612_0089296 | 3300053078 | Bacteria | 1302 |
| 570 | Ga0495595_0010883 | 3300053084 | Bacteria | 3794 |
| 571 | Ga0495595_0015075 | 3300053084 | Bacteria | 3291 |
| 572 | Ga0495595_0026966 | 3300053084 | Bacteria | 2556 |
| 573 | Ga0495619_0026732 | 3300053085 | Bacteria | 3714 |
| 574 | Ga0495619_0124379 | 3300053085 | Bacteria | 1769 |
| 575 | Ga0495619_0928503 | 3300053085 | Bacteria | 584 |
| 576 | Ga0500644_0086478 | 3300053088 | Bacteria | 1164 |
| 577 | Ga0500583_0257831 | 3300053092 | Bacteria | 860 |
| 578 | Ga0500651_0053664 | 3300053093 | Bacteria | 2528 |
| 579 | Ga0500641_0036683 | 3300053096 | Bacteria | 1962 |
| 580 | Ga0500650_0279212 | 3300053098 | Bacteria | 743 |
| 581 | Ga0500556_0054579 | 3300053104 | Bacteria | 1456 |
| 582 | Ga0500559_0056050 | 3300053136 | Bacteria | 1749 |
| 583 | Ga0500588_0211500 | 3300053146 | Bacteria | 721 |
| 584 | Ga0500600_0144881 | 3300053149 | Bacteria | 1190 |
| 585 | Ga0500630_020876 | 3300053159 | Bacteria | 3236 |
| 586 | Ga0500634_0303527 | 3300053161 | Bacteria | 632 |
| 587 | Ga0466962_0012605 | 3300061719 | Bacteria | 4067 |
| 588 | Ga0466962_0250846 | 3300061719 | Bacteria | 870 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044706 | Ga0466964_0543531 | Ga0466964_0543531_114_620 | 148 |
| 2 | 3300044901 | Ga0466960_0608031 | Ga0466960_0608031_12_524 | 158 |
| 3 | 3300044656 | Ga0466969_0024280 | Ga0466969_0024280_2127_2702 | 161 |
| 4 | 3300044684 | Ga0466966_0010743 | Ga0466966_0010743_2617_3192 | 161 |
| 5 | 3300044693 | Ga0466961_0016747 | Ga0466961_0016747_1272_1847 | 161 |
| 6 | 3300045049 | Ga0466959_0130224 | Ga0466959_0130224_1031_1606 | 161 |
| 7 | 3300046476 | Ga0495662_0058462 | Ga0495662_0058462_1349_1849 | 165 |
| 8 | 3300005434 | Ga0070709_10671431 | Ga0070709_106714312 | 167 |
| 9 | 3300037466 | Ga0395898_0120004 | Ga0395898_0120004_1499_2092 | 167 |
| 10 | 3300038443 | Ga0395901_0157075 | Ga0395901_0157075_434_1027 | 167 |
| 11 | 3300044656 | Ga0466969_0044942 | Ga0466969_0044942_101_706 | 167 |
| 12 | 3300044658 | Ga0466972_0128237 | Ga0466972_0128237_560_1153 | 167 |
| 13 | 3300044684 | Ga0466966_0058635 | Ga0466966_0058635_1694_2287 | 167 |
| 14 | 3300044693 | Ga0466961_0036797 | Ga0466961_0036797_2515_3120 | 167 |
| 15 | 3300044694 | Ga0466963_0101707 | Ga0466963_0101707_127_720 | 167 |
| 16 | 3300044694 | Ga0466963_0284208 | Ga0466963_0284208_110_703 | 167 |
| 17 | 3300044694 | Ga0466963_0739755 | Ga0466963_0739755_53_646 | 167 |
| 18 | 3300044842 | Ga0466957_0084190 | Ga0466957_0084190_421_1014 | 167 |
| 19 | 3300044842 | Ga0466957_0299103 | Ga0466957_0299103_128_721 | 167 |
| 20 | 3300044901 | Ga0466960_0191558 | Ga0466960_0191558_389_982 | 167 |
| 21 | 3300044901 | Ga0466960_0469049 | Ga0466960_0469049_106_705 | 167 |
| 22 | 3300045049 | Ga0466959_0599207 | Ga0466959_0599207_44_649 | 167 |
| 23 | 3300045976 | Ga0466967_0071026 | Ga0466967_0071026_1341_1934 | 167 |
| 24 | 3300045976 | Ga0466967_0491417 | Ga0466967_0491417_219_812 | 167 |
| 25 | 3300048908 | Ga0496105_0380095 | Ga0496105_0380095_59_652 | 167 |
| 26 | 3300048911 | Ga0496108_0024605 | Ga0496108_0024605_1556_2149 | 167 |
| 27 | 3300061719 | Ga0466962_0250846 | Ga0466962_0250846_267_860 | 167 |
| 28 | 3300031995 | Ga0307409_100285593 | Ga0307409_1002855932 | 168 |
| 29 | 3300005338 | Ga0068868_100842955 | Ga0068868_1008429551 | 169 |
| 30 | 3300039437 | Ga0436365_1873403 | Ga0436365_1873403_13_588 | 169 |
| 31 | 3300045976 | Ga0466967_0067289 | Ga0466967_0067289_1838_2431 | 169 |
| 32 | 3300053085 | Ga0495619_0928503 | Ga0495619_0928503_11_553 | 169 |
| 33 | 3300044901 | Ga0466960_0159690 | Ga0466960_0159690_22_585 | 171 |
| 34 | 3300044684 | Ga0466966_0078083 | Ga0466966_0078083_1201_1791 | 174 |
| 35 | 3300005436 | Ga0070713_100742457 | Ga0070713_1007424572 | 175 |
| 36 | 3300005937 | Ga0081455_10010822 | Ga0081455_100108225 | 175 |
| 37 | 3300025928 | Ga0207700_10550123 | Ga0207700_105501232 | 175 |
| 38 | 3300009147 | Ga0114129_10640809 | Ga0114129_106408092 | 177 |
| 39 | 3300050507 | nmdc:mga05p37_542982_c1 | nmdc:mga05p37_542982_c1_103_669 | 177 |
| 40 | 3300005437 | Ga0070710_10360189 | Ga0070710_103601892 | 178 |
| 41 | 3300025928 | Ga0207700_10007308 | Ga0207700_100073082 | 178 |
| 42 | 3300035086 | Ga0373934_0000159 | Ga0373934_0000159_4644_5213 | 178 |
| 43 | 3300035111 | Ga0373923_0006383 | Ga0373923_0006383_3090_3659 | 178 |
| 44 | 3300035111 | Ga0373923_0188675 | Ga0373923_0188675_321_890 | 178 |
| 45 | 3300035116 | Ga0373945_0146034 | Ga0373945_0146034_115_684 | 178 |
| 46 | 3300035117 | Ga0373953_0000270 | Ga0373953_0000270_12389_12958 | 178 |
| 47 | 3300035118 | Ga0373954_0000963 | Ga0373954_0000963_5141_5710 | 178 |
| 48 | 3300035119 | Ga0373956_0000328 | Ga0373956_0000328_18400_18969 | 178 |
| 49 | 3300035120 | Ga0373957_0000203 | Ga0373957_0000203_785_1354 | 178 |
| 50 | 3300035120 | Ga0373957_0023821 | Ga0373957_0023821_229_798 | 178 |
| 51 | 3300035172 | Ga0373955_0000024 | Ga0373955_0000024_16859_17428 | 178 |
| 52 | 3300035172 | Ga0373955_0032055 | Ga0373955_0032055_607_1176 | 178 |
| 53 | 3300035410 | Ga0373924_0000562 | Ga0373924_0000562_7894_8463 | 178 |
| 54 | 3300035724 | Ga0373933_0000153 | Ga0373933_0000153_25852_26421 | 178 |
| 55 | 3300036401 | Ga0373937_0000333 | Ga0373937_0000333_1481_2050 | 178 |
| 56 | 3300037068 | Ga0373925_0010690 | Ga0373925_0010690_833_1402 | 178 |
| 57 | 3300038741 | Ga0400488_55730 | Ga0400488_55730_958_1530 | 178 |
| 58 | 3300046454 | Ga0495592_0001610 | Ga0495592_0001610_1361_1930 | 178 |
| 59 | 3300046454 | Ga0495592_0497776 | Ga0495592_0497776_81_650 | 178 |
| 60 | 3300046459 | Ga0495629_0001760 | Ga0495629_0001760_5250_5819 | 178 |
| 61 | 3300046462 | Ga0495651_0001169 | Ga0495651_0001169_1313_1882 | 178 |
| 62 | 3300046463 | Ga0495653_0002881 | Ga0495653_0002881_9193_9762 | 178 |
| 63 | 3300046463 | Ga0495653_0063855 | Ga0495653_0063855_1395_1964 | 178 |
| 64 | 3300046473 | Ga0495582_0004201 | Ga0495582_0004201_4538_5107 | 178 |
| 65 | 3300046475 | Ga0495639_0003255 | Ga0495639_0003255_2725_3294 | 178 |
| 66 | 3300046477 | Ga0495664_0029292 | Ga0495664_0029292_57_626 | 178 |
| 67 | 3300046511 | Ga0495608_0000101 | Ga0495608_0000101_42717_43286 | 178 |
| 68 | 3300046514 | Ga0495618_0499236 | Ga0495618_0499236_107_676 | 178 |
| 69 | 3300046516 | Ga0495628_0000327 | Ga0495628_0000327_24117_24686 | 178 |
| 70 | 3300046516 | Ga0495628_0018571 | Ga0495628_0018571_315_884 | 178 |
| 71 | 3300046517 | Ga0495630_0218608 | Ga0495630_0218608_794_1363 | 178 |
| 72 | 3300046529 | Ga0495652_0000775 | Ga0495652_0000775_22121_22690 | 178 |
| 73 | 3300046533 | Ga0495640_0045893 | Ga0495640_0045893_940_1509 | 178 |
| 74 | 3300046535 | Ga0495586_0000770 | Ga0495586_0000770_17018_17587 | 178 |
| 75 | 3300046536 | Ga0495587_0000861 | Ga0495587_0000861_1226_1795 | 178 |
| 76 | 3300046536 | Ga0495587_0063562 | Ga0495587_0063562_195_764 | 178 |
| 77 | 3300046543 | Ga0495645_0023381 | Ga0495645_0023381_464_1033 | 178 |
| 78 | 3300046559 | Ga0495667_0000742 | Ga0495667_0000742_5426_5995 | 178 |
| 79 | 3300046642 | Ga0495634_0118666 | Ga0495634_0118666_909_1478 | 178 |
| 80 | 3300046663 | Ga0495635_0153347 | Ga0495635_0153347_265_834 | 178 |
| 81 | 3300046675 | Ga0495657_0000156 | Ga0495657_0000156_18401_18970 | 178 |
| 82 | 3300046678 | Ga0495599_0000097 | Ga0495599_0000097_42610_43179 | 178 |
| 83 | 3300046679 | Ga0495623_0000471 | Ga0495623_0000471_11018_11587 | 178 |
| 84 | 3300046679 | Ga0495623_0028141 | Ga0495623_0028141_1109_1678 | 178 |
| 85 | 3300046680 | Ga0495646_0076900 | Ga0495646_0076900_1278_1847 | 178 |
| 86 | 3300046683 | Ga0495658_0061558 | Ga0495658_0061558_188_757 | 178 |
| 87 | 3300046689 | Ga0495613_0031742 | Ga0495613_0031742_265_834 | 178 |
| 88 | 3300046809 | Ga0495600_0003272 | Ga0495600_0003272_1473_2042 | 178 |
| 89 | 3300046809 | Ga0495600_0025545 | Ga0495600_0025545_919_1488 | 178 |
| 90 | 3300047315 | Ga0495581_0037274 | Ga0495581_0037274_1255_1824 | 178 |
| 91 | 3300047317 | Ga0495604_0000196 | Ga0495604_0000196_12702_13271 | 178 |
| 92 | 3300047317 | Ga0495604_0060756 | Ga0495604_0060756_1707_2276 | 178 |
| 93 | 3300047319 | Ga0495674_0390578 | Ga0495674_0390578_464_1033 | 178 |
| 94 | 3300047319 | Ga0495674_0439321 | Ga0495674_0439321_414_983 | 178 |
| 95 | 3300047322 | Ga0495680_0000226 | Ga0495680_0000226_18376_18945 | 178 |
| 96 | 3300047322 | Ga0495680_0007648 | Ga0495680_0007648_813_1382 | 178 |
| 97 | 3300047673 | Ga0495593_0006917 | Ga0495593_0006917_4566_5135 | 178 |
| 98 | 3300048088 | Ga0495602_0000172 | Ga0495602_0000172_18245_18814 | 178 |
| 99 | 3300048088 | Ga0495602_0166094 | Ga0495602_0166094_414_983 | 178 |
| 100 | 3300048088 | Ga0495602_0351018 | Ga0495602_0351018_464_1033 | 178 |
| 101 | 3300053078 | Ga0495612_0006591 | Ga0495612_0006591_1262_1831 | 178 |
| 102 | 3300053084 | Ga0495595_0010883 | Ga0495595_0010883_2012_2581 | 178 |
| 103 | 3300053084 | Ga0495595_0015075 | Ga0495595_0015075_2617_3186 | 178 |
| 104 | 3300053085 | Ga0495619_0026732 | Ga0495619_0026732_1337_1906 | 178 |
| 105 | 3300005468 | Ga0070707_100110822 | Ga0070707_1001108224 | 181 |
| 106 | 3300005468 | Ga0070707_100335386 | Ga0070707_1003353863 | 181 |
| 107 | 3300005518 | Ga0070699_100216790 | Ga0070699_1002167902 | 181 |
| 108 | 3300025910 | Ga0207684_10408276 | Ga0207684_104082762 | 181 |
| 109 | 3300025922 | Ga0207646_10202794 | Ga0207646_102027942 | 181 |
| 110 | 3300044719 | Ga0466971_0055535 | Ga0466971_0055535_128_739 | 181 |
| 111 | 3300045049 | Ga0466959_0186082 | Ga0466959_0186082_646_1257 | 181 |
| 112 | 3300005445 | Ga0070708_100004503 | Ga0070708_1000045039 | 182 |
| 113 | 3300005445 | Ga0070708_100010420 | Ga0070708_1000104207 | 182 |
| 114 | 3300005467 | Ga0070706_100128241 | Ga0070706_1001282412 | 182 |
| 115 | 3300025904 | Ga0207647_10077625 | Ga0207647_100776252 | 182 |
| 116 | 3300025910 | Ga0207684_10216502 | Ga0207684_102165022 | 182 |
| 117 | 3300025910 | Ga0207684_10818875 | Ga0207684_108188752 | 182 |
| 118 | 3300025922 | Ga0207646_10048535 | Ga0207646_100485355 | 182 |
| 119 | 3300048905 | Ga0496102_0173364 | Ga0496102_0173364_260_868 | 182 |
| 120 | 3300048913 | Ga0496110_0381496 | Ga0496110_0381496_277_885 | 182 |
| 121 | 3300048914 | Ga0496111_0314933 | Ga0496111_0314933_303_911 | 182 |
| 122 | 3300048917 | Ga0496114_0067157 | Ga0496114_0067157_372_980 | 182 |
| 123 | 3300048918 | Ga0496115_0036352 | Ga0496115_0036352_415_1023 | 182 |
| 124 | 3300049590 | Ga0501074_0532793 | Ga0501074_0532793_125_745 | 182 |
| 125 | iso_pu_bacteria | 2643221561 | 2643825603 | 182 |
| 126 | iso_pu_bacteria | 8053945823 | 8053947379 | 182 |
| 127 | 3300005445 | Ga0070708_100022421 | Ga0070708_1000224213 | 183 |
| 128 | 3300005467 | Ga0070706_100006796 | Ga0070706_1000067963 | 183 |
| 129 | 3300005467 | Ga0070706_100072927 | Ga0070706_1000729271 | 183 |
| 130 | 3300005468 | Ga0070707_100010529 | Ga0070707_10001052910 | 183 |
| 131 | 3300005468 | Ga0070707_100362658 | Ga0070707_1003626582 | 183 |
| 132 | 3300005468 | Ga0070707_101015270 | Ga0070707_1010152701 | 183 |
| 133 | 3300005471 | Ga0070698_100123683 | Ga0070698_1001236832 | 183 |
| 134 | 3300005518 | Ga0070699_100059670 | Ga0070699_1000596702 | 183 |
| 135 | 3300005548 | Ga0070665_100279072 | Ga0070665_1002790722 | 183 |
| 136 | 3300007076 | Ga0075435_100107686 | Ga0075435_1001076863 | 183 |
| 137 | 3300025910 | Ga0207684_10006215 | Ga0207684_100062153 | 183 |
| 138 | 3300025922 | Ga0207646_10061737 | Ga0207646_100617373 | 183 |
| 139 | 3300025922 | Ga0207646_10110749 | Ga0207646_101107493 | 183 |
| 140 | 3300025922 | Ga0207646_10120398 | Ga0207646_101203983 | 183 |
| 141 | 3300031665 | Ga0316575_10038387 | Ga0316575_100383872 | 183 |
| 142 | 3300035692 | Ga0373935_0353828 | Ga0373935_0353828_304_888 | 183 |
| 143 | 3300036712 | Ga0316584_0210830 | Ga0316584_0210830_231_833 | 183 |
| 144 | 3300038725 | Ga0400484_31873 | Ga0400484_31873_12376_12963 | 183 |
| 145 | 3300038726 | Ga0400490_12830 | Ga0400490_12830_733_1320 | 183 |
| 146 | 3300038726 | Ga0400490_33722 | Ga0400490_33722_18974_19606 | 183 |
| 147 | 3300038727 | Ga0400491_11198 | Ga0400491_11198_3842_4429 | 183 |
| 148 | 3300038735 | Ga0400485_06848 | Ga0400485_06848_1765_2352 | 183 |
| 149 | 3300038741 | Ga0400488_25331 | Ga0400488_25331_300_887 | 183 |
| 150 | 3300038742 | Ga0400486_05863 | Ga0400486_05863_38567_39157 | 183 |
| 151 | 3300038742 | Ga0400486_16702 | Ga0400486_16702_26615_27202 | 183 |
| 152 | 3300039093 | Ga0400489_11382 | Ga0400489_11382_7835_8422 | 183 |
| 153 | 3300046455 | Ga0495603_0080327 | Ga0495603_0080327_625_1209 | 183 |
| 154 | 3300046472 | Ga0495580_0319368 | Ga0495580_0319368_65_649 | 183 |
| 155 | 3300046499 | Ga0495594_0009701 | Ga0495594_0009701_2388_2972 | 183 |
| 156 | 3300046517 | Ga0495630_0014076 | Ga0495630_0014076_3147_3731 | 183 |
| 157 | 3300046531 | Ga0495665_0032561 | Ga0495665_0032561_1251_1835 | 183 |
| 158 | 3300046642 | Ga0495634_0022516 | Ga0495634_0022516_257_841 | 183 |
| 159 | 3300047321 | Ga0495676_0099553 | Ga0495676_0099553_143_727 | 183 |
| 160 | 3300047673 | Ga0495593_0019260 | Ga0495593_0019260_1951_2535 | 183 |
| 161 | 3300050515 | nmdc:mga0a205_141807_c1 | nmdc:mga0a205_141807_c1_1652_2275 | 183 |
| 162 | 3300005364 | Ga0070673_100514352 | Ga0070673_1005143521 | 184 |
| 163 | 3300005434 | Ga0070709_10012583 | Ga0070709_100125832 | 184 |
| 164 | 3300005435 | Ga0070714_100012596 | Ga0070714_10001259610 | 184 |
| 165 | 3300005436 | Ga0070713_100064606 | Ga0070713_1000646062 | 184 |
| 166 | 3300005436 | Ga0070713_100179727 | Ga0070713_1001797272 | 184 |
| 167 | 3300005436 | Ga0070713_100446719 | Ga0070713_1004467191 | 184 |
| 168 | 3300005437 | Ga0070710_10000156 | Ga0070710_1000015616 | 184 |
| 169 | 3300005439 | Ga0070711_100001013 | Ga0070711_1000010137 | 184 |
| 170 | 3300005440 | Ga0070705_100108772 | Ga0070705_1001087722 | 184 |
| 171 | 3300005445 | Ga0070708_100009051 | Ga0070708_1000090512 | 184 |
| 172 | 3300005445 | Ga0070708_100622285 | Ga0070708_1006222851 | 184 |
| 173 | 3300005467 | Ga0070706_100002251 | Ga0070706_10000225117 | 184 |
| 174 | 3300005467 | Ga0070706_100011378 | Ga0070706_1000113782 | 184 |
| 175 | 3300005467 | Ga0070706_100089714 | Ga0070706_1000897142 | 184 |
| 176 | 3300005468 | Ga0070707_100001697 | Ga0070707_10000169714 | 184 |
| 177 | 3300005468 | Ga0070707_100004942 | Ga0070707_10000494213 | 184 |
| 178 | 3300005468 | Ga0070707_100007974 | Ga0070707_1000079743 | 184 |
| 179 | 3300005471 | Ga0070698_100003640 | Ga0070698_1000036406 | 184 |
| 180 | 3300005471 | Ga0070698_100102994 | Ga0070698_1001029942 | 184 |
| 181 | 3300005536 | Ga0070697_100028376 | Ga0070697_1000283762 | 184 |
| 182 | 3300005563 | Ga0068855_100250409 | Ga0068855_1002504092 | 184 |
| 183 | 3300005983 | Ga0081540_1001125 | Ga0081540_100112515 | 184 |
| 184 | 3300006028 | Ga0070717_10003117 | Ga0070717_1000311712 | 184 |
| 185 | 3300006163 | Ga0070715_10137568 | Ga0070715_101375681 | 184 |
| 186 | 3300006163 | Ga0070715_10189786 | Ga0070715_101897862 | 184 |
| 187 | 3300006173 | Ga0070716_100005401 | Ga0070716_1000054011 | 184 |
| 188 | 3300006173 | Ga0070716_100119323 | Ga0070716_1001193232 | 184 |
| 189 | 3300006852 | Ga0075433_10025524 | Ga0075433_100255246 | 184 |
| 190 | 3300006852 | Ga0075433_10173037 | Ga0075433_101730372 | 184 |
| 191 | 3300006871 | Ga0075434_100076453 | Ga0075434_1000764533 | 184 |
| 192 | 3300006871 | Ga0075434_100496438 | Ga0075434_1004964382 | 184 |
| 193 | 3300006914 | Ga0075436_100062217 | Ga0075436_1000622171 | 184 |
| 194 | 3300006914 | Ga0075436_100095378 | Ga0075436_1000953782 | 184 |
| 195 | 3300007076 | Ga0075435_100002359 | Ga0075435_1000023597 | 184 |
| 196 | 3300007076 | Ga0075435_100389071 | Ga0075435_1003890712 | 184 |
| 197 | 3300007076 | Ga0075435_100506953 | Ga0075435_1005069532 | 184 |
| 198 | 3300009098 | Ga0105245_10243814 | Ga0105245_102438142 | 184 |
| 199 | 3300009147 | Ga0114129_10009348 | Ga0114129_100093482 | 184 |
| 200 | 3300009174 | Ga0105241_10126179 | Ga0105241_101261791 | 184 |
| 201 | 3300013296 | Ga0157374_11151021 | Ga0157374_111510211 | 184 |
| 202 | 3300025898 | Ga0207692_10046850 | Ga0207692_100468503 | 184 |
| 203 | 3300025898 | Ga0207692_10123442 | Ga0207692_101234422 | 184 |
| 204 | 3300025905 | Ga0207685_10061489 | Ga0207685_100614892 | 184 |
| 205 | 3300025906 | Ga0207699_10000563 | Ga0207699_1000056312 | 184 |
| 206 | 3300025906 | Ga0207699_10042181 | Ga0207699_100421815 | 184 |
| 207 | 3300025910 | Ga0207684_10002393 | Ga0207684_100023939 | 184 |
| 208 | 3300025910 | Ga0207684_10003086 | Ga0207684_1000308617 | 184 |
| 209 | 3300025911 | Ga0207654_10237226 | Ga0207654_102372261 | 184 |
| 210 | 3300025916 | Ga0207663_10000822 | Ga0207663_100008227 | 184 |
| 211 | 3300025916 | Ga0207663_10001119 | Ga0207663_100011192 | 184 |
| 212 | 3300025922 | Ga0207646_10000470 | Ga0207646_100004709 | 184 |
| 213 | 3300025922 | Ga0207646_10015576 | Ga0207646_100155765 | 184 |
| 214 | 3300025928 | Ga0207700_10004933 | Ga0207700_100049336 | 184 |
| 215 | 3300025928 | Ga0207700_10025045 | Ga0207700_100250454 | 184 |
| 216 | 3300025928 | Ga0207700_10026702 | Ga0207700_100267023 | 184 |
| 217 | 3300025928 | Ga0207700_10788596 | Ga0207700_107885961 | 184 |
| 218 | 3300025929 | Ga0207664_10002078 | Ga0207664_100020783 | 184 |
| 219 | 3300025929 | Ga0207664_10022897 | Ga0207664_100228971 | 184 |
| 220 | 3300025929 | Ga0207664_10166928 | Ga0207664_101669282 | 184 |
| 221 | 3300025939 | Ga0207665_10000882 | Ga0207665_100008827 | 184 |
| 222 | 3300025939 | Ga0207665_10007304 | Ga0207665_100073048 | 184 |
| 223 | 3300025949 | Ga0207667_10258860 | Ga0207667_102588602 | 184 |
| 224 | 3300026078 | Ga0207702_10594613 | Ga0207702_105946132 | 184 |
| 225 | 3300026121 | Ga0207683_10622235 | Ga0207683_106222351 | 184 |
| 226 | 3300034817 | Ga0373948_0008068 | Ga0373948_0008068_439_1026 | 184 |
| 227 | 3300034819 | Ga0373958_0001609 | Ga0373958_0001609_31_618 | 184 |
| 228 | 3300034820 | Ga0373959_0008127 | Ga0373959_0008127_556_1143 | 184 |
| 229 | 3300034957 | Ga0373938_0008973 | Ga0373938_0008973_813_1400 | 184 |
| 230 | 3300035085 | Ga0373929_0003855 | Ga0373929_0003855_1414_2001 | 184 |
| 231 | 3300035086 | Ga0373934_0001926 | Ga0373934_0001926_6414_7001 | 184 |
| 232 | 3300035086 | Ga0373934_0026610 | Ga0373934_0026610_606_1193 | 184 |
| 233 | 3300035088 | Ga0373940_0006056 | Ga0373940_0006056_161_748 | 184 |
| 234 | 3300035089 | Ga0373944_0144923 | Ga0373944_0144923_67_654 | 184 |
| 235 | 3300035090 | Ga0373949_0014019 | Ga0373949_0014019_128_715 | 184 |
| 236 | 3300035091 | Ga0373951_0013850 | Ga0373951_0013850_501_1088 | 184 |
| 237 | 3300035092 | Ga0373952_0001767 | Ga0373952_0001767_1457_2044 | 184 |
| 238 | 3300035112 | Ga0373932_0007636 | Ga0373932_0007636_255_842 | 184 |
| 239 | 3300035113 | Ga0373936_0064662 | Ga0373936_0064662_891_1478 | 184 |
| 240 | 3300035114 | Ga0373939_0036425 | Ga0373939_0036425_610_1197 | 184 |
| 241 | 3300035115 | Ga0373941_0007261 | Ga0373941_0007261_1884_2471 | 184 |
| 242 | 3300035117 | Ga0373953_0038972 | Ga0373953_0038972_765_1352 | 184 |
| 243 | 3300035117 | Ga0373953_0097242 | Ga0373953_0097242_445_1032 | 184 |
| 244 | 3300035118 | Ga0373954_0013865 | Ga0373954_0013865_2822_3409 | 184 |
| 245 | 3300035119 | Ga0373956_0006785 | Ga0373956_0006785_3307_3894 | 184 |
| 246 | 3300035119 | Ga0373956_0006834 | Ga0373956_0006834_2934_3521 | 184 |
| 247 | 3300035120 | Ga0373957_0002550 | Ga0373957_0002550_3749_4336 | 184 |
| 248 | 3300035120 | Ga0373957_0070357 | Ga0373957_0070357_600_1187 | 184 |
| 249 | 3300035121 | Ga0373960_0115849 | Ga0373960_0115849_33_620 | 184 |
| 250 | 3300035170 | Ga0373943_0073705 | Ga0373943_0073705_508_1095 | 184 |
| 251 | 3300035171 | Ga0373946_0008811 | Ga0373946_0008811_1853_2440 | 184 |
| 252 | 3300035172 | Ga0373955_0028111 | Ga0373955_0028111_949_1536 | 184 |
| 253 | 3300035172 | Ga0373955_0039474 | Ga0373955_0039474_1881_2468 | 184 |
| 254 | 3300035207 | Ga0373942_0040476 | Ga0373942_0040476_507_1094 | 184 |
| 255 | 3300035241 | Ga0373961_0004281 | Ga0373961_0004281_2316_2903 | 184 |
| 256 | 3300035242 | Ga0373962_0066987 | Ga0373962_0066987_451_1038 | 184 |
| 257 | 3300035410 | Ga0373924_0015361 | Ga0373924_0015361_160_747 | 184 |
| 258 | 3300035410 | Ga0373924_0088825 | Ga0373924_0088825_632_1219 | 184 |
| 259 | 3300035691 | Ga0373931_0207876 | Ga0373931_0207876_357_944 | 184 |
| 260 | 3300035692 | Ga0373935_0029311 | Ga0373935_0029311_1614_2201 | 184 |
| 261 | 3300035692 | Ga0373935_0131923 | Ga0373935_0131923_999_1586 | 184 |
| 262 | 3300035724 | Ga0373933_0006584 | Ga0373933_0006584_2301_2888 | 184 |
| 263 | 3300035725 | Ga0373947_0154365 | Ga0373947_0154365_851_1438 | 184 |
| 264 | 3300036401 | Ga0373937_0004325 | Ga0373937_0004325_3824_4411 | 184 |
| 265 | 3300036401 | Ga0373937_0094927 | Ga0373937_0094927_1524_2111 | 184 |
| 266 | 3300037068 | Ga0373925_0011433 | Ga0373925_0011433_621_1208 | 184 |
| 267 | 3300037068 | Ga0373925_0144816 | Ga0373925_0144816_173_760 | 184 |
| 268 | 3300039437 | Ga0436365_0298795 | Ga0436365_0298795_2882_3478 | 184 |
| 269 | 3300039450 | Ga0436363_0632637 | Ga0436363_0632637_62_649 | 184 |
| 270 | 3300044735 | Ga0466968_0126894 | Ga0466968_0126894_370_957 | 184 |
| 271 | 3300045049 | Ga0466959_0096591 | Ga0466959_0096591_463_1050 | 184 |
| 272 | 3300046454 | Ga0495592_0223785 | Ga0495592_0223785_500_1087 | 184 |
| 273 | 3300046459 | Ga0495629_0010447 | Ga0495629_0010447_5003_5590 | 184 |
| 274 | 3300046461 | Ga0495641_0072977 | Ga0495641_0072977_513_1100 | 184 |
| 275 | 3300046462 | Ga0495651_0193220 | Ga0495651_0193220_504_1091 | 184 |
| 276 | 3300046463 | Ga0495653_0052012 | Ga0495653_0052012_1180_1767 | 184 |
| 277 | 3300046463 | Ga0495653_0061573 | Ga0495653_0061573_1869_2456 | 184 |
| 278 | 3300046476 | Ga0495662_0090406 | Ga0495662_0090406_166_753 | 184 |
| 279 | 3300046477 | Ga0495664_0007153 | Ga0495664_0007153_5338_5925 | 184 |
| 280 | 3300046511 | Ga0495608_0290403 | Ga0495608_0290403_11_598 | 184 |
| 281 | 3300046514 | Ga0495618_0018008 | Ga0495618_0018008_3737_4324 | 184 |
| 282 | 3300046514 | Ga0495618_0021311 | Ga0495618_0021311_2221_2808 | 184 |
| 283 | 3300046516 | Ga0495628_0021056 | Ga0495628_0021056_2169_2756 | 184 |
| 284 | 3300046516 | Ga0495628_0130712 | Ga0495628_0130712_1131_1718 | 184 |
| 285 | 3300046517 | Ga0495630_0101833 | Ga0495630_0101833_340_927 | 184 |
| 286 | 3300046526 | Ga0495666_0076415 | Ga0495666_0076415_573_1160 | 184 |
| 287 | 3300046529 | Ga0495652_0014267 | Ga0495652_0014267_3367_3954 | 184 |
| 288 | 3300046529 | Ga0495652_0237341 | Ga0495652_0237341_130_717 | 184 |
| 289 | 3300046529 | Ga0495652_0577920 | Ga0495652_0577920_163_750 | 184 |
| 290 | 3300046533 | Ga0495640_0049188 | Ga0495640_0049188_1258_1845 | 184 |
| 291 | 3300046535 | Ga0495586_0017828 | Ga0495586_0017828_1612_2199 | 184 |
| 292 | 3300046535 | Ga0495586_0030252 | Ga0495586_0030252_949_1536 | 184 |
| 293 | 3300046536 | Ga0495587_0008620 | Ga0495587_0008620_3538_4125 | 184 |
| 294 | 3300046536 | Ga0495587_0123226 | Ga0495587_0123226_476_1063 | 184 |
| 295 | 3300046543 | Ga0495645_0046362 | Ga0495645_0046362_720_1307 | 184 |
| 296 | 3300046543 | Ga0495645_0087227 | Ga0495645_0087227_1383_1970 | 184 |
| 297 | 3300046543 | Ga0495645_0202481 | Ga0495645_0202481_295_882 | 184 |
| 298 | 3300046559 | Ga0495667_0033214 | Ga0495667_0033214_520_1107 | 184 |
| 299 | 3300046559 | Ga0495667_0183337 | Ga0495667_0183337_416_1003 | 184 |
| 300 | 3300046642 | Ga0495634_0038005 | Ga0495634_0038005_1633_2220 | 184 |
| 301 | 3300046663 | Ga0495635_0079034 | Ga0495635_0079034_340_927 | 184 |
| 302 | 3300046663 | Ga0495635_0109729 | Ga0495635_0109729_1164_1751 | 184 |
| 303 | 3300046675 | Ga0495657_0007855 | Ga0495657_0007855_6867_7454 | 184 |
| 304 | 3300046675 | Ga0495657_0069628 | Ga0495657_0069628_1375_1962 | 184 |
| 305 | 3300046678 | Ga0495599_0026425 | Ga0495599_0026425_2907_3494 | 184 |
| 306 | 3300046678 | Ga0495599_0043674 | Ga0495599_0043674_1058_1645 | 184 |
| 307 | 3300046679 | Ga0495623_0009399 | Ga0495623_0009399_339_926 | 184 |
| 308 | 3300046679 | Ga0495623_0018208 | Ga0495623_0018208_868_1455 | 184 |
| 309 | 3300046680 | Ga0495646_0035868 | Ga0495646_0035868_1009_1596 | 184 |
| 310 | 3300046680 | Ga0495646_0145612 | Ga0495646_0145612_388_975 | 184 |
| 311 | 3300046681 | Ga0495647_0056653 | Ga0495647_0056653_889_1476 | 184 |
| 312 | 3300046683 | Ga0495658_0244854 | Ga0495658_0244854_260_847 | 184 |
| 313 | 3300046689 | Ga0495613_0050844 | Ga0495613_0050844_1932_2519 | 184 |
| 314 | 3300046690 | Ga0495624_0033878 | Ga0495624_0033878_1859_2446 | 184 |
| 315 | 3300046690 | Ga0495624_0084727 | Ga0495624_0084727_878_1465 | 184 |
| 316 | 3300047315 | Ga0495581_0026136 | Ga0495581_0026136_2151_2738 | 184 |
| 317 | 3300047317 | Ga0495604_0074011 | Ga0495604_0074011_504_1091 | 184 |
| 318 | 3300047317 | Ga0495604_0126016 | Ga0495604_0126016_520_1107 | 184 |
| 319 | 3300047319 | Ga0495674_0053174 | Ga0495674_0053174_2040_2627 | 184 |
| 320 | 3300047319 | Ga0495674_0329856 | Ga0495674_0329856_148_735 | 184 |
| 321 | 3300047322 | Ga0495680_0005150 | Ga0495680_0005150_1892_2479 | 184 |
| 322 | 3300047322 | Ga0495680_0045310 | Ga0495680_0045310_331_918 | 184 |
| 323 | 3300047444 | Ga0495675_0123406 | Ga0495675_0123406_765_1352 | 184 |
| 324 | 3300048088 | Ga0495602_0098455 | Ga0495602_0098455_289_876 | 184 |
| 325 | 3300048088 | Ga0495602_0155447 | Ga0495602_0155447_575_1162 | 184 |
| 326 | 3300048088 | Ga0495602_0231577 | Ga0495602_0231577_515_1102 | 184 |
| 327 | 3300048089 | Ga0495614_0037965 | Ga0495614_0037965_659_1246 | 184 |
| 328 | 3300048903 | Ga0496100_0278882 | Ga0496100_0278882_587_1174 | 184 |
| 329 | 3300048904 | Ga0496101_0095064 | Ga0496101_0095064_410_997 | 184 |
| 330 | 3300048905 | Ga0496102_0047115 | Ga0496102_0047115_1269_1856 | 184 |
| 331 | 3300048907 | Ga0496104_0280085 | Ga0496104_0280085_848_1435 | 184 |
| 332 | 3300048908 | Ga0496105_0023558 | Ga0496105_0023558_505_1092 | 184 |
| 333 | 3300048909 | Ga0496106_0119199 | Ga0496106_0119199_1075_1662 | 184 |
| 334 | 3300048910 | Ga0496107_0087690 | Ga0496107_0087690_743_1330 | 184 |
| 335 | 3300048911 | Ga0496108_0098906 | Ga0496108_0098906_634_1221 | 184 |
| 336 | 3300048915 | Ga0496112_0539636 | Ga0496112_0539636_251_838 | 184 |
| 337 | 3300048917 | Ga0496114_0071217 | Ga0496114_0071217_1028_1615 | 184 |
| 338 | 3300048918 | Ga0496115_0019992 | Ga0496115_0019992_1609_2196 | 184 |
| 339 | 3300050507 | nmdc:mga05p37_43016_c1 | nmdc:mga05p37_43016_c1_565_1185 | 184 |
| 340 | 3300050511 | nmdc:mga08y16_475396_c1 | nmdc:mga08y16_475396_c1_347_967 | 184 |
| 341 | 3300050512 | nmdc:mga0n895_26750_c1 | nmdc:mga0n895_26750_c1_1379_1966 | 184 |
| 342 | 3300050512 | nmdc:mga0n895_38113_c1 | nmdc:mga0n895_38113_c1_219_806 | 184 |
| 343 | 3300050513 | nmdc:mga0rr50_15996_c1 | nmdc:mga0rr50_15996_c1_2245_2832 | 184 |
| 344 | 3300050513 | nmdc:mga0rr50_183657_c1 | nmdc:mga0rr50_183657_c1_483_1070 | 184 |
| 345 | 3300050513 | nmdc:mga0rr50_271477_c1 | nmdc:mga0rr50_271477_c1_216_836 | 184 |
| 346 | 3300050514 | nmdc:mga08x19_138794_c1 | nmdc:mga08x19_138794_c1_613_1233 | 184 |
| 347 | 3300050514 | nmdc:mga08x19_274502_c1 | nmdc:mga08x19_274502_c1_309_896 | 184 |
| 348 | 3300050514 | nmdc:mga08x19_485940_c1 | nmdc:mga08x19_485940_c1_171_758 | 184 |
| 349 | 3300053077 | Ga0495601_0013113 | Ga0495601_0013113_1735_2322 | 184 |
| 350 | 3300053078 | Ga0495612_0016052 | Ga0495612_0016052_421_1008 | 184 |
| 351 | 3300053078 | Ga0495612_0089296 | Ga0495612_0089296_569_1156 | 184 |
| 352 | 3300053084 | Ga0495595_0026966 | Ga0495595_0026966_47_634 | 184 |
| 353 | 3300053085 | Ga0495619_0124379 | Ga0495619_0124379_223_810 | 184 |
| 354 | 3300005445 | Ga0070708_100508366 | Ga0070708_1005083662 | 186 |
| 355 | 3300005467 | Ga0070706_100640857 | Ga0070706_1006408571 | 186 |
| 356 | 3300005468 | Ga0070707_100090500 | Ga0070707_1000905003 | 186 |
| 357 | 3300005468 | Ga0070707_100283513 | Ga0070707_1002835132 | 186 |
| 358 | 3300005518 | Ga0070699_100858676 | Ga0070699_1008586761 | 186 |
| 359 | 3300005614 | Ga0068856_100148928 | Ga0068856_1001489284 | 186 |
| 360 | 3300005614 | Ga0068856_100246890 | Ga0068856_1002468902 | 186 |
| 361 | 3300006038 | Ga0075365_10045305 | Ga0075365_100453053 | 186 |
| 362 | 3300009093 | Ga0105240_10094884 | Ga0105240_100948842 | 186 |
| 363 | 3300009147 | Ga0114129_10119346 | Ga0114129_101193464 | 186 |
| 364 | 3300009545 | Ga0105237_10065060 | Ga0105237_100650603 | 186 |
| 365 | 3300009551 | Ga0105238_10284675 | Ga0105238_102846751 | 186 |
| 366 | 3300020069 | Ga0197907_10198624 | Ga0197907_101986242 | 186 |
| 367 | 3300020082 | Ga0206353_10600692 | Ga0206353_106006924 | 186 |
| 368 | 3300025910 | Ga0207684_10422838 | Ga0207684_104228382 | 186 |
| 369 | 3300025913 | Ga0207695_10254280 | Ga0207695_102542801 | 186 |
| 370 | 3300025922 | Ga0207646_10074591 | Ga0207646_100745914 | 186 |
| 371 | 3300025922 | Ga0207646_10214194 | Ga0207646_102141943 | 186 |
| 372 | 3300025929 | Ga0207664_10326266 | Ga0207664_103262662 | 186 |
| 373 | 3300025929 | Ga0207664_10651693 | Ga0207664_106516932 | 186 |
| 374 | 3300025949 | Ga0207667_10126269 | Ga0207667_101262693 | 186 |
| 375 | 3300026078 | Ga0207702_10116688 | Ga0207702_101166882 | 186 |
| 376 | 3300026142 | Ga0207698_10310033 | Ga0207698_103100332 | 186 |
| 377 | 3300026142 | Ga0207698_11328389 | Ga0207698_113283891 | 186 |
| 378 | 3300031548 | Ga0307408_100709644 | Ga0307408_1007096442 | 186 |
| 379 | 3300031731 | Ga0307405_10381253 | Ga0307405_103812532 | 186 |
| 380 | 3300031824 | Ga0307413_10577508 | Ga0307413_105775081 | 186 |
| 381 | 3300031852 | Ga0307410_10279010 | Ga0307410_102790102 | 186 |
| 382 | 3300031901 | Ga0307406_10275136 | Ga0307406_102751362 | 186 |
| 383 | 3300031903 | Ga0307407_10491035 | Ga0307407_104910352 | 186 |
| 384 | 3300031995 | Ga0307409_100105371 | Ga0307409_1001053712 | 186 |
| 385 | 3300032004 | Ga0307414_10372629 | Ga0307414_103726292 | 186 |
| 386 | 3300032005 | Ga0307411_10400730 | Ga0307411_104007302 | 186 |
| 387 | 3300032126 | Ga0307415_100307273 | Ga0307415_1003072732 | 186 |
| 388 | 3300037418 | Ga0395900_0346494 | Ga0395900_0346494_724_1317 | 186 |
| 389 | 3300039450 | Ga0436363_1208389 | Ga0436363_1208389_16_609 | 186 |
| 390 | 3300044683 | Ga0466965_0117141 | Ga0466965_0117141_567_1178 | 186 |
| 391 | 3300044684 | Ga0466966_0009536 | Ga0466966_0009536_1692_2285 | 186 |
| 392 | 3300044684 | Ga0466966_0101495 | Ga0466966_0101495_766_1359 | 186 |
| 393 | 3300044693 | Ga0466961_0022970 | Ga0466961_0022970_3314_3907 | 186 |
| 394 | 3300044693 | Ga0466961_0082949 | Ga0466961_0082949_765_1358 | 186 |
| 395 | 3300044693 | Ga0466961_0254791 | Ga0466961_0254791_341_934 | 186 |
| 396 | 3300044694 | Ga0466963_0006979 | Ga0466963_0006979_269_868 | 186 |
| 397 | 3300044694 | Ga0466963_0017699 | Ga0466963_0017699_1420_2013 | 186 |
| 398 | 3300044694 | Ga0466963_0681429 | Ga0466963_0681429_22_615 | 186 |
| 399 | 3300044706 | Ga0466964_0002467 | Ga0466964_0002467_4043_4636 | 186 |
| 400 | 3300044706 | Ga0466964_0064259 | Ga0466964_0064259_283_876 | 186 |
| 401 | 3300044735 | Ga0466968_0038287 | Ga0466968_0038287_765_1358 | 186 |
| 402 | 3300044765 | Ga0466970_0047309 | Ga0466970_0047309_571_1164 | 186 |
| 403 | 3300044765 | Ga0466970_0151682 | Ga0466970_0151682_251_844 | 186 |
| 404 | 3300044842 | Ga0466957_0020934 | Ga0466957_0020934_2847_3440 | 186 |
| 405 | 3300044901 | Ga0466960_0096369 | Ga0466960_0096369_467_1060 | 186 |
| 406 | 3300045049 | Ga0466959_0015491 | Ga0466959_0015491_4622_5215 | 186 |
| 407 | 3300045836 | Ga0466958_0134424 | Ga0466958_0134424_298_891 | 186 |
| 408 | 3300045976 | Ga0466967_0003844 | Ga0466967_0003844_4569_5168 | 186 |
| 409 | 3300045976 | Ga0466967_0012928 | Ga0466967_0012928_830_1423 | 186 |
| 410 | 3300045976 | Ga0466967_0061841 | Ga0466967_0061841_195_788 | 186 |
| 411 | 3300045976 | Ga0466967_0343112 | Ga0466967_0343112_437_1030 | 186 |
| 412 | 3300046533 | Ga0495640_0249959 | Ga0495640_0249959_326_919 | 186 |
| 413 | 3300048911 | Ga0496108_0191748 | Ga0496108_0191748_492_1094 | 186 |
| 414 | 3300049568 | Ga0501031_0032757 | Ga0501031_0032757_1564_2157 | 186 |
| 415 | 3300049568 | Ga0501031_0203690 | Ga0501031_0203690_665_1276 | 186 |
| 416 | 3300049569 | Ga0501032_0011504 | Ga0501032_0011504_3591_4184 | 186 |
| 417 | 3300049570 | Ga0501033_0144188 | Ga0501033_0144188_1036_1641 | 186 |
| 418 | 3300049570 | Ga0501033_0177992 | Ga0501033_0177992_728_1321 | 186 |
| 419 | 3300049571 | Ga0501034_0013123 | Ga0501034_0013123_3643_4236 | 186 |
| 420 | 3300049572 | Ga0501036_0308448 | Ga0501036_0308448_42_635 | 186 |
| 421 | 3300049573 | Ga0501037_0034880 | Ga0501037_0034880_2488_3081 | 186 |
| 422 | 3300049574 | Ga0501038_0008112 | Ga0501038_0008112_2472_3065 | 186 |
| 423 | 3300049579 | Ga0501043_0017479 | Ga0501043_0017479_1746_2339 | 186 |
| 424 | 3300049580 | Ga0501046_0094453 | Ga0501046_0094453_256_849 | 186 |
| 425 | 3300049581 | Ga0501047_0013453 | Ga0501047_0013453_2892_3485 | 186 |
| 426 | 3300049582 | Ga0501048_0000017 | Ga0501048_0000017_64922_65515 | 186 |
| 427 | 3300049583 | Ga0501067_0272343 | Ga0501067_0272343_224_817 | 186 |
| 428 | 3300049586 | Ga0501070_0042575 | Ga0501070_0042575_396_989 | 186 |
| 429 | 3300049586 | Ga0501070_0211775 | Ga0501070_0211775_587_1201 | 186 |
| 430 | 3300049742 | Ga0501080_0368691 | Ga0501080_0368691_511_1104 | 186 |
| 431 | 3300049822 | Ga0501035_0023468 | Ga0501035_0023468_1139_1732 | 186 |
| 432 | 3300049822 | Ga0501035_0105015 | Ga0501035_0105015_461_1066 | 186 |
| 433 | 3300049823 | Ga0501044_0005946 | Ga0501044_0005946_2228_2821 | 186 |
| 434 | 3300049823 | Ga0501044_0164545 | Ga0501044_0164545_216_821 | 186 |
| 435 | 3300049824 | Ga0501045_0314244 | Ga0501045_0314244_329_922 | 186 |
| 436 | 3300050492 | nmdc:mga0yw44_2602_c1 | nmdc:mga0yw44_2602_c1_1858_2469 | 186 |
| 437 | 3300050496 | nmdc:mga07m45_43084_c1 | nmdc:mga07m45_43084_c1_254_865 | 186 |
| 438 | 3300061719 | Ga0466962_0012605 | Ga0466962_0012605_824_1417 | 186 |
| 439 | iso_pu_bacteria | 8056054917 | 8056055041 | 186 |
| 440 | 3300025900 | Ga0207710_10018858 | Ga0207710_100188582 | 187 |
| 441 | 3300048903 | Ga0496100_0588745 | Ga0496100_0588745_219_815 | 187 |
| 442 | 3300048905 | Ga0496102_0000072 | Ga0496102_0000072_67726_68322 | 187 |
| 443 | 3300048906 | Ga0496103_0000053 | Ga0496103_0000053_144529_145125 | 187 |
| 444 | 3300048909 | Ga0496106_0674089 | Ga0496106_0674089_175_771 | 187 |
| 445 | 3300048920 | Ga0496117_0158894 | Ga0496117_0158894_16_612 | 187 |
| 446 | 3300048921 | Ga0496118_0019577 | Ga0496118_0019577_936_1532 | 187 |
| 447 | 3300048922 | Ga0496119_0041354 | Ga0496119_0041354_2287_2883 | 187 |
| 448 | 3300048924 | Ga0496121_0028152 | Ga0496121_0028152_4537_5133 | 187 |
| 449 | 3300049679 | Ga0501249_075606 | Ga0501249_075606_163_756 | 187 |
| 450 | 3300053161 | Ga0500634_0303527 | Ga0500634_0303527_27_620 | 187 |
| 451 | iso_pu_bacteria | 2861520306 | 2861520943 | 187 |
| 452 | iso_pu_bacteria | 8057568493 | 8057568659 | 187 |
| 453 | 3300006847 | Ga0075431_100042289 | Ga0075431_1000422892 | 189 |
| 454 | 3300050510 | nmdc:mga06r32_21177_c1 | nmdc:mga06r32_21177_c1_1185_1787 | 189 |
| 455 | iso_pu_bacteria | 2501939600 | 2501944214 | 189 |
| 456 | iso_pu_bacteria | 2515154129 | 2515719166 | 189 |
| 457 | iso_pu_bacteria | 2515154202 | 2516083373 | 189 |
| 458 | iso_pu_bacteria | 2751185782 | 2753268277 | 189 |
| 459 | iso_pu_bacteria | 2831935698 | 2831936260 | 189 |
| 460 | iso_pu_bacteria | 2832004796 | 2832010483 | 189 |
| 461 | iso_pu_bacteria | 2855670206 | 2855676467 | 189 |
| 462 | iso_pu_bacteria | 2855676851 | 2855678611 | 189 |
| 463 | iso_pu_bacteria | 2855683550 | 2855684694 | 189 |
| 464 | iso_pu_bacteria | 2856858025 | 2856864452 | 189 |
| 465 | iso_pu_bacteria | 2857288857 | 2857294571 | 189 |
| 466 | iso_pu_bacteria | 2858848962 | 2858852049 | 189 |
| 467 | iso_pu_bacteria | 2858868258 | 2858872932 | 189 |
| 468 | iso_pu_bacteria | 2858882152 | 2858888695 | 189 |
| 469 | iso_pu_bacteria | 2858888857 | 2858888949 | 189 |
| 470 | iso_pu_bacteria | 2858895516 | 2858897457 | 189 |
| 471 | iso_pu_bacteria | 2858902515 | 2858905724 | 189 |
| 472 | iso_pu_bacteria | 2866065130 | 2866070292 | 189 |
| 473 | iso_pu_bacteria | 2867302475 | 2867303569 | 189 |
| 474 | iso_pu_bacteria | 2867312974 | 2867316078 | 189 |
| 475 | iso_pu_bacteria | 2867319477 | 2867320944 | 189 |
| 476 | iso_pu_bacteria | 2867507094 | 2867511803 | 189 |
| 477 | iso_pu_bacteria | 2869048445 | 2869050969 | 189 |
| 478 | iso_pu_bacteria | 2869061728 | 2869063641 | 189 |
| 479 | iso_pu_bacteria | 2869068681 | 2869074187 | 189 |
| 480 | iso_pu_bacteria | 2880489317 | 2880489713 | 189 |
| 481 | iso_pu_bacteria | 2880495981 | 2880495989 | 189 |
| 482 | iso_pu_bacteria | 2887478801 | 2887481173 | 189 |
| 483 | iso_pu_bacteria | 2902582711 | 2902583467 | 189 |
| 484 | iso_pu_bacteria | 2929219909 | 2929224663 | 189 |
| 485 | iso_pu_bacteria | 2929226422 | 2929232396 | 189 |
| 486 | iso_pu_bacteria | 2996221748 | 2996227602 | 189 |
| 487 | iso_pu_bacteria | 649633069 | 649814020 | 189 |
| 488 | iso_pu_bacteria | 8003830390 | 8003836143 | 189 |
| 489 | iso_pu_bacteria | 8003870546 | 8003873565 | 189 |
| 490 | iso_pu_bacteria | 8054704163 | 8054707802 | 189 |
| 491 | iso_pu_bacteria | 8054727385 | 8054732754 | 189 |
| 492 | iso_pu_bacteria | 8054734606 | 8054737972 | 189 |
| 493 | iso_pu_bacteria | 8055412473 | 8055413475 | 189 |
| 494 | 3300006844 | Ga0075428_100000182 | Ga0075428_10000018223 | 190 |
| 495 | 3300030731 | Ga0316177_1122181 | Ga0316177_11221812 | 190 |
| 496 | 3300030733 | Ga0314311_1119181 | Ga0314311_11191812 | 190 |
| 497 | 3300030744 | Ga0316181_1275879 | Ga0316181_12758793 | 190 |
| 498 | 3300031456 | Ga0307513_10000001 | Ga0307513_100000011296 | 190 |
| 499 | 3300041404 | Ga0439436_0013256 | Ga0439436_0013256_1086_1694 | 190 |
| 500 | 3300041405 | Ga0439438_063712 | Ga0439438_063712_138_746 | 190 |
| 501 | 3300042007 | Ga0439449_0002778 | Ga0439449_0002778_4822_5430 | 190 |
| 502 | 3300042014 | Ga0439457_012549 | Ga0439457_012549_573_1181 | 190 |
| 503 | 3300042145 | Ga0450906_033896 | Ga0450906_033896_65_673 | 190 |
| 504 | 3300042146 | Ga0450907_005944 | Ga0450907_005944_355_963 | 190 |
| 505 | iso_pu_bacteria | 2675903059 | 2676483589 | 190 |
| 506 | 3300005347 | Ga0070668_100009783 | Ga0070668_1000097834 | 192 |
| 507 | 3300009098 | Ga0105245_11784200 | Ga0105245_117842001 | 192 |
| 508 | 3300025972 | Ga0207668_10003312 | Ga0207668_100033126 | 192 |
| 509 | 3300037312 | Ga0395899_0064228 | Ga0395899_0064228_1875_2483 | 192 |
| 510 | 3300037418 | Ga0395900_0024817 | Ga0395900_0024817_5213_5821 | 192 |
| 511 | 3300037466 | Ga0395898_0038018 | Ga0395898_0038018_3463_4071 | 192 |
| 512 | 3300037471 | Ga0395905_0040635 | Ga0395905_0040635_2888_3496 | 192 |
| 513 | 3300038443 | Ga0395901_0045358 | Ga0395901_0045358_2823_3431 | 192 |
| 514 | 3300044842 | Ga0466957_0057509 | Ga0466957_0057509_774_1385 | 192 |
| 515 | 3300046507 | Ga0495606_0004365 | Ga0495606_0004365_1767_2390 | 192 |
| 516 | 3300046616 | Ga0495668_0000464 | Ga0495668_0000464_23821_24444 | 192 |
| 517 | 3300046660 | Ga0495625_0000677 | Ga0495625_0000677_27450_28073 | 192 |
| 518 | 3300048091 | Ga0495626_0000184 | Ga0495626_0000184_55246_55869 | 192 |
| 519 | 3300049569 | Ga0501032_0058074 | Ga0501032_0058074_765_1433 | 192 |
| 520 | 3300049571 | Ga0501034_0083969 | Ga0501034_0083969_1145_1813 | 192 |
| 521 | 3300049572 | Ga0501036_0196314 | Ga0501036_0196314_512_1180 | 192 |
| 522 | 3300049573 | Ga0501037_0122675 | Ga0501037_0122675_483_1151 | 192 |
| 523 | 3300049574 | Ga0501038_0076579 | Ga0501038_0076579_1279_1947 | 192 |
| 524 | 3300049575 | Ga0501039_0037135 | Ga0501039_0037135_2468_3136 | 192 |
| 525 | 3300049579 | Ga0501043_0134383 | Ga0501043_0134383_1055_1723 | 192 |
| 526 | 3300049580 | Ga0501046_0047422 | Ga0501046_0047422_1041_1709 | 192 |
| 527 | 3300049581 | Ga0501047_0064555 | Ga0501047_0064555_1115_1783 | 192 |
| 528 | 3300049582 | Ga0501048_0141628 | Ga0501048_0141628_149_817 | 192 |
| 529 | 3300049585 | Ga0501069_0057226 | Ga0501069_0057226_340_1008 | 192 |
| 530 | 3300049589 | Ga0501073_0377847 | Ga0501073_0377847_16_684 | 192 |
| 531 | 3300049590 | Ga0501074_0283539 | Ga0501074_0283539_132_800 | 192 |
| 532 | 3300049742 | Ga0501080_0199188 | Ga0501080_0199188_145_813 | 192 |
| 533 | 3300049822 | Ga0501035_0043976 | Ga0501035_0043976_1203_1871 | 192 |
| 534 | 3300003203 | JGI25406J46586_10042849 | JGI25406J46586_100428491 | 193 |
| 535 | 3300003203 | JGI25406J46586_10080278 | JGI25406J46586_100802782 | 193 |
| 536 | 3300005338 | Ga0068868_100199682 | Ga0068868_1001996822 | 193 |
| 537 | 3300005355 | Ga0070671_100184760 | Ga0070671_1001847601 | 193 |
| 538 | 3300005367 | Ga0070667_100059665 | Ga0070667_1000596655 | 193 |
| 539 | 3300005455 | Ga0070663_100784821 | Ga0070663_1007848211 | 193 |
| 540 | 3300005530 | Ga0070679_100522648 | Ga0070679_1005226481 | 193 |
| 541 | 3300005548 | Ga0070665_100620283 | Ga0070665_1006202832 | 193 |
| 542 | 3300005548 | Ga0070665_101125307 | Ga0070665_1011253072 | 193 |
| 543 | 3300005617 | Ga0068859_100104853 | Ga0068859_1001048534 | 193 |
| 544 | 3300005841 | Ga0068863_100087639 | Ga0068863_1000876393 | 193 |
| 545 | 3300005843 | Ga0068860_100042129 | Ga0068860_1000421295 | 193 |
| 546 | 3300005844 | Ga0068862_100062137 | Ga0068862_1000621376 | 193 |
| 547 | 3300005937 | Ga0081455_10183459 | Ga0081455_101834591 | 193 |
| 548 | 3300005985 | Ga0081539_10000385 | Ga0081539_1000038579 | 193 |
| 549 | 3300005985 | Ga0081539_10000406 | Ga0081539_1000040631 | 193 |
| 550 | 3300005985 | Ga0081539_10001654 | Ga0081539_1000165421 | 193 |
| 551 | 3300005985 | Ga0081539_10004523 | Ga0081539_100045235 | 193 |
| 552 | 3300005985 | Ga0081539_10022628 | Ga0081539_100226281 | 193 |
| 553 | 3300005985 | Ga0081539_10027574 | Ga0081539_100275744 | 193 |
| 554 | 3300006237 | Ga0097621_100616732 | Ga0097621_1006167322 | 193 |
| 555 | 3300006847 | Ga0075431_100438078 | Ga0075431_1004380782 | 193 |
| 556 | 3300006931 | Ga0097620_100104854 | Ga0097620_1001048544 | 193 |
| 557 | 3300009092 | Ga0105250_10214143 | Ga0105250_102141432 | 193 |
| 558 | 3300009098 | Ga0105245_11002780 | Ga0105245_110027802 | 193 |
| 559 | 3300009147 | Ga0114129_10000744 | Ga0114129_1000074436 | 193 |
| 560 | 3300009545 | Ga0105237_10836927 | Ga0105237_108369273 | 193 |
| 561 | 3300010375 | Ga0105239_10967987 | Ga0105239_109679873 | 193 |
| 562 | 3300013297 | Ga0157378_10293501 | Ga0157378_102935013 | 193 |
| 563 | 3300014968 | Ga0157379_10347953 | Ga0157379_103479533 | 193 |
| 564 | 3300025908 | Ga0207643_10301319 | Ga0207643_103013192 | 193 |
| 565 | 3300025909 | Ga0207705_10508098 | Ga0207705_105080982 | 193 |
| 566 | 3300025918 | Ga0207662_10232618 | Ga0207662_102326182 | 193 |
| 567 | 3300025925 | Ga0207650_10612055 | Ga0207650_106120552 | 193 |
| 568 | 3300025960 | Ga0207651_10919248 | Ga0207651_109192481 | 193 |
| 569 | 3300025986 | Ga0207658_10036320 | Ga0207658_100363202 | 193 |
| 570 | 3300026035 | Ga0207703_10214162 | Ga0207703_102141622 | 193 |
| 571 | 3300026088 | Ga0207641_10480478 | Ga0207641_104804782 | 193 |
| 572 | 3300026118 | Ga0207675_100466336 | Ga0207675_1004663362 | 193 |
| 573 | 3300026121 | Ga0207683_10338448 | Ga0207683_103384482 | 193 |
| 574 | 3300028380 | Ga0268265_10093589 | Ga0268265_100935892 | 193 |
| 575 | 3300028381 | Ga0268264_10082729 | Ga0268264_100827293 | 193 |
| 576 | 3300028786 | Ga0307517_10084573 | Ga0307517_100845736 | 193 |
| 577 | 3300028786 | Ga0307517_10237093 | Ga0307517_102370932 | 193 |
| 578 | 3300028794 | Ga0307515_10002200 | Ga0307515_1000220033 | 193 |
| 579 | 3300028794 | Ga0307515_10010401 | Ga0307515_100104013 | 193 |
| 580 | 3300030522 | Ga0307512_10004194 | Ga0307512_100041946 | 193 |
| 581 | 3300030522 | Ga0307512_10004480 | Ga0307512_100044806 | 193 |
| 582 | 3300031456 | Ga0307513_10023131 | Ga0307513_100231314 | 193 |
| 583 | 3300031456 | Ga0307513_10046108 | Ga0307513_100461084 | 193 |
| 584 | 3300031507 | Ga0307509_10002147 | Ga0307509_100021476 | 193 |
| 585 | 3300031507 | Ga0307509_10248430 | Ga0307509_102484302 | 193 |
| 586 | 3300031548 | Ga0307408_100013342 | Ga0307408_1000133424 | 193 |
| 587 | 3300031616 | Ga0307508_10001138 | Ga0307508_1000113813 | 193 |
| 588 | 3300031616 | Ga0307508_10005883 | Ga0307508_100058834 | 193 |
| 589 | 3300031616 | Ga0307508_10108590 | Ga0307508_101085902 | 193 |
| 590 | 3300031730 | Ga0307516_10079584 | Ga0307516_100795843 | 193 |
| 591 | 3300031730 | Ga0307516_10100183 | Ga0307516_101001831 | 193 |
| 592 | 3300031852 | Ga0307410_10111168 | Ga0307410_101111684 | 193 |
| 593 | 3300031852 | Ga0307410_10179954 | Ga0307410_101799542 | 193 |
| 594 | 3300031889 | Ga0326468_10000912 | Ga0326468_100009122 | 193 |
| 595 | 3300031995 | Ga0307409_100013557 | Ga0307409_1000135577 | 193 |
| 596 | 3300032002 | Ga0307416_100051915 | Ga0307416_1000519153 | 193 |
| 597 | 3300032005 | Ga0307411_10141253 | Ga0307411_101412533 | 193 |
| 598 | 3300032126 | Ga0307415_100113398 | Ga0307415_1001133982 | 193 |
| 599 | 3300032126 | Ga0307415_100360078 | Ga0307415_1003600782 | 193 |
| 600 | 3300033179 | Ga0307507_10093132 | Ga0307507_100931323 | 193 |
| 601 | 3300033179 | Ga0307507_10162155 | Ga0307507_101621552 | 193 |
| 602 | 3300033180 | Ga0307510_10186421 | Ga0307510_101864214 | 193 |
| 603 | 3300034817 | Ga0373948_0014954 | Ga0373948_0014954_220_831 | 193 |
| 604 | 3300034818 | Ga0373950_0047944 | Ga0373950_0047944_95_706 | 193 |
| 605 | 3300034957 | Ga0373938_0020761 | Ga0373938_0020761_304_915 | 193 |
| 606 | 3300035088 | Ga0373940_0011319 | Ga0373940_0011319_527_1138 | 193 |
| 607 | 3300035091 | Ga0373951_0000194 | Ga0373951_0000194_13163_13774 | 193 |
| 608 | 3300035112 | Ga0373932_0074181 | Ga0373932_0074181_66_677 | 193 |
| 609 | 3300035207 | Ga0373942_0000437 | Ga0373942_0000437_1375_1986 | 193 |
| 610 | 3300035692 | Ga0373935_0017285 | Ga0373935_0017285_3751_4362 | 193 |
| 611 | 3300037312 | Ga0395899_0097524 | Ga0395899_0097524_756_1367 | 193 |
| 612 | 3300037418 | Ga0395900_0033302 | Ga0395900_0033302_790_1401 | 193 |
| 613 | 3300037466 | Ga0395898_0094652 | Ga0395898_0094652_1021_1632 | 193 |
| 614 | 3300042016 | Ga0439463_059187 | Ga0439463_059187_39_650 | 193 |
| 615 | 3300042438 | Ga0439459_0021566 | Ga0439459_0021566_115_726 | 193 |
| 616 | 3300042438 | Ga0439459_0081129 | Ga0439459_0081129_119_733 | 193 |
| 617 | 3300045976 | Ga0466967_0136212 | Ga0466967_0136212_432_1043 | 193 |
| 618 | 3300046460 | Ga0495638_0178870 | Ga0495638_0178870_117_728 | 193 |
| 619 | 3300046475 | Ga0495639_0172570 | Ga0495639_0172570_386_997 | 193 |
| 620 | 3300046519 | Ga0495632_0013760 | Ga0495632_0013760_1221_1832 | 193 |
| 621 | 3300048911 | Ga0496108_0000481 | Ga0496108_0000481_3489_4100 | 193 |
| 622 | 3300050507 | nmdc:mga05p37_452_c1 | nmdc:mga05p37_452_c1_3166_3777 | 193 |
| 623 | 3300050507 | nmdc:mga05p37_552421_c1 | nmdc:mga05p37_552421_c1_13_639 | 193 |
| 624 | 3300053088 | Ga0500644_0086478 | Ga0500644_0086478_223_834 | 193 |
| 625 | 3300053092 | Ga0500583_0257831 | Ga0500583_0257831_76_687 | 193 |
| 626 | 3300053093 | Ga0500651_0053664 | Ga0500651_0053664_440_1051 | 193 |
| 627 | 3300053096 | Ga0500641_0036683 | Ga0500641_0036683_336_947 | 193 |
| 628 | 3300053098 | Ga0500650_0279212 | Ga0500650_0279212_48_659 | 193 |
| 629 | 3300053104 | Ga0500556_0054579 | Ga0500556_0054579_166_777 | 193 |
| 630 | 3300053136 | Ga0500559_0056050 | Ga0500559_0056050_295_906 | 193 |
| 631 | 3300053146 | Ga0500588_0211500 | Ga0500588_0211500_15_626 | 193 |
| 632 | 3300053149 | Ga0500600_0144881 | Ga0500600_0144881_500_1111 | 193 |
| 633 | 3300053159 | Ga0500630_020876 | Ga0500630_020876_922_1533 | 193 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ae8-assembly1.cif.gz_B | crystal structure of imidazoleglycerol-phosphate dehydratase from staphylococcus aureus subsp. aureus n315 | 0.8472 | 5 | 178 |
| 2ae8-assembly1.cif.gz_E | crystal structure of imidazoleglycerol-phosphate dehydratase from staphylococcus aureus subsp. aureus n315 | 0.8413 | 5 | 178 |
| 2ae8-assembly1.cif.gz_B | crystal structure of imidazoleglycerol-phosphate dehydratase from staphylococcus aureus subsp. aureus n315 | 0.8376 | 5 | 178 |
| 2f1d-assembly1.cif.gz_D | x-ray structure of imidazoleglycerol-phosphate dehydratase | 0.835 | 3 | 180 |
| 2ae8-assembly1.cif.gz_E | crystal structure of imidazoleglycerol-phosphate dehydratase from staphylococcus aureus subsp. aureus n315 | 0.8317 | 5 | 178 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f1dA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9389 | 81 | 180 | 3.30.230.40 |
| 2ae8A02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.935 | 81 | 178 | 3.30.230.40 |
| 2f1dA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9293 | 81 | 180 | 3.30.230.40 |
| 2ae8A02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9251 | 81 | 178 | 3.30.230.40 |
| 1rhyA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9011 | 81 | 175 | 3.30.230.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7R8WT62-F1-model_v4 | Uncharacterized protein | 0.9777 | 68 | 147 |
GO:0000105
GO:0004424 |
| AF-A0A7C6DMZ1-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 0.9776 | 22 | 140 |
GO:0000105
GO:0004424 |
| AF-A0A534ZHA0-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) | 0.9747 | 45 | 143 |
GO:0000105
GO:0004424 |
| AF-A0A378VWE9-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase (IGPD) (EC 4.2.1.19) | 0.9741 | 31 | 137 |
GO:0000105
GO:0004424 |
| AF-A0A3D2R5Q6-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 0.9739 | 28 | 137 |
GO:0000105
GO:0004424 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar