metagRoot

F471098

General Info

Members	Datasets	Scaffolds	Average Seq Length
633	398	1266	220

Family's Representative Sequence

Representative Sequence	3300037853\|Ga0436364_0691871\|Ga0436364_0691871_2327_3112
Length	261
Sequence	MIVMGRLRFRHPMEVDRLKFALVFLATPWLILHTENLSGGATMTLQLGDKAPDFEAETTQGKIRFHDWIGNSWCVLFSHPKDFTPVCTTELGYMAKLKPEFDKRNTKIIGLSVDPVTNHAKWAKDIEEIQGTAPNYPMIGDTDLSISKAYGMLPASTSGTSEGRTPADNQTVRNVFVIAPDKTIKLIIVYPMTTGRNFDEVLRVLDSLQMTAKHKVSTPVNWMPGEDVIIAGSVSDEEAKKIYPQGWKAPRPWMRIVPQPR

Samples

	Sample ID	Description	Type	Environment
1	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
2	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
3	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
4	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
5	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
6	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
7	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
8	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
9	3300003373	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
10	3300004801	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
11	3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
12	3300005277	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2)	Metagenome	Rhizosphere
13	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
14	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
15	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
16	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
17	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
18	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
19	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
20	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
21	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
22	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
23	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
24	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
25	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
26	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
27	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
28	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
29	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
30	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
31	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
32	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
33	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
34	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
35	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
36	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
37	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
38	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
39	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
40	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
41	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
42	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
43	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
44	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
45	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
46	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
47	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
48	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
49	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
50	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
51	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
52	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
53	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
54	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
55	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
56	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
57	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
58	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
59	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
60	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
61	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
62	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
63	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
64	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
65	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
66	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
67	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
68	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
69	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
70	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
71	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
72	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
73	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
74	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
75	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
76	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
77	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
78	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
79	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
80	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
81	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
82	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
83	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
84	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
85	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
86	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
87	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
88	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
89	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
90	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
91	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
92	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
93	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
94	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
95	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
96	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
97	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
98	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
99	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
100	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
101	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
102	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
103	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
104	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
105	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
106	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
107	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
108	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
109	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
110	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
111	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
112	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
113	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
114	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
115	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
116	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
117	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
118	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
119	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
120	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
121	3300012505	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610	Metagenome	Rhizosphere
122	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
123	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
124	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
125	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
126	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
127	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
128	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
129	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
130	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
131	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
132	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
133	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
134	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
135	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
136	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
137	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
138	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
139	3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
140	3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3)	Metatranscriptome	Rhizosphere
141	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
142	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
143	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
144	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
145	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
146	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
147	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
148	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
149	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
150	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
151	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
152	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
217	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
219	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
221	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
222	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
223	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
224	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
225	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
226	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
227	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
228	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
229	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
230	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
231	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
232	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
233	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
234	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
235	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
236	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
237	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
238	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
239	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
240	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
241	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
242	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
243	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
244	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
245	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
246	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
247	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
248	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
249	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
250	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
251	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
252	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
253	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
254	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
255	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
256	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
257	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
258	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
259	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
260	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
261	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
262	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
263	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
264	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
265	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
266	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
267	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
268	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
269	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
270	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
271	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
272	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
273	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
274	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
275	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
276	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
277	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
278	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
279	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
280	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
281	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
282	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
283	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
284	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
285	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
286	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
287	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
288	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
289	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
290	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
291	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
292	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
293	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
294	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
295	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
296	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
297	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
298	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
299	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
300	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
301	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
302	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
303	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
304	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
305	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
306	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
307	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
308	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
309	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
310	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
311	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
312	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
313	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
314	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
315	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
316	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
317	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
318	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
319	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
320	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
321	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
322	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
323	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
324	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
325	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
326	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
327	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
328	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
329	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
330	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
331	3300049688	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought	Metagenome	Rhizosphere
332	3300049690	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought	Metagenome	Rhizosphere
333	3300049708	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control	Metagenome	Rhizosphere
334	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
335	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
336	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
337	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
338	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
339	3300049779	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought	Metagenome	Rhizosphere
340	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
341	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
342	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
343	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
344	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
345	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
346	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
347	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
348	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
349	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
350	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
351	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
352	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
353	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
354	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
355	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
356	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
357	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
358	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
359	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
360	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
361	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
362	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
363	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
364	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
365	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
366	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
367	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
368	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
369	3300059508	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
370	3300059647	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
371	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
372	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
373	2508501050	Microvirga lupini Lut6	Isolate	Nodule
374	2508501114	Microvirga lotononidis WSM3557	Isolate	Nodule
375	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
376	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
377	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
378	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
379	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
380	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
381	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
382	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
383	2773857925	Microvirga vignae BR3299	Isolate	Unclassified
384	2882456835	Microvirga sp. KLBC 81	Isolate	Unclassified
385	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
386	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
387	2894232714	Microvirga tunisiensis Lmie10	Isolate	Nodule
388	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
389	2904699407
390	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
391	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
392	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
393	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
394	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
395	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
396	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
397	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
398	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	92.56
Metatranscriptomes	3.48
Isolates	3.96

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	6.79
Nodule	2.69
Rhizoplane	4.74
Rhizosphere	80.25
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0436364_0691871	3300037853	Bacteria	6222
2	JGI24739J22299_10082463	3300001989	Bacteria	986
3	JGI24737J22298_10020075	3300001990	Bacteria	2135
4	JGI24743J22301_10016214	3300001991	Bacteria	1388
5	JGI24750J21931_1008362	3300002070	Bacteria	1315
6	JGI24738J21930_10012017	3300002075	Bacteria	1895
7	JGI24749J21850_1008892	3300002076	Bacteria	1402
8	JGI24742J22300_10019858	3300002244	Bacteria	1143
9	JGI25407J50210_10042357	3300003373	Bacteria	1165
10	Ga0058860_11917468	3300004801	Bacteria	981
11	Ga0058862_12619317	3300004803	Bacteria	1051
12	Ga0065716_1007519	3300005277	Bacteria	751
13	Ga0065712_10162364	3300005290	Bacteria	1293
14	Ga0065707_10022432	3300005295	Bacteria	1458
15	Ga0070676_10031013	3300005328	Bacteria	3052
16	Ga0070676_10083288	3300005328	Bacteria	1945
17	Ga0070683_100095605	3300005329	Bacteria	2794
18	Ga0070683_100432285	3300005329	Bacteria	1256
19	Ga0070690_100000660	3300005330	Bacteria	17597
20	Ga0070670_100001026	3300005331	Bacteria	22081
21	Ga0068869_100038541	3300005334	Bacteria	3407
22	Ga0070666_10029226	3300005335	Bacteria	3622
23	Ga0070680_100000080	3300005336	Bacteria	52683
24	Ga0070682_100010323	3300005337	Bacteria	5299
25	Ga0068868_100011576	3300005338	Bacteria	6425
26	Ga0068868_100421394	3300005338	Bacteria	1156
27	Ga0070660_100026700	3300005339	Bacteria	4302
28	Ga0070689_100002434	3300005340	Bacteria	12160
29	Ga0070691_10001827	3300005341	Bacteria	9285
30	Ga0070691_10021347	3300005341	Bacteria	2996
31	Ga0070687_100003691	3300005343	Bacteria	5987
32	Ga0070661_100002409	3300005344	Bacteria	12824
33	Ga0070692_10019122	3300005345	Bacteria	3304
34	Ga0070668_100005118	3300005347	Bacteria	9716
35	Ga0070669_100004712	3300005353	Bacteria	9837
36	Ga0070675_100008237	3300005354	Bacteria	8086
37	Ga0070675_100068778	3300005354	Bacteria	2933
38	Ga0070674_100074126	3300005356	Bacteria	2414
39	Ga0070673_100008265	3300005364	Bacteria	6911
40	Ga0070688_100002021	3300005365	Bacteria	10227
41	Ga0070688_100018014	3300005365	Bacteria	4066
42	Ga0070659_100004121	3300005366	Bacteria	10362
43	Ga0070659_100090002	3300005366	Bacteria	2459
44	Ga0070667_100031891	3300005367	Bacteria	4392
45	Ga0070667_100213743	3300005367	Bacteria	1715
46	Ga0070703_10195126	3300005406	Bacteria	791
47	Ga0070709_10002307	3300005434	Bacteria	10361
48	Ga0070709_10085590	3300005434	Bacteria	2068
49	Ga0070714_100053703	3300005435	Bacteria	3441
50	Ga0070714_100821433	3300005435	Bacteria	901
51	Ga0070713_100017966	3300005436	Bacteria	5367
52	Ga0070713_100774251	3300005436	Bacteria	919
53	Ga0070710_10005058	3300005437	Bacteria	6242
54	Ga0070710_10014096	3300005437	Bacteria	4016
55	Ga0070701_10001744	3300005438	Bacteria	8181
56	Ga0070711_100059539	3300005439	Bacteria	2652
57	Ga0070711_100544770	3300005439	Bacteria	962
58	Ga0070705_100002427	3300005440	Bacteria	9371
59	Ga0070705_100467734	3300005440	Bacteria	950
60	Ga0070700_100001961	3300005441	Bacteria	10447
61	Ga0070700_100073997	3300005441	Bacteria	2182
62	Ga0070694_100001929	3300005444	Bacteria	12291
63	Ga0070663_100003541	3300005455	Bacteria	9017
64	Ga0070678_100006325	3300005456	Bacteria	6945
65	Ga0070678_100108436	3300005456	Bacteria	2168
66	Ga0070662_100008263	3300005457	Bacteria	6779
67	Ga0070662_100035761	3300005457	Bacteria	3510
68	Ga0070662_100320396	3300005457	Bacteria	1264
69	Ga0070681_10266071	3300005458	Bacteria	1626
70	Ga0068867_100010807	3300005459	Bacteria	6440
71	Ga0070685_10005703	3300005466	Bacteria	6322
72	Ga0070706_100011162	3300005467	Bacteria	8339
73	Ga0070706_100621768	3300005467	Bacteria	1003
74	Ga0070707_100032662	3300005468	Bacteria	4959
75	Ga0070698_100080787	3300005471	Bacteria	3246
76	Ga0070679_100303301	3300005530	Bacteria	1548
77	Ga0070684_100054048	3300005535	Bacteria	3499
78	Ga0070684_100348993	3300005535	Bacteria	1361
79	Ga0070697_100025365	3300005536	Bacteria	4729
80	Ga0070697_100347991	3300005536	Bacteria	1280
81	Ga0068853_100007475	3300005539	Bacteria	8746
82	Ga0070672_100072483	3300005543	Bacteria	2742
83	Ga0070672_100187807	3300005543	Bacteria	1724
84	Ga0070686_100002842	3300005544	Bacteria	9536
85	Ga0070695_100027762	3300005545	Bacteria	3508
86	Ga0070695_100109482	3300005545	Bacteria	1872
87	Ga0070696_100014403	3300005546	Bacteria	5305
88	Ga0070696_100047173	3300005546	Bacteria	2989
89	Ga0070696_100417212	3300005546	Bacteria	1053
90	Ga0070693_100001882	3300005547	Bacteria	9582
91	Ga0070665_100104557	3300005548	Bacteria	2834
92	Ga0070704_100003085	3300005549	Bacteria	9484
93	Ga0070704_100052351	3300005549	Bacteria	2880
94	Ga0070704_100324705	3300005549	Bacteria	1291
95	Ga0068855_100000047	3300005563	Bacteria	145355
96	Ga0068855_100005551	3300005563	Bacteria	15397
97	Ga0070664_100004511	3300005564	Bacteria	11168
98	Ga0070664_100022775	3300005564	Bacteria	5168
99	Ga0068857_100012382	3300005577	Bacteria	7425
100	Ga0068856_100219645	3300005614	Bacteria	1916
101	Ga0068856_100342805	3300005614	Bacteria	1512
102	Ga0070702_100001466	3300005615	Bacteria	9677
103	Ga0068852_100001810	3300005616	Bacteria	14530
104	Ga0068852_100004162	3300005616	Bacteria	10193
105	Ga0068859_100063575	3300005617	Bacteria	3721
106	Ga0068859_100097066	3300005617	Bacteria	3000
107	Ga0068864_100032007	3300005618	Bacteria	4465
108	Ga0068866_10009876	3300005718	Bacteria	4071
109	Ga0068861_100030852	3300005719	Bacteria	3932
110	Ga0068863_100005230	3300005841	Bacteria	12803
111	Ga0068858_100015657	3300005842	Bacteria	7132
112	Ga0068860_100015798	3300005843	Bacteria	7371
113	Ga0068860_100394795	3300005843	Bacteria	1368
114	Ga0068862_100010985	3300005844	Bacteria	7477
115	Ga0081455_10001550	3300005937	Bacteria	28283
116	Ga0081455_10108068	3300005937	Bacteria	2217
117	Ga0081538_10000110	3300005981	Bacteria	81874
118	Ga0075365_10046288	3300006038	Bacteria	2856
119	Ga0075365_10083680	3300006038	Bacteria	2164
120	Ga0075368_10003383	3300006042	Bacteria	5322
121	Ga0075368_10026150	3300006042	Bacteria	2244
122	Ga0075363_100024121	3300006048	Bacteria	3090
123	Ga0075363_100076564	3300006048	Bacteria	1824
124	Ga0075364_10001735	3300006051	Bacteria	12003
125	Ga0075364_10057556	3300006051	Bacteria	2546
126	Ga0070715_10198453	3300006163	Bacteria	1018
127	Ga0070716_100003333	3300006173	Bacteria	7549
128	Ga0070712_100020863	3300006175	Bacteria	4293
129	Ga0070712_100028088	3300006175	Bacteria	3761
130	Ga0075362_10007658	3300006177	Bacteria	4102
131	Ga0075362_10018872	3300006177	Bacteria	2861
132	Ga0075367_10009311	3300006178	Bacteria	5129
133	Ga0075367_10030796	3300006178	Bacteria	3078
134	Ga0075367_10054430	3300006178	Bacteria	2373
135	Ga0075369_10085569	3300006186	Bacteria	1402
136	Ga0075366_10058749	3300006195	Bacteria	2285
137	Ga0075366_10167671	3300006195	Bacteria	1332
138	Ga0097621_100037569	3300006237	Bacteria	3882
139	Ga0068871_100098424	3300006358	Bacteria	2447
140	Ga0075428_100018775	3300006844	Bacteria	7647
141	Ga0075428_100019271	3300006844	Bacteria	7549
142	Ga0075428_100123609	3300006844	Bacteria	2817
143	Ga0075428_100128363	3300006844	Bacteria	2758
144	Ga0075430_100001386	3300006846	Bacteria	19674
145	Ga0075430_100052978	3300006846	Bacteria	3417
146	Ga0075431_100005390	3300006847	Bacteria	12631
147	Ga0075431_100038743	3300006847	Bacteria	4910
148	Ga0075431_100068162	3300006847	Bacteria	3672
149	Ga0075433_10014734	3300006852	Bacteria	6399
150	Ga0075433_10245527	3300006852	Bacteria	1589
151	Ga0075434_100642475	3300006871	Bacteria	1079
152	Ga0075429_100086590	3300006880	Bacteria	2730
153	Ga0075429_100102060	3300006880	Bacteria	2504
154	Ga0068865_100001284	3300006881	Bacteria	14607
155	Ga0068865_100155083	3300006881	Bacteria	1741
156	Ga0068865_100351837	3300006881	Bacteria	1194
157	Ga0068865_100421341	3300006881	Bacteria	1098
158	Ga0097620_100063579	3300006931	Bacteria	3721
159	Ga0097620_100097067	3300006931	Bacteria	3000
160	Ga0075435_100051479	3300007076	Bacteria	3317
161	Ga0075435_100090427	3300007076	Bacteria	2525
162	Ga0099795_10001655	3300007788	Bacteria	4935
163	Ga0105250_10005739	3300009092	Bacteria	5529
164	Ga0105240_10000085	3300009093	Bacteria	189341
165	Ga0105240_10082642	3300009093	Bacteria	3944
166	Ga0111539_10000996	3300009094	Bacteria	37109
167	Ga0111539_10138238	3300009094	Bacteria	2853
168	Ga0105247_10001359	3300009101	Bacteria	17777
169	Ga0105247_10012939	3300009101	Bacteria	5005
170	Ga0114129_10000695	3300009147	Bacteria	42405
171	Ga0114129_10011164	3300009147	Bacteria	12805
172	Ga0114129_10012726	3300009147	Bacteria	11977
173	Ga0114129_10142880	3300009147	Bacteria	3279
174	Ga0114129_10515080	3300009147	Bacteria	1560
175	Ga0114129_10664151	3300009147	Bacteria	1344
176	Ga0105243_10001534	3300009148	Bacteria	20187
177	Ga0105243_10385779	3300009148	Bacteria	1297
178	Ga0105241_10006456	3300009174	Bacteria	8644
179	Ga0105242_10006932	3300009176	Bacteria	8743
180	Ga0105242_10323156	3300009176	Bacteria	1416
181	Ga0105248_10004821	3300009177	Bacteria	14932
182	Ga0105248_10138694	3300009177	Bacteria	2743
183	Ga0105237_10196962	3300009545	Bacteria	2014
184	Ga0105238_10068032	3300009551	Bacteria	3562
185	Ga0105249_10002488	3300009553	Bacteria	15966
186	Ga0105249_10137662	3300009553	Bacteria	2339
187	Ga0105249_10234818	3300009553	Bacteria	1810
188	Ga0105239_10003600	3300010375	Bacteria	18923
189	Ga0105239_10019140	3300010375	Bacteria	7566
190	Ga0105239_10051299	3300010375	Bacteria	4523
191	Ga0105239_10434791	3300010375	Bacteria	1487
192	Ga0105246_10001576	3300011119	Bacteria	13572
193	Ga0157339_1009638	3300012505	Bacteria	857
194	Ga0157373_10012112	3300013100	Bacteria	6340
195	Ga0157371_10008405	3300013102	Bacteria	8225
196	Ga0157370_10064004	3300013104	Bacteria	3482
197	Ga0157369_10003313	3300013105	Bacteria	19144
198	Ga0157369_10014834	3300013105	Bacteria	8793
199	Ga0157374_10158408	3300013296	Bacteria	2205
200	Ga0157374_10204077	3300013296	Bacteria	1936
201	Ga0157378_10002727	3300013297	Bacteria	15725
202	Ga0157378_10091092	3300013297	Bacteria	2772
203	Ga0157378_10219147	3300013297	Bacteria	1808
204	Ga0163162_10129703	3300013306	Bacteria	2630
205	Ga0157372_10039813	3300013307	Bacteria	5189
206	Ga0157375_10215992	3300013308	Bacteria	2076
207	Ga0157375_10989998	3300013308	Bacteria	981
208	Ga0163163_10012697	3300014325	Bacteria	7684
209	Ga0163163_10026175	3300014325	Bacteria	5571
210	Ga0163163_10359611	3300014325	Bacteria	1512
211	Ga0163163_11703328	3300014325	Bacteria	691
212	Ga0157380_10106709	3300014326	Bacteria	2344
213	Ga0157380_10848773	3300014326	Bacteria	935
214	Ga0157377_10005214	3300014745	Bacteria	6085
215	Ga0157377_10040505	3300014745	Bacteria	2580
216	Ga0157379_10003160	3300014968	Bacteria	13930
217	Ga0157379_10011734	3300014968	Bacteria	7651
218	Ga0157376_10002757	3300014969	Bacteria	11997
219	Ga0157376_10718684	3300014969	Bacteria	1005
220	Ga0163161_10002233	3300017792	Bacteria	13939
221	Ga0163161_10236556	3300017792	Bacteria	1419
222	Ga0163161_10578560	3300017792	Bacteria	923
223	Ga0197907_10574277	3300020069	Bacteria	822
224	Ga0206356_10213865	3300020070	Bacteria	2189
225	Ga0206356_10238056	3300020070	Bacteria	764
226	Ga0206356_10530302	3300020070	Bacteria	1207
227	Ga0206349_1088119	3300020075	Bacteria	796
228	Ga0206349_1829239	3300020075	Bacteria	974
229	Ga0206355_1026851	3300020076	Bacteria	741
230	Ga0206351_10352610	3300020077	Bacteria	753
231	Ga0206350_11108245	3300020080	Bacteria	1083
232	Ga0206350_11486995	3300020080	Bacteria	982
233	Ga0206350_11660331	3300020080	Bacteria	882
234	Ga0206354_10209766	3300020081	Bacteria	2123
235	Ga0206354_11039539	3300020081	Bacteria	735
236	Ga0206353_10016773	3300020082	Bacteria	887
237	Ga0206353_10169770	3300020082	Bacteria	1832
238	Ga0154015_1501833	3300020610	Bacteria	1193
239	Ga0213873_10002997	3300021358	Bacteria	2996
240	Ga0213874_10002722	3300021377	Bacteria	3840
241	Ga0213874_10013032	3300021377	Bacteria	2145
242	Ga0213876_10003010	3300021384	Bacteria	9751
243	Ga0213876_10007856	3300021384	Bacteria	5786
244	Ga0213875_10025448	3300021388	Bacteria	2819
245	Ga0224712_10052806	3300022467	Bacteria	1589
246	Ga0224712_10203776	3300022467	Bacteria	900
247	Ga0209675_1013081	3300025291	Bacteria	2624
248	Ga0207653_10066607	3300025885	Bacteria	1224
249	Ga0207692_10013184	3300025898	Bacteria	3578
250	Ga0207692_10018328	3300025898	Bacteria	3141
251	Ga0207642_10128620	3300025899	Bacteria	1318
252	Ga0207710_10014109	3300025900	Bacteria	3366
253	Ga0207710_10048542	3300025900	Bacteria	1900
254	Ga0207680_10091024	3300025903	Bacteria	1940
255	Ga0207647_10011566	3300025904	Bacteria	6184
256	Ga0207647_10142978	3300025904	Bacteria	1401
257	Ga0207685_10008811	3300025905	Bacteria	2897
258	Ga0207699_10005673	3300025906	Bacteria	5996
259	Ga0207699_10033385	3300025906	Bacteria	2909
260	Ga0207699_10308874	3300025906	Bacteria	1106
261	Ga0207645_10006347	3300025907	Bacteria	8500
262	Ga0207684_10011513	3300025910	Bacteria	7727
263	Ga0207654_10003481	3300025911	Bacteria	7962
264	Ga0207695_10449454	3300025913	Bacteria	1172
265	Ga0207671_10328112	3300025914	Bacteria	1212
266	Ga0207693_10000200	3300025915	Bacteria	54560
267	Ga0207693_10068838	3300025915	Bacteria	2771
268	Ga0207693_10074484	3300025915	Bacteria	2659
269	Ga0207693_10129200	3300025915	Bacteria	1986
270	Ga0207693_10239540	3300025915	Bacteria	1424
271	Ga0207663_10095247	3300025916	Bacteria	1985
272	Ga0207663_10238094	3300025916	Bacteria	1333
273	Ga0207663_10259707	3300025916	Bacteria	1282
274	Ga0207660_10092907	3300025917	Bacteria	2240
275	Ga0207662_10037122	3300025918	Bacteria	2851
276	Ga0207657_10000248	3300025919	Bacteria	57425
277	Ga0207649_10208391	3300025920	Bacteria	1385
278	Ga0207652_10094526	3300025921	Bacteria	2632
279	Ga0207652_10121710	3300025921	Bacteria	2322
280	Ga0207652_10466461	3300025921	Bacteria	1138
281	Ga0207646_10018461	3300025922	Bacteria	6504
282	Ga0207646_10274249	3300025922	Bacteria	1524
283	Ga0207681_10020199	3300025923	Bacteria	4217
284	Ga0207681_10222265	3300025923	Bacteria	1462
285	Ga0207694_10000011	3300025924	Bacteria	417640
286	Ga0207694_10121410	3300025924	Bacteria	2087
287	Ga0207650_10002308	3300025925	Bacteria	13285
288	Ga0207650_10248955	3300025925	Bacteria	1438
289	Ga0207659_10039373	3300025926	Bacteria	3296
290	Ga0207659_10051125	3300025926	Bacteria	2938
291	Ga0207687_10044333	3300025927	Bacteria	3069
292	Ga0207700_10006050	3300025928	Bacteria	7286
293	Ga0207700_10084690	3300025928	Bacteria	2486
294	Ga0207664_10044812	3300025929	Bacteria	3466
295	Ga0207664_10128557	3300025929	Bacteria	2130
296	Ga0207664_10132216	3300025929	Bacteria	2102
297	Ga0207664_10522994	3300025929	Bacteria	1063
298	Ga0207690_10011179	3300025932	Bacteria	5358
299	Ga0207690_10056958	3300025932	Bacteria	2639
300	Ga0207706_10004882	3300025933	Bacteria	12543
301	Ga0207706_10020523	3300025933	Bacteria	5939
302	Ga0207706_10137073	3300025933	Bacteria	2153
303	Ga0207706_10234254	3300025933	Bacteria	1606
304	Ga0207686_10282025	3300025934	Bacteria	1227
305	Ga0207709_10107949	3300025935	Bacteria	1855
306	Ga0207709_10253609	3300025935	Bacteria	1286
307	Ga0207709_10496073	3300025935	Bacteria	952
308	Ga0207670_10004489	3300025936	Bacteria	7520
309	Ga0207670_10008169	3300025936	Bacteria	5892
310	Ga0207669_10072159	3300025937	Bacteria	2172
311	Ga0207704_10087049	3300025938	Bacteria	2039
312	Ga0207704_10323812	3300025938	Bacteria	1190
313	Ga0207665_10000458	3300025939	Bacteria	28143
314	Ga0207691_10039803	3300025940	Bacteria	4347
315	Ga0207691_10225633	3300025940	Bacteria	1623
316	Ga0207711_10454027	3300025941	Bacteria	1193
317	Ga0207689_10036491	3300025942	Bacteria	4080
318	Ga0207661_10097815	3300025944	Bacteria	2458
319	Ga0207661_10098367	3300025944	Bacteria	2452
320	Ga0207679_10523976	3300025945	Bacteria	1060
321	Ga0207667_10122102	3300025949	Bacteria	2684
322	Ga0207667_10419522	3300025949	Bacteria	1361
323	Ga0207651_10000493	3300025960	Bacteria	16585
324	Ga0207651_10064780	3300025960	Bacteria	2559
325	Ga0207651_10181104	3300025960	Bacteria	1672
326	Ga0207712_10153210	3300025961	Bacteria	1783
327	Ga0207712_10226164	3300025961	Bacteria	1499
328	Ga0207668_10025612	3300025972	Bacteria	3819
329	Ga0207668_10464113	3300025972	Bacteria	1083
330	Ga0207668_10780720	3300025972	Bacteria	844
331	Ga0207658_10214752	3300025986	Bacteria	1614
332	Ga0207658_10685420	3300025986	Bacteria	925
333	Ga0207677_10195219	3300026023	Bacteria	1604
334	Ga0207703_10035005	3300026035	Bacteria	3989
335	Ga0207639_10045194	3300026041	Bacteria	3316
336	Ga0207639_10408058	3300026041	Bacteria	1225
337	Ga0207678_10000246	3300026067	Bacteria	48851
338	Ga0207678_10038927	3300026067	Bacteria	4128
339	Ga0207708_10004494	3300026075	Bacteria	10273
340	Ga0207708_10079322	3300026075	Bacteria	2522
341	Ga0207708_10135535	3300026075	Bacteria	1928
342	Ga0207702_10160437	3300026078	Bacteria	2053
343	Ga0207702_10182496	3300026078	Bacteria	1933
344	Ga0207641_10444835	3300026088	Bacteria	1251
345	Ga0207648_10010995	3300026089	Bacteria	8546
346	Ga0207676_10006148	3300026095	Bacteria	8476
347	Ga0207674_10004043	3300026116	Bacteria	17797
348	Ga0207675_100000602	3300026118	Bacteria	35101
349	Ga0207675_100215720	3300026118	Bacteria	1847
350	Ga0207675_101307079	3300026118	Bacteria	746
351	Ga0207683_10000236	3300026121	Bacteria	48996
352	Ga0207698_10000995	3300026142	Bacteria	16436
353	Ga0207698_10286406	3300026142	Bacteria	1526
354	Ga0209982_1003192	3300027552	Bacteria	2319
355	Ga0209970_1008800	3300027614	Bacteria	1654
356	Ga0210002_1003971	3300027617	Bacteria	2196
357	Ga0209983_1010485	3300027665	Bacteria	1894
358	Ga0209998_10002734	3300027717	Bacteria	3978
359	Ga0209998_10009441	3300027717	Bacteria	2026
360	Ga0209813_10006747	3300027866	Bacteria	2844
361	Ga0209974_10098108	3300027876	Bacteria	1022
362	Ga0207428_10046904	3300027907	Bacteria	3472
363	Ga0207428_10078604	3300027907	Bacteria	2581
364	Ga0268265_10045371	3300028380	Bacteria	3279
365	Ga0268265_10699674	3300028380	Bacteria	979
366	Ga0265325_10007510	3300031241	Bacteria	6518
367	Ga0265339_10009549	3300031249	Bacteria	6085
368	Ga0265339_10014850	3300031249	Bacteria	4683
369	Ga0265331_10132766	3300031250	Bacteria	1135
370	Ga0307408_100123895	3300031548	Bacteria	2006
371	Ga0307408_100491970	3300031548	Bacteria	1072
372	Ga0265313_10004609	3300031595	Bacteria	10463
373	Ga0307508_10000020	3300031616	Bacteria	188730
374	Ga0265342_10011113	3300031712	Bacteria	6179
375	Ga0307516_10029114	3300031730	Bacteria	5585
376	Ga0307405_10010509	3300031731	Bacteria	4804
377	Ga0307405_10489264	3300031731	Bacteria	984
378	Ga0307413_10142925	3300031824	Bacteria	1656
379	Ga0307410_10066522	3300031852	Bacteria	2483
380	Ga0307410_11089461	3300031852	Bacteria	692
381	Ga0307407_10050713	3300031903	Bacteria	2376
382	Ga0307409_100307386	3300031995	Bacteria	1478
383	Ga0307409_100330974	3300031995	Bacteria	1429
384	Ga0307409_101227268	3300031995	Bacteria	774
385	Ga0307416_101308863	3300032002	Bacteria	830
386	Ga0307414_10133555	3300032004	Bacteria	1931
387	Ga0307415_100517598	3300032126	Bacteria	1046
388	Ga0315911_1000020	3300033442	Bacteria	139809
389	Ga0373948_0025906	3300034817	Bacteria	1153
390	Ga0373958_0014114	3300034819	Bacteria	1393
391	Ga0373949_0055911	3300035090	Bacteria	1005
392	Ga0373939_0012775	3300035114	Bacteria	2148
393	Ga0373941_0061740	3300035115	Bacteria	1221
394	Ga0373945_0147167	3300035116	Bacteria	953
395	Ga0373962_0013682	3300035242	Bacteria	2058
396	Ga0373931_0001131	3300035691	Bacteria	11321
397	Ga0373931_0084099	3300035691	Bacteria	1761
398	Ga0373931_0532483	3300035691	Bacteria	761
399	Ga0373927_0014287	3300035695	Bacteria	5261
400	Ga0373947_0002571	3300035725	Bacteria	10909
401	Ga0316582_0353998	3300036647	Bacteria	1010
402	Ga0373925_0002966	3300037068	Bacteria	13397
403	Ga0395899_0320263	3300037312	Bacteria	1045
404	Ga0395900_0737253	3300037418	Bacteria	916
405	Ga0395898_0124297	3300037466	Bacteria	2472
406	Ga0395905_0949406	3300037471	Bacteria	763
407	Ga0436364_0232879	3300037853	Bacteria	6722
408	Ga0436364_1337263	3300037853	Bacteria	1359
409	Ga0395901_0042484	3300038443	Bacteria	4713
410	Ga0436365_0096118	3300039437	Bacteria	1245
411	Ga0436365_0117972	3300039437	Bacteria	7142
412	Ga0436365_0629093	3300039437	Bacteria	821
413	Ga0436365_0870051	3300039437	Bacteria	20416
414	Ga0436365_1301518	3300039437	Bacteria	44224
415	Ga0436361_0379408	3300039447	Bacteria	804
416	Ga0436363_0143280	3300039450	Bacteria	13194
417	Ga0436363_0300349	3300039450	Bacteria	863
418	Ga0436363_0607910	3300039450	Bacteria	9062
419	Ga0436363_0720062	3300039450	Bacteria	2408
420	Ga0436363_0928967	3300039450	Bacteria	8384
421	Ga0436362_0304737	3300039453	Bacteria	942
422	Ga0436362_0505611	3300039453	Bacteria	2298
423	Ga0436362_0791772	3300039453	Bacteria	694
424	Ga0436362_0875213	3300039453	Bacteria	957
425	Ga0436362_1172658	3300039453	Bacteria	5531
426	Ga0439433_0025467	3300041999	Bacteria	1336
427	Ga0439464_0006302	3300042439	Bacteria	3087
428	Ga0439460_0015595	3300042461	Bacteria	2014
429	Ga0439460_0020674	3300042461	Bacteria	1791
430	Ga0466969_0010315	3300044656	Bacteria	4956
431	Ga0466972_0298871	3300044658	Bacteria	752
432	Ga0466965_0031542	3300044683	Bacteria	2584
433	Ga0466966_0031750	3300044684	Bacteria	3425
434	Ga0466957_0018362	3300044842	Bacteria	4107
435	Ga0451576_0153237	3300045051	Bacteria	2404
436	Ga0495603_0000250	3300046455	Bacteria	28101
437	Ga0495629_0001470	3300046459	Bacteria	18585
438	Ga0495629_0052342	3300046459	Bacteria	2857
439	Ga0495641_0003809	3300046461	Bacteria	11034
440	Ga0495653_0342595	3300046463	Bacteria	963
441	Ga0495580_0001491	3300046472	Bacteria	20557
442	Ga0495582_0002191	3300046473	Bacteria	10932
443	Ga0495584_0063089	3300046491	Bacteria	1862
444	Ga0495585_0059059	3300046492	Bacteria	2115
445	Ga0495594_0000080	3300046499	Bacteria	42875
446	Ga0495628_0151596	3300046516	Bacteria	1765
447	Ga0495663_0084289	3300046525	Bacteria	1028
448	Ga0495598_0130621	3300046537	Bacteria	861
449	Ga0495622_0065547	3300046557	Bacteria	1679
450	Ga0495622_0186965	3300046557	Bacteria	927
451	Ga0495633_0138644	3300046558	Bacteria	1125
452	Ga0495634_0004361	3300046642	Bacteria	11137
453	Ga0495634_0040156	3300046642	Bacteria	3184
454	Ga0495635_0020859	3300046663	Bacteria	4565
455	Ga0495659_0061592	3300046664	Bacteria	1387
456	Ga0495659_0089487	3300046664	Bacteria	1180
457	Ga0495588_0004008	3300046674	Bacteria	6476
458	Ga0495599_0033803	3300046678	Bacteria	3214
459	Ga0495647_0049598	3300046681	Bacteria	1626
460	Ga0495658_0033207	3300046683	Bacteria	2824
461	Ga0495613_0001057	3300046689	Bacteria	21043
462	Ga0495581_0003446	3300047315	Bacteria	9084
463	Ga0495672_0158708	3300047320	Bacteria	1165
464	Ga0495672_0236499	3300047320	Bacteria	894
465	Ga0495680_0046792	3300047322	Bacteria	3408
466	Ga0495593_0000491	3300047673	Bacteria	22280
467	Ga0495602_0108072	3300048088	Bacteria	2266
468	Ga0495614_0051702	3300048089	Bacteria	1761
469	Ga0496100_0096150	3300048903	Bacteria	2032
470	Ga0496100_0139100	3300048903	Bacteria	1718
471	Ga0496101_0277778	3300048904	Bacteria	1308
472	Ga0496102_0037317	3300048905	Bacteria	4383
473	Ga0496102_0089822	3300048905	Bacteria	2842
474	Ga0496102_0720330	3300048905	Bacteria	920
475	Ga0496103_0054321	3300048906	Bacteria	2482
476	Ga0496103_0066233	3300048906	Bacteria	2254
477	Ga0496103_0082689	3300048906	Bacteria	2021
478	Ga0496104_0007956	3300048907	Bacteria	9399
479	Ga0496104_0154764	3300048907	Bacteria	2200
480	Ga0496105_0107726	3300048908	Bacteria	2300
481	Ga0496105_0327320	3300048908	Bacteria	1227
482	Ga0496106_0036751	3300048909	Bacteria	3663
483	Ga0496107_0012035	3300048910	Bacteria	6034
484	Ga0496107_0080488	3300048910	Bacteria	2375
485	Ga0496107_0109994	3300048910	Bacteria	2024
486	Ga0496108_0115230	3300048911	Bacteria	2301
487	Ga0496109_0051413	3300048912	Bacteria	3753
488	Ga0496109_0081245	3300048912	Bacteria	2986
489	Ga0496110_0032973	3300048913	Bacteria	4478
490	Ga0496110_0076776	3300048913	Bacteria	2970
491	Ga0496111_0039519	3300048914	Bacteria	3383
492	Ga0496111_0411834	3300048914	Bacteria	998
493	Ga0496112_0033267	3300048915	Bacteria	5010
494	Ga0496113_0049843	3300048916	Bacteria	3119
495	Ga0496113_0116278	3300048916	Bacteria	2087
496	Ga0496114_0029398	3300048917	Bacteria	4516
497	Ga0496115_0212920	3300048918	Bacteria	1596
498	Ga0496124_0069442	3300048927	Bacteria	2925
499	Ga0496126_0018674	3300048929	Bacteria	6862
500	Ga0496126_0038910	3300048929	Bacteria	4420
501	Ga0496126_0082441	3300048929	Bacteria	2841
502	Ga0496126_0113130	3300048929	Bacteria	2363
503	Ga0495682_0021682	3300049460	Bacteria	2405
504	Ga0501292_000393	3300049515	Bacteria	5851
505	Ga0501031_0087477	3300049568	Bacteria	2032
506	Ga0501031_0375208	3300049568	Bacteria	920
507	Ga0501032_0088407	3300049569	Bacteria	2057
508	Ga0501033_0075887	3300049570	Bacteria	2467
509	Ga0501033_0295116	3300049570	Bacteria	1142
510	Ga0501036_0066569	3300049572	Bacteria	3048
511	Ga0501036_0114830	3300049572	Bacteria	2275
512	Ga0501036_0360494	3300049572	Bacteria	1214
513	Ga0501037_0285333	3300049573	Bacteria	1149
514	Ga0501038_0026312	3300049574	Bacteria	5182
515	Ga0501039_0004262	3300049575	Bacteria	10771
516	Ga0501039_0047900	3300049575	Bacteria	3304
517	Ga0501040_0019086	3300049576	Bacteria	4558
518	Ga0501040_0020236	3300049576	Bacteria	4433
519	Ga0501041_0008648	3300049577	Bacteria	5997
520	Ga0501041_0124046	3300049577	Bacteria	1606
521	Ga0501041_0128660	3300049577	Bacteria	1577
522	Ga0501042_0008920	3300049578	Bacteria	6653
523	Ga0501043_0075588	3300049579	Bacteria	2646
524	Ga0501046_0027080	3300049580	Bacteria	4680
525	Ga0501068_0043261	3300049584	Bacteria	2709
526	Ga0501068_0044470	3300049584	Bacteria	2674
527	Ga0501071_0010573	3300049587	Bacteria	6190
528	Ga0501071_0045092	3300049587	Bacteria	3164
529	Ga0501072_0006688	3300049588	Bacteria	8765
530	Ga0501072_0199240	3300049588	Bacteria	1596
531	Ga0501075_0012540	3300049591	Bacteria	6028
532	Ga0501075_0040211	3300049591	Bacteria	3501
533	Ga0501075_0144957	3300049591	Bacteria	1810
534	Ga0501259_002489	3300049688	Bacteria	2986
535	Ga0501261_000386	3300049690	Bacteria	5889
536	Ga0501245_004162	3300049708	Bacteria	1979
537	Ga0501079_0051816	3300049741	Bacteria	3169
538	Ga0501079_0185167	3300049741	Bacteria	1625
539	Ga0501080_0100599	3300049742	Bacteria	2682
540	Ga0501080_0311178	3300049742	Bacteria	1427
541	Ga0501081_0040009	3300049743	Bacteria	3209
542	Ga0501081_0312727	3300049743	Bacteria	1153
543	Ga0501081_0333650	3300049743	Bacteria	1116
544	Ga0501083_0053949	3300049744	Bacteria	2698
545	Ga0501279_000301	3300049775	Bacteria	6649
546	Ga0501283_001238	3300049779	Bacteria	3365
547	Ga0501283_028831	3300049779	Bacteria	923
548	Ga0501035_0076311	3300049822	Bacteria	2964
549	Ga0501226_013229	3300049853	Bacteria	912
550	nmdc:mga03n38_164446_c1	3300050490	Bacteria	1126
551	nmdc:mga03n38_269561_c1	3300050490	Bacteria	905
552	nmdc:mga03n38_53404_c1	3300050490	Bacteria	1812
553	nmdc:mga00v17_5712_c1	3300050491	Bacteria	6572
554	nmdc:mga00v17_76489_c1	3300050491	Bacteria	2083
555	nmdc:mga0yw44_184835_c1	3300050492	Bacteria	1373
556	nmdc:mga0yw44_541_c1	3300050492	Bacteria	13593
557	nmdc:mga0yw44_61624_c1	3300050492	Bacteria	2303
558	nmdc:mga0k408_247232_c1	3300050493	Bacteria	1065
559	nmdc:mga06z11_362102_c1	3300050494	Bacteria	869
560	nmdc:mga04h51_3587_c1	3300050495	Bacteria	3783
561	nmdc:mga04h51_65714_c1	3300050495	Bacteria	1255
562	nmdc:mga05p37_145560_c1	3300050507	Bacteria	2902
563	nmdc:mga05p37_3083_c1	3300050507	Bacteria	19357
564	nmdc:mga05p37_773030_c1	3300050507	Bacteria	1055
565	nmdc:mga05p37_828195_c1	3300050507	Bacteria	1008
566	nmdc:mga05p37_83546_c1	3300050507	Bacteria	3934
567	nmdc:mga09592_349450_c1	3300050508	Bacteria	1280
568	nmdc:mga09592_367783_c1	3300050508	Bacteria	1244
569	nmdc:mga09592_5403_c1	3300050508	Bacteria	10389
570	nmdc:mga0qj67_101521_c1	3300050509	Bacteria	2319
571	nmdc:mga0qj67_22130_c1	3300050509	Bacteria	4880
572	nmdc:mga06r32_184005_c1	3300050510	Bacteria	2076
573	nmdc:mga06r32_262444_c1	3300050510	Bacteria	1715
574	nmdc:mga06r32_279823_c1	3300050510	Bacteria	1655
575	nmdc:mga06r32_4645_c1	3300050510	Bacteria	12324
576	nmdc:mga08y16_137219_c1	3300050511	Bacteria	2543
577	nmdc:mga08y16_3556_c1	3300050511	Bacteria	16174
578	nmdc:mga0n895_167414_c1	3300050512	Bacteria	2230
579	nmdc:mga0n895_194155_c1	3300050512	Bacteria	2061
580	nmdc:mga0n895_526528_c1	3300050512	Bacteria	1189
581	nmdc:mga0rr50_272600_c1	3300050513	Bacteria	1411
582	nmdc:mga0rr50_5407_c1	3300050513	Bacteria	7615
583	nmdc:mga0rr50_733406_c1	3300050513	Bacteria	843
584	nmdc:mga0a205_41185_c1	3300050515	Bacteria	4448
585	nmdc:mga0a205_41464_c1	3300050515	Bacteria	4432
586	nmdc:mga0a205_44335_c1	3300050515	Bacteria	4287
587	nmdc:mga0sz30_62313_c2	3300050516	Bacteria	903
588	nmdc:mga0sz30_81399_c1	3300050516	Bacteria	1402
589	Ga0495619_0056439	3300053085	Bacteria	2603
590	Ga0495619_0093924	3300053085	Bacteria	2034
591	Ga0500566_0133237	3300053094	Bacteria	1327
592	Ga0500641_0012489	3300053096	Bacteria	3103
593	Ga0500572_001289	3300053111	Bacteria	7015
594	Ga0500652_000003	3300053131	Bacteria	221528
595	Ga0500655_045790	3300053133	Bacteria	864
596	Ga0500655_057679	3300053133	Bacteria	779
597	Ga0500559_0000217	3300053136	Bacteria	46155
598	Ga0500568_0080174	3300053139	Bacteria	1240
599	Ga0500636_0029946	3300053177	Bacteria	3217
600	Ga0500645_012327	3300053730	Bacteria	2764
601	Ga0500596_001019	3300053735	Bacteria	5611
602	Ga0501084_0050269	3300054114	Bacteria	3489
603	Ga0501084_0057845	3300054114	Bacteria	3243
604	Ga0587088_070089	3300059508	Bacteria	729
605	Ga0587079_066746	3300059647	Bacteria	793
606	Ga0501082_0057517	3300060353	Bacteria	3350
607	Ga0530510_0020446	3300061734	Bacteria	4706
608	2508733984	2508501050	Bacteria	9633614
609	2509078892	2508501114	Bacteria	7082538
610	2513673679	2513237098	Bacteria	9902361
611	2513857410	2513237137	Bacteria	9558895
612	2517893378	2517572143	Bacteria	9484767
613	2524442196	2524023205	Bacteria	8918781
614	2524470665	2524023210	Bacteria	9029266
615	2524537869	2524023228	Bacteria	10118060
616	2671118023	2667528175	Bacteria	7532676
617	2745079486	2744054633	Bacteria	8678936
618	2774873314	2773857925	Bacteria	6472445
619	2882458454	2882456835	Bacteria	6863978
620	2885389440	2885383462	Bacteria	9473874
621	2885416646	2885409591	Bacteria	9235467
622	2894233512	2894232714	Bacteria	8834183
623	2903775051	2903768456	Bacteria	9749579
624	2904701907
625	2935634319	2935630451	Bacteria	8169952
626	2941511209	2941507105	Bacteria	8166816
627	2941518593	2941515067	Bacteria	8166720
628	2941527144	2941523033	Bacteria	8169134
629	2941536008	2941531003	Bacteria	7653939
630	3005713829	3005710791	Bacteria	7622528
631	8006942084	8006933436	Bacteria	10410654
632	8006981824	8006973647	Bacteria	10679141
633	8056680565	8056673599	Bacteria	7871253
634	Ga0436364_0691871
635	JGI24739J22299_10082463
636	JGI24737J22298_10020075
637	JGI24743J22301_10016214
638	JGI24750J21931_1008362
639	JGI24738J21930_10012017
640	JGI24749J21850_1008892
641	JGI24742J22300_10019858
642	JGI25407J50210_10042357
643	Ga0058860_11917468
644	Ga0058862_12619317
645	Ga0065716_1007519
646	Ga0065712_10162364
647	Ga0065707_10022432
648	Ga0070676_10031013
649	Ga0070676_10083288
650	Ga0070683_100095605
651	Ga0070683_100432285
652	Ga0070690_100000660
653	Ga0070670_100001026
654	Ga0068869_100038541
655	Ga0070666_10029226
656	Ga0070680_100000080
657	Ga0070682_100010323
658	Ga0068868_100011576
659	Ga0068868_100421394
660	Ga0070660_100026700
661	Ga0070689_100002434
662	Ga0070691_10001827
663	Ga0070691_10021347
664	Ga0070687_100003691
665	Ga0070661_100002409
666	Ga0070692_10019122
667	Ga0070668_100005118
668	Ga0070669_100004712
669	Ga0070675_100008237
670	Ga0070675_100068778
671	Ga0070674_100074126
672	Ga0070673_100008265
673	Ga0070688_100002021
674	Ga0070688_100018014
675	Ga0070659_100004121
676	Ga0070659_100090002
677	Ga0070667_100031891
678	Ga0070667_100213743
679	Ga0070703_10195126
680	Ga0070709_10002307
681	Ga0070709_10085590
682	Ga0070714_100053703
683	Ga0070714_100821433
684	Ga0070713_100017966
685	Ga0070713_100774251
686	Ga0070710_10005058
687	Ga0070710_10014096
688	Ga0070701_10001744
689	Ga0070711_100059539
690	Ga0070711_100544770
691	Ga0070705_100002427
692	Ga0070705_100467734
693	Ga0070700_100001961
694	Ga0070700_100073997
695	Ga0070694_100001929
696	Ga0070663_100003541
697	Ga0070678_100006325
698	Ga0070678_100108436
699	Ga0070662_100008263
700	Ga0070662_100035761
701	Ga0070662_100320396
702	Ga0070681_10266071
703	Ga0068867_100010807
704	Ga0070685_10005703
705	Ga0070706_100011162
706	Ga0070706_100621768
707	Ga0070707_100032662
708	Ga0070698_100080787
709	Ga0070679_100303301
710	Ga0070684_100054048
711	Ga0070684_100348993
712	Ga0070697_100025365
713	Ga0070697_100347991
714	Ga0068853_100007475
715	Ga0070672_100072483
716	Ga0070672_100187807
717	Ga0070686_100002842
718	Ga0070695_100027762
719	Ga0070695_100109482
720	Ga0070696_100014403
721	Ga0070696_100047173
722	Ga0070696_100417212
723	Ga0070693_100001882
724	Ga0070665_100104557
725	Ga0070704_100003085
726	Ga0070704_100052351
727	Ga0070704_100324705
728	Ga0068855_100000047
729	Ga0068855_100005551
730	Ga0070664_100004511
731	Ga0070664_100022775
732	Ga0068857_100012382
733	Ga0068856_100219645
734	Ga0068856_100342805
735	Ga0070702_100001466
736	Ga0068852_100001810
737	Ga0068852_100004162
738	Ga0068859_100063575
739	Ga0068859_100097066
740	Ga0068864_100032007
741	Ga0068866_10009876
742	Ga0068861_100030852
743	Ga0068863_100005230
744	Ga0068858_100015657
745	Ga0068860_100015798
746	Ga0068860_100394795
747	Ga0068862_100010985
748	Ga0081455_10001550
749	Ga0081455_10108068
750	Ga0081538_10000110
751	Ga0075365_10046288
752	Ga0075365_10083680
753	Ga0075368_10003383
754	Ga0075368_10026150
755	Ga0075363_100024121
756	Ga0075363_100076564
757	Ga0075364_10001735
758	Ga0075364_10057556
759	Ga0070715_10198453
760	Ga0070716_100003333
761	Ga0070712_100020863
762	Ga0070712_100028088
763	Ga0075362_10007658
764	Ga0075362_10018872
765	Ga0075367_10009311
766	Ga0075367_10030796
767	Ga0075367_10054430
768	Ga0075369_10085569
769	Ga0075366_10058749
770	Ga0075366_10167671
771	Ga0097621_100037569
772	Ga0068871_100098424
773	Ga0075428_100018775
774	Ga0075428_100019271
775	Ga0075428_100123609
776	Ga0075428_100128363
777	Ga0075430_100001386
778	Ga0075430_100052978
779	Ga0075431_100005390
780	Ga0075431_100038743
781	Ga0075431_100068162
782	Ga0075433_10014734
783	Ga0075433_10245527
784	Ga0075434_100642475
785	Ga0075429_100086590
786	Ga0075429_100102060
787	Ga0068865_100001284
788	Ga0068865_100155083
789	Ga0068865_100351837
790	Ga0068865_100421341
791	Ga0097620_100063579
792	Ga0097620_100097067
793	Ga0075435_100051479
794	Ga0075435_100090427
795	Ga0099795_10001655
796	Ga0105250_10005739
797	Ga0105240_10000085
798	Ga0105240_10082642
799	Ga0111539_10000996
800	Ga0111539_10138238
801	Ga0105247_10001359
802	Ga0105247_10012939
803	Ga0114129_10000695
804	Ga0114129_10011164
805	Ga0114129_10012726
806	Ga0114129_10142880
807	Ga0114129_10515080
808	Ga0114129_10664151
809	Ga0105243_10001534
810	Ga0105243_10385779
811	Ga0105241_10006456
812	Ga0105242_10006932
813	Ga0105242_10323156
814	Ga0105248_10004821
815	Ga0105248_10138694
816	Ga0105237_10196962
817	Ga0105238_10068032
818	Ga0105249_10002488
819	Ga0105249_10137662
820	Ga0105249_10234818
821	Ga0105239_10003600
822	Ga0105239_10019140
823	Ga0105239_10051299
824	Ga0105239_10434791
825	Ga0105246_10001576
826	Ga0157339_1009638
827	Ga0157373_10012112
828	Ga0157371_10008405
829	Ga0157370_10064004
830	Ga0157369_10003313
831	Ga0157369_10014834
832	Ga0157374_10158408
833	Ga0157374_10204077
834	Ga0157378_10002727
835	Ga0157378_10091092
836	Ga0157378_10219147
837	Ga0163162_10129703
838	Ga0157372_10039813
839	Ga0157375_10215992
840	Ga0157375_10989998
841	Ga0163163_10012697
842	Ga0163163_10026175
843	Ga0163163_10359611
844	Ga0163163_11703328
845	Ga0157380_10106709
846	Ga0157380_10848773
847	Ga0157377_10005214
848	Ga0157377_10040505
849	Ga0157379_10003160
850	Ga0157379_10011734
851	Ga0157376_10002757
852	Ga0157376_10718684
853	Ga0163161_10002233
854	Ga0163161_10236556
855	Ga0163161_10578560
856	Ga0197907_10574277
857	Ga0206356_10213865
858	Ga0206356_10238056
859	Ga0206356_10530302
860	Ga0206349_1088119
861	Ga0206349_1829239
862	Ga0206355_1026851
863	Ga0206351_10352610
864	Ga0206350_11108245
865	Ga0206350_11486995
866	Ga0206350_11660331
867	Ga0206354_10209766
868	Ga0206354_11039539
869	Ga0206353_10016773
870	Ga0206353_10169770
871	Ga0154015_1501833
872	Ga0213873_10002997
873	Ga0213874_10002722
874	Ga0213874_10013032
875	Ga0213876_10003010
876	Ga0213876_10007856
877	Ga0213875_10025448
878	Ga0224712_10052806
879	Ga0224712_10203776
880	Ga0209675_1013081
881	Ga0207653_10066607
882	Ga0207692_10013184
883	Ga0207692_10018328
884	Ga0207642_10128620
885	Ga0207710_10014109
886	Ga0207710_10048542
887	Ga0207680_10091024
888	Ga0207647_10011566
889	Ga0207647_10142978
890	Ga0207685_10008811
891	Ga0207699_10005673
892	Ga0207699_10033385
893	Ga0207699_10308874
894	Ga0207645_10006347
895	Ga0207684_10011513
896	Ga0207654_10003481
897	Ga0207695_10449454
898	Ga0207671_10328112
899	Ga0207693_10000200
900	Ga0207693_10068838
901	Ga0207693_10074484
902	Ga0207693_10129200
903	Ga0207693_10239540
904	Ga0207663_10095247
905	Ga0207663_10238094
906	Ga0207663_10259707
907	Ga0207660_10092907
908	Ga0207662_10037122
909	Ga0207657_10000248
910	Ga0207649_10208391
911	Ga0207652_10094526
912	Ga0207652_10121710
913	Ga0207652_10466461
914	Ga0207646_10018461
915	Ga0207646_10274249
916	Ga0207681_10020199
917	Ga0207681_10222265
918	Ga0207694_10000011
919	Ga0207694_10121410
920	Ga0207650_10002308
921	Ga0207650_10248955
922	Ga0207659_10039373
923	Ga0207659_10051125
924	Ga0207687_10044333
925	Ga0207700_10006050
926	Ga0207700_10084690
927	Ga0207664_10044812
928	Ga0207664_10128557
929	Ga0207664_10132216
930	Ga0207664_10522994
931	Ga0207690_10011179
932	Ga0207690_10056958
933	Ga0207706_10004882
934	Ga0207706_10020523
935	Ga0207706_10137073
936	Ga0207706_10234254
937	Ga0207686_10282025
938	Ga0207709_10107949
939	Ga0207709_10253609
940	Ga0207709_10496073
941	Ga0207670_10004489
942	Ga0207670_10008169
943	Ga0207669_10072159
944	Ga0207704_10087049
945	Ga0207704_10323812
946	Ga0207665_10000458
947	Ga0207691_10039803
948	Ga0207691_10225633
949	Ga0207711_10454027
950	Ga0207689_10036491
951	Ga0207661_10097815
952	Ga0207661_10098367
953	Ga0207679_10523976
954	Ga0207667_10122102
955	Ga0207667_10419522
956	Ga0207651_10000493
957	Ga0207651_10064780
958	Ga0207651_10181104
959	Ga0207712_10153210
960	Ga0207712_10226164
961	Ga0207668_10025612
962	Ga0207668_10464113
963	Ga0207668_10780720
964	Ga0207658_10214752
965	Ga0207658_10685420
966	Ga0207677_10195219
967	Ga0207703_10035005
968	Ga0207639_10045194
969	Ga0207639_10408058
970	Ga0207678_10000246
971	Ga0207678_10038927
972	Ga0207708_10004494
973	Ga0207708_10079322
974	Ga0207708_10135535
975	Ga0207702_10160437
976	Ga0207702_10182496
977	Ga0207641_10444835
978	Ga0207648_10010995
979	Ga0207676_10006148
980	Ga0207674_10004043
981	Ga0207675_100000602
982	Ga0207675_100215720
983	Ga0207675_101307079
984	Ga0207683_10000236
985	Ga0207698_10000995
986	Ga0207698_10286406
987	Ga0209982_1003192
988	Ga0209970_1008800
989	Ga0210002_1003971
990	Ga0209983_1010485
991	Ga0209998_10002734
992	Ga0209998_10009441
993	Ga0209813_10006747
994	Ga0209974_10098108
995	Ga0207428_10046904
996	Ga0207428_10078604
997	Ga0268265_10045371
998	Ga0268265_10699674
999	Ga0265325_10007510
1000	Ga0265339_10009549
1001	Ga0265339_10014850
1002	Ga0265331_10132766
1003	Ga0307408_100123895
1004	Ga0307408_100491970
1005	Ga0265313_10004609
1006	Ga0307508_10000020
1007	Ga0265342_10011113
1008	Ga0307516_10029114
1009	Ga0307405_10010509
1010	Ga0307405_10489264
1011	Ga0307413_10142925
1012	Ga0307410_10066522
1013	Ga0307410_11089461
1014	Ga0307407_10050713
1015	Ga0307409_100307386
1016	Ga0307409_100330974
1017	Ga0307409_101227268
1018	Ga0307416_101308863
1019	Ga0307414_10133555
1020	Ga0307415_100517598
1021	Ga0315911_1000020
1022	Ga0373948_0025906
1023	Ga0373958_0014114
1024	Ga0373949_0055911
1025	Ga0373939_0012775
1026	Ga0373941_0061740
1027	Ga0373945_0147167
1028	Ga0373962_0013682
1029	Ga0373931_0001131
1030	Ga0373931_0084099
1031	Ga0373931_0532483
1032	Ga0373927_0014287
1033	Ga0373947_0002571
1034	Ga0316582_0353998
1035	Ga0373925_0002966
1036	Ga0395899_0320263
1037	Ga0395900_0737253
1038	Ga0395898_0124297
1039	Ga0395905_0949406
1040	Ga0436364_0232879
1041	Ga0436364_1337263
1042	Ga0395901_0042484
1043	Ga0436365_0096118
1044	Ga0436365_0117972
1045	Ga0436365_0629093
1046	Ga0436365_0870051
1047	Ga0436365_1301518
1048	Ga0436361_0379408
1049	Ga0436363_0143280
1050	Ga0436363_0300349
1051	Ga0436363_0607910
1052	Ga0436363_0720062
1053	Ga0436363_0928967
1054	Ga0436362_0304737
1055	Ga0436362_0505611
1056	Ga0436362_0791772
1057	Ga0436362_0875213
1058	Ga0436362_1172658
1059	Ga0439433_0025467
1060	Ga0439464_0006302
1061	Ga0439460_0015595
1062	Ga0439460_0020674
1063	Ga0466969_0010315
1064	Ga0466972_0298871
1065	Ga0466965_0031542
1066	Ga0466966_0031750
1067	Ga0466957_0018362
1068	Ga0451576_0153237
1069	Ga0495603_0000250
1070	Ga0495629_0001470
1071	Ga0495629_0052342
1072	Ga0495641_0003809
1073	Ga0495653_0342595
1074	Ga0495580_0001491
1075	Ga0495582_0002191
1076	Ga0495584_0063089
1077	Ga0495585_0059059
1078	Ga0495594_0000080
1079	Ga0495628_0151596
1080	Ga0495663_0084289
1081	Ga0495598_0130621
1082	Ga0495622_0065547
1083	Ga0495622_0186965
1084	Ga0495633_0138644
1085	Ga0495634_0004361
1086	Ga0495634_0040156
1087	Ga0495635_0020859
1088	Ga0495659_0061592
1089	Ga0495659_0089487
1090	Ga0495588_0004008
1091	Ga0495599_0033803
1092	Ga0495647_0049598
1093	Ga0495658_0033207
1094	Ga0495613_0001057
1095	Ga0495581_0003446
1096	Ga0495672_0158708
1097	Ga0495672_0236499
1098	Ga0495680_0046792
1099	Ga0495593_0000491
1100	Ga0495602_0108072
1101	Ga0495614_0051702
1102	Ga0496100_0096150
1103	Ga0496100_0139100
1104	Ga0496101_0277778
1105	Ga0496102_0037317
1106	Ga0496102_0089822
1107	Ga0496102_0720330
1108	Ga0496103_0054321
1109	Ga0496103_0066233
1110	Ga0496103_0082689
1111	Ga0496104_0007956
1112	Ga0496104_0154764
1113	Ga0496105_0107726
1114	Ga0496105_0327320
1115	Ga0496106_0036751
1116	Ga0496107_0012035
1117	Ga0496107_0080488
1118	Ga0496107_0109994
1119	Ga0496108_0115230
1120	Ga0496109_0051413
1121	Ga0496109_0081245
1122	Ga0496110_0032973
1123	Ga0496110_0076776
1124	Ga0496111_0039519
1125	Ga0496111_0411834
1126	Ga0496112_0033267
1127	Ga0496113_0049843
1128	Ga0496113_0116278
1129	Ga0496114_0029398
1130	Ga0496115_0212920
1131	Ga0496124_0069442
1132	Ga0496126_0018674
1133	Ga0496126_0038910
1134	Ga0496126_0082441
1135	Ga0496126_0113130
1136	Ga0495682_0021682
1137	Ga0501292_000393
1138	Ga0501031_0087477
1139	Ga0501031_0375208
1140	Ga0501032_0088407
1141	Ga0501033_0075887
1142	Ga0501033_0295116
1143	Ga0501036_0066569
1144	Ga0501036_0114830
1145	Ga0501036_0360494
1146	Ga0501037_0285333
1147	Ga0501038_0026312
1148	Ga0501039_0004262
1149	Ga0501039_0047900
1150	Ga0501040_0019086
1151	Ga0501040_0020236
1152	Ga0501041_0008648
1153	Ga0501041_0124046
1154	Ga0501041_0128660
1155	Ga0501042_0008920
1156	Ga0501043_0075588
1157	Ga0501046_0027080
1158	Ga0501068_0043261
1159	Ga0501068_0044470
1160	Ga0501071_0010573
1161	Ga0501071_0045092
1162	Ga0501072_0006688
1163	Ga0501072_0199240
1164	Ga0501075_0012540
1165	Ga0501075_0040211
1166	Ga0501075_0144957
1167	Ga0501259_002489
1168	Ga0501261_000386
1169	Ga0501245_004162
1170	Ga0501079_0051816
1171	Ga0501079_0185167
1172	Ga0501080_0100599
1173	Ga0501080_0311178
1174	Ga0501081_0040009
1175	Ga0501081_0312727
1176	Ga0501081_0333650
1177	Ga0501083_0053949
1178	Ga0501279_000301
1179	Ga0501283_001238
1180	Ga0501283_028831
1181	Ga0501035_0076311
1182	Ga0501226_013229
1183	nmdc:mga03n38_164446_c1
1184	nmdc:mga03n38_269561_c1
1185	nmdc:mga03n38_53404_c1
1186	nmdc:mga00v17_5712_c1
1187	nmdc:mga00v17_76489_c1
1188	nmdc:mga0yw44_184835_c1
1189	nmdc:mga0yw44_541_c1
1190	nmdc:mga0yw44_61624_c1
1191	nmdc:mga0k408_247232_c1
1192	nmdc:mga06z11_362102_c1
1193	nmdc:mga04h51_3587_c1
1194	nmdc:mga04h51_65714_c1
1195	nmdc:mga05p37_145560_c1
1196	nmdc:mga05p37_3083_c1
1197	nmdc:mga05p37_773030_c1
1198	nmdc:mga05p37_828195_c1
1199	nmdc:mga05p37_83546_c1
1200	nmdc:mga09592_349450_c1
1201	nmdc:mga09592_367783_c1
1202	nmdc:mga09592_5403_c1
1203	nmdc:mga0qj67_101521_c1
1204	nmdc:mga0qj67_22130_c1
1205	nmdc:mga06r32_184005_c1
1206	nmdc:mga06r32_262444_c1
1207	nmdc:mga06r32_279823_c1
1208	nmdc:mga06r32_4645_c1
1209	nmdc:mga08y16_137219_c1
1210	nmdc:mga08y16_3556_c1
1211	nmdc:mga0n895_167414_c1
1212	nmdc:mga0n895_194155_c1
1213	nmdc:mga0n895_526528_c1
1214	nmdc:mga0rr50_272600_c1
1215	nmdc:mga0rr50_5407_c1
1216	nmdc:mga0rr50_733406_c1
1217	nmdc:mga0a205_41185_c1
1218	nmdc:mga0a205_41464_c1
1219	nmdc:mga0a205_44335_c1
1220	nmdc:mga0sz30_62313_c2
1221	nmdc:mga0sz30_81399_c1
1222	Ga0495619_0056439
1223	Ga0495619_0093924
1224	Ga0500566_0133237
1225	Ga0500641_0012489
1226	Ga0500572_001289
1227	Ga0500652_000003
1228	Ga0500655_045790
1229	Ga0500655_057679
1230	Ga0500559_0000217
1231	Ga0500568_0080174
1232	Ga0500636_0029946
1233	Ga0500645_012327
1234	Ga0500596_001019
1235	Ga0501084_0050269
1236	Ga0501084_0057845
1237	Ga0587088_070089
1238	Ga0587079_066746
1239	Ga0501082_0057517
1240	Ga0530510_0020446
1241	2508733984
1242	2509078892
1243	2513673679
1244	2513857410
1245	2517893378
1246	2524442196
1247	2524470665
1248	2524537869
1249	2671118023
1250	2745079486
1251	2774873314
1252	2882458454
1253	2885389440
1254	2885416646
1255	2894233512
1256	2903775051
1257	2904701907
1258	2935634319
1259	2941511209
1260	2941518593
1261	2941527144
1262	2941536008
1263	3005713829
1264	8006942084
1265	8006981824
1266	8056680565

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

47

187

0.96 PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

207

246

0.95 PF08534

Redoxin

46

205

0.85 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7kuu-assembly1.cif.gz_B	lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form	0.957	3	219
6p0w-assembly1.cif.gz_A-2	lsfa from p. aeruginosa, a 1-cys prx in reduced form	0.956	3	219
7kuu-assembly1.cif.gz_B	lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form	0.9524	3	219
6p0w-assembly1.cif.gz_A-2	lsfa from p. aeruginosa, a 1-cys prx in reduced form	0.9468	3	219
5ykj-assembly1.cif.gz_A	structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems	0.9186	3	216

ID	Description	Score	Start	End	Superfamily
af_A0A0R0K508_6_109_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9495	5	106	3.40.30.10
af_A0A0R0K508_6_109_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9234	5	106	3.40.30.10
af_Q54SE2_176_239_3.30.1020.10	Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2	0.8911	155	218	3.30.1020.10
af_P34227_199_260_3.30.1020.10	Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2	0.8848	155	216	3.30.1020.10
af_Q54W30_4_152_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.881	3	166	3.40.30.10

ID	Description	Score	Start	End	GO Terms
AF-A0A7C7WM65-F1-model_v4	Redoxin domain-containing protein	0.9827	1	169	GO:0005829 GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454
AF-A0A534YD48-F1-model_v4	Peroxiredoxin	0.9803	1	184	GO:0005829 GO:0045454 GO:0051920
AF-A0A659YRX5-F1-model_v4	deleted	0.975	1	103
AF-A0A534YD48-F1-model_v4	Peroxiredoxin	0.975	1	184	GO:0005829 GO:0045454 GO:0051920
AF-A0A7C7WM65-F1-model_v4	Redoxin domain-containing protein	0.9714	1	169	GO:0005829 GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454

F471098

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00578

AhpC-TSA

AhpC/TSA family

47

187

0.96

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

207

246

0.95

PF08534

Redoxin

Redoxin

46

205

0.85

Structural Annotation

Top 5 Hits

Map