F470963

General Info

Members Datasets Scaffolds Average Seq Length
631 386 1262 208

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2582580736|2583151250
Length 240
Sequence RVTLEHMNVALQGSLFDSAPASAPEPTTEHTEPAEHTAGYDTGTEPALRPLDGLHRTHLGDGAWVDVLPGWLTGADLLFDTLATQVPWRAERRRMYDRTVDVPRLLCFYDEDRPLPHDVLAAARDRLSAHYGAELGERFRTAGLCYYRDGGDSVAWHGDTIGRGSAEDTMVAILSVGAARPLLLRPRGGGAGATVRYGLGHGDLIVMGGSCQRTWEHAVPKTSKPVGPRISIQFRPRGVR

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
71 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
72 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
126 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
137 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
138 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
139 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
149 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
150 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
154 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
169 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
170 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
171 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
174 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
177 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
178 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
188 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
189 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
192 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
193 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
194 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
195 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
196 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
197 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
198 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
199 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
200 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
203 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
204 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
205 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
206 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
207 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
208 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
209 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
210 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
211 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
212 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
213 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
214 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
215 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
216 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
225 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
240 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
241 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
242 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
246 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
260 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
276 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
277 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
299 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
300 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
301 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
306 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
307 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
308 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
309 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
313 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
314 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
326 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
327 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
328 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
329 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
330 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
331 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
335 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
336 2582580736 Prauserella sp. Am3 Isolate Unclassified
337 2501939600 Micromonospora sp. L5 Isolate Unclassified
338 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
339 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
340 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
341 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
342 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
343 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
344 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
345 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
346 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
347 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
348 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
349 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
350 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
351 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
352 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
353 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
354 2808606448 Streptomyces sp. 193411 Isolate Unclassified
355 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
356 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
357 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
358 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
359 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
360 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
361 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
362 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
363 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
364 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
365 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
366 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
367 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
368 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
369 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
370 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
371 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
372 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
373 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
374 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
375 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
376 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
377 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
378 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
379 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
380 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
381 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
382 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
383 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
384 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
385 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
386 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.49
Metatranscriptomes 1.43
Isolates 8.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.44
Nodule 0.16
Rhizoplane 6.34
Rhizosphere 75.91
Stem 0
Stem Tuber 0.16
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10040345 3300001989 Bacteria 1558
2 JGI24735J21928_10016369 3300002067 Bacteria 2302
3 JGI25406J46586_10001637 3300003203 Bacteria 10572
4 JGI25406J46586_10003725 3300003203 Bacteria 7141
5 rootH1_10003415 3300003316 Bacteria 5504
6 rootH2_10183783 3300003320 Bacteria 2181
7 rootL2_10014789 3300003322 Bacteria 5428
8 rootH1_10145035 3300003323 Bacteria 3401
9 Ga0006562J51391_1103456 3300003578 Bacteria 2227
10 Ga0055540_1002007 3300003792 Bacteria 11337
11 Ga0055540_1003433 3300003792 Bacteria 7657
12 Ga0055540_1006416 3300003792 Bacteria 4676
13 Ga0070658_10096748 3300005327 Bacteria 2437
14 Ga0070683_100047783 3300005329 Bacteria 3955
15 Ga0070683_100291133 3300005329 Bacteria 1553
16 Ga0068869_100121106 3300005334 Bacteria 2001
17 Ga0070680_100608637 3300005336 Bacteria 938
18 Ga0070682_100088645 3300005337 Bacteria 2020
19 Ga0070682_100157851 3300005337 Bacteria 1564
20 Ga0070682_100172550 3300005337 Bacteria 1504
21 Ga0070682_100375873 3300005337 Bacteria 1067
22 Ga0070682_100433088 3300005337 Bacteria 1003
23 Ga0070660_100145427 3300005339 Bacteria 1904
24 Ga0070668_100103773 3300005347 Bacteria 2255
25 Ga0070669_100516143 3300005353 Bacteria 993
26 Ga0070674_100268092 3300005356 Bacteria 1348
27 Ga0070709_10047550 3300005434 Bacteria 2673
28 Ga0070714_100002594 3300005435 Bacteria 13316
29 Ga0070714_100016154 3300005435 Bacteria 6021
30 Ga0070714_100135919 3300005435 Bacteria 2201
31 Ga0070714_100147202 3300005435 Bacteria 2119
32 Ga0070714_100202508 3300005435 Bacteria 1816
33 Ga0070714_100468662 3300005435 Bacteria 1198
34 Ga0070714_100713357 3300005435 Bacteria 968
35 Ga0070713_100004275 3300005436 Bacteria 9560
36 Ga0070713_100113909 3300005436 Bacteria 2361
37 Ga0070713_100131836 3300005436 Bacteria 2205
38 Ga0070713_100212933 3300005436 Bacteria 1750
39 Ga0070713_100538874 3300005436 Bacteria 1104
40 Ga0070713_100745717 3300005436 Bacteria 937
41 Ga0070710_10216937 3300005437 Bacteria 1215
42 Ga0070711_100057108 3300005439 Bacteria 2701
43 Ga0070705_100418083 3300005440 Bacteria 997
44 Ga0070700_100000004 3300005441 Bacteria 245987
45 Ga0070708_100002178 3300005445 Bacteria 15127
46 Ga0070708_100128832 3300005445 Bacteria 2341
47 Ga0070663_100021781 3300005455 Bacteria 4269
48 Ga0070663_100212845 3300005455 Bacteria 1514
49 Ga0070662_100201403 3300005457 Bacteria 1580
50 Ga0070681_10034417 3300005458 Bacteria 5086
51 Ga0068867_100693467 3300005459 Bacteria 898
52 Ga0070698_100047971 3300005471 Bacteria 4364
53 Ga0070679_100160353 3300005530 Bacteria 2224
54 Ga0070679_100486669 3300005530 Bacteria 1178
55 Ga0070679_100766318 3300005530 Bacteria 908
56 Ga0070693_100034918 3300005547 Bacteria 2785
57 Ga0070665_100282844 3300005548 Bacteria 1661
58 Ga0068855_100024221 3300005563 Bacteria 7266
59 Ga0068855_100288270 3300005563 Bacteria 1821
60 Ga0068857_100011524 3300005577 Bacteria 7692
61 Ga0068857_100086897 3300005577 Bacteria 2797
62 Ga0068857_100149319 3300005577 Bacteria 2117
63 Ga0068854_100015888 3300005578 Bacteria 5003
64 Ga0068856_100076829 3300005614 Bacteria 3308
65 Ga0068856_100226816 3300005614 Bacteria 1884
66 Ga0070702_100002838 3300005615 Bacteria 7602
67 Ga0068852_101334281 3300005616 Bacteria 739
68 Ga0068866_10060061 3300005718 Bacteria 1969
69 Ga0068861_100554130 3300005719 Bacteria 1048
70 Ga0081455_10002447 3300005937 Bacteria 22104
71 Ga0081455_10003072 3300005937 Bacteria 19458
72 Ga0081455_10012577 3300005937 Bacteria 8440
73 Ga0081455_10016606 3300005937 Bacteria 7098
74 Ga0081455_10024374 3300005937 Bacteria 5604
75 Ga0081455_10036749 3300005937 Bacteria 4356
76 Ga0081455_10194741 3300005937 Bacteria 1523
77 Ga0081539_10000070 3300005985 Bacteria 235651
78 Ga0081539_10000254 3300005985 Bacteria 123532
79 Ga0070717_10027491 3300006028 Bacteria 4547
80 Ga0070717_10097984 3300006028 Bacteria 2485
81 Ga0075365_10081481 3300006038 Bacteria 2193
82 Ga0075363_100081645 3300006048 Bacteria 1768
83 Ga0075363_100265887 3300006048 Bacteria 990
84 Ga0075364_10001141 3300006051 Bacteria 14192
85 Ga0075364_10259259 3300006051 Bacteria 1182
86 Ga0070715_10076242 3300006163 Bacteria 1511
87 Ga0070712_100120879 3300006175 Bacteria 1970
88 Ga0070712_100262324 3300006175 Bacteria 1385
89 Ga0075367_10001685 3300006178 Bacteria 9658
90 Ga0075369_10012941 3300006186 Bacteria 3302
91 Ga0075369_10116749 3300006186 Bacteria 1206
92 Ga0075370_10005917 3300006353 Bacteria 6118
93 Ga0075370_10066105 3300006353 Bacteria 2062
94 Ga0075428_100000757 3300006844 Bacteria 33566
95 Ga0075428_100018665 3300006844 Bacteria 7667
96 Ga0075428_100585704 3300006844 Bacteria 1192
97 Ga0075430_100000817 3300006846 Bacteria 24271
98 Ga0075431_100001797 3300006847 Bacteria 20238
99 Ga0075434_100000259 3300006871 Bacteria 37447
100 Ga0075429_100001237 3300006880 Bacteria 20713
101 Ga0068865_100065478 3300006881 Bacteria 2560
102 Ga0105240_10213606 3300009093 Bacteria 2252
103 Ga0111539_11105338 3300009094 Bacteria 921
104 Ga0105245_10031359 3300009098 Bacteria 4703
105 Ga0114129_10001234 3300009147 Bacteria 34058
106 Ga0114129_10002198 3300009147 Bacteria 26865
107 Ga0114129_10207985 3300009147 Bacteria 2647
108 Ga0105243_10142040 3300009148 Bacteria 2049
109 Ga0105242_10023921 3300009176 Bacteria 4821
110 Ga0105238_10053394 3300009551 Bacteria 4061
111 Ga0105249_10085153 3300009553 Bacteria 2945
112 Ga0105239_10070111 3300010375 Bacteria 3850
113 Ga0105246_10416349 3300011119 Bacteria 1120
114 Ga0157329_1001350 3300012491 Bacteria 1231
115 Ga0157319_1006178 3300012497 Bacteria 850
116 Ga0157313_1006778 3300012503 Bacteria 873
117 Ga0157371_10093316 3300013102 Bacteria 2133
118 Ga0157369_10041625 3300013105 Bacteria 5014
119 Ga0157369_10247934 3300013105 Bacteria 1859
120 Ga0157369_10371910 3300013105 Bacteria 1484
121 Ga0157369_10982381 3300013105 Bacteria 865
122 Ga0157369_11304241 3300013105 Bacteria 740
123 Ga0157369_11360040 3300013105 Bacteria 723
124 Ga0157378_10011256 3300013297 Bacteria 7826
125 Ga0157378_10291398 3300013297 Bacteria 1576
126 Ga0163162_10102712 3300013306 Bacteria 2952
127 Ga0157372_10088589 3300013307 Bacteria 3514
128 Ga0157372_10113250 3300013307 Bacteria 3109
129 Ga0157372_10135015 3300013307 Bacteria 2841
130 Ga0157375_10089733 3300013308 Bacteria 3131
131 Ga0157375_10484633 3300013308 Bacteria 1401
132 Ga0157375_10834001 3300013308 Bacteria 1069
133 Ga0163163_11230070 3300014325 Bacteria 811
134 Ga0157380_10102347 3300014326 Bacteria 2388
135 Ga0157380_10196761 3300014326 Bacteria 1785
136 Ga0163161_10093344 3300017792 Bacteria 2230
137 Ga0163161_10201137 3300017792 Bacteria 1535
138 Ga0197907_10914288 3300020069 Bacteria 1326
139 Ga0206354_10996845 3300020081 Bacteria 1364
140 Ga0206354_11257981 3300020081 Bacteria 1000
141 Ga0206353_10330845 3300020082 Bacteria 944
142 Ga0206353_11352776 3300020082 Bacteria 3200
143 Ga0206353_11619359 3300020082 Bacteria 2440
144 Ga0213875_10002535 3300021388 Bacteria 10896
145 Ga0213875_10032956 3300021388 Bacteria 2447
146 Ga0209673_1041673 3300025273 Bacteria 1300
147 Ga0207426_1010888 3300025302 Bacteria 3500
148 Ga0209051_1000642 3300025303 Bacteria 39944
149 Ga0209051_1002013 3300025303 Bacteria 15513
150 Ga0209051_1002782 3300025303 Bacteria 12062
151 Ga0207692_10075195 3300025898 Bacteria 1791
152 Ga0207692_10337443 3300025898 Bacteria 926
153 Ga0207688_10007682 3300025901 Bacteria 5872
154 Ga0207647_10009757 3300025904 Bacteria 6813
155 Ga0207685_10070493 3300025905 Bacteria 1415
156 Ga0207699_10021411 3300025906 Bacteria 3484
157 Ga0207699_10508831 3300025906 Bacteria 870
158 Ga0207705_10068918 3300025909 Bacteria 2561
159 Ga0207707_10058201 3300025912 Bacteria 3363
160 Ga0207695_10167760 3300025913 Bacteria 2122
161 Ga0207693_10071272 3300025915 Bacteria 2720
162 Ga0207693_10160894 3300025915 Bacteria 1766
163 Ga0207693_10236317 3300025915 Bacteria 1435
164 Ga0207660_10110128 3300025917 Bacteria 2071
165 Ga0207657_10043019 3300025919 Bacteria 3982
166 Ga0207652_10156847 3300025921 Bacteria 2039
167 Ga0207652_10371205 3300025921 Bacteria 1291
168 Ga0207694_10039622 3300025924 Bacteria 3626
169 Ga0207650_10299994 3300025925 Bacteria 1312
170 Ga0207687_10031971 3300025927 Bacteria 3561
171 Ga0207700_10032649 3300025928 Bacteria 3716
172 Ga0207700_10103145 3300025928 Bacteria 2280
173 Ga0207700_10251032 3300025928 Bacteria 1511
174 Ga0207700_10436661 3300025928 Bacteria 1152
175 Ga0207664_10003810 3300025929 Bacteria 10121
176 Ga0207664_10009642 3300025929 Bacteria 6784
177 Ga0207664_10813807 3300025929 Bacteria 840
178 Ga0207706_10002019 3300025933 Bacteria 19876
179 Ga0207709_10021578 3300025935 Bacteria 3647
180 Ga0207709_10082261 3300025935 Bacteria 2079
181 Ga0207669_10286763 3300025937 Bacteria 1245
182 Ga0207669_10485726 3300025937 Bacteria 985
183 Ga0207665_10112181 3300025939 Bacteria 1917
184 Ga0207691_10360635 3300025940 Bacteria 1243
185 Ga0207689_10132669 3300025942 Bacteria 2050
186 Ga0207661_10027724 3300025944 Bacteria 4330
187 Ga0207661_10357533 3300025944 Bacteria 1319
188 Ga0207661_10965626 3300025944 Bacteria 785
189 Ga0207667_10046497 3300025949 Bacteria 4596
190 Ga0207667_10103853 3300025949 Bacteria 2931
191 Ga0207712_10179283 3300025961 Bacteria 1663
192 Ga0207668_10021530 3300025972 Bacteria 4113
193 Ga0207668_10138047 3300025972 Bacteria 1871
194 Ga0207658_10053249 3300025986 Bacteria 2990
195 Ga0207678_10127075 3300026067 Bacteria 2174
196 Ga0207678_10492296 3300026067 Bacteria 1068
197 Ga0207708_10000008 3300026075 Bacteria 245837
198 Ga0207708_10070023 3300026075 Bacteria 2686
199 Ga0207702_10080593 3300026078 Bacteria 2825
200 Ga0207702_10456545 3300026078 Bacteria 1240
201 Ga0207648_10088774 3300026089 Bacteria 2699
202 Ga0207674_10033183 3300026116 Bacteria 5405
203 Ga0207674_10087952 3300026116 Bacteria 3100
204 Ga0207675_100003090 3300026118 Bacteria 16310
205 Ga0207698_10271074 3300026142 Bacteria 1565
206 Ga0207698_10467494 3300026142 Bacteria 1221
207 Ga0268264_10112449 3300028381 Bacteria 2387
208 Ga0265337_1000139 3300028556 Bacteria 36279
209 Ga0265326_10001897 3300028558 Bacteria 7162
210 Ga0265319_1001580 3300028563 Bacteria 13351
211 Ga0265334_10000881 3300028573 Bacteria 15032
212 Ga0265318_10008159 3300028577 Bacteria 4680
213 Ga0265322_10008419 3300028654 Bacteria 3004
214 Ga0265336_10001858 3300028666 Bacteria 9147
215 Ga0307517_10001013 3300028786 Bacteria 47758
216 Ga0307515_10092155 3300028794 Bacteria 3775
217 Ga0265338_10001072 3300028800 Bacteria 45406
218 Ga0265338_10003430 3300028800 Bacteria 22337
219 Ga0265324_10002085 3300029957 Bacteria 10579
220 Ga0307511_10000716 3300030521 Bacteria 35363
221 Ga0307511_10246958 3300030521 Bacteria 863
222 Ga0307512_10003223 3300030522 Bacteria 19291
223 Ga0307512_10044093 3300030522 Bacteria 3671
224 Ga0307512_10100058 3300030522 Bacteria 1969
225 Ga0316181_1271580 3300030744 Bacteria 4644
226 Ga0316182_1115344 3300030745 Bacteria 5616
227 Ga0265320_10008860 3300031240 Bacteria 6118
228 Ga0265325_10011746 3300031241 Bacteria 5023
229 Ga0265340_10002439 3300031247 Bacteria 10580
230 Ga0265327_10000001 3300031251 Bacteria 894475
231 Ga0265316_10049682 3300031344 Bacteria 3302
232 Ga0307509_10053620 3300031507 Bacteria 4298
233 Ga0307408_100003935 3300031548 Bacteria 10117
234 Ga0307408_100046020 3300031548 Bacteria 3119
235 Ga0307408_100382878 3300031548 Bacteria 1203
236 Ga0307508_10000420 3300031616 Bacteria 50353
237 Ga0307508_10013931 3300031616 Bacteria 7339
238 Ga0307508_10022040 3300031616 Bacteria 5794
239 Ga0307508_10172505 3300031616 Bacteria 1766
240 Ga0307508_10229685 3300031616 Bacteria 1454
241 Ga0307514_10005876 3300031649 Bacteria 10828
242 Ga0307514_10032208 3300031649 Bacteria 4199
243 Ga0316575_10001555 3300031665 Bacteria 7444
244 Ga0316575_10101314 3300031665 Bacteria 1171
245 Ga0316579_10004999 3300031691 Bacteria 5319
246 Ga0316579_10106210 3300031691 Bacteria 1346
247 Ga0265314_10009482 3300031711 Bacteria 8210
248 Ga0265342_10001481 3300031712 Bacteria 21785
249 Ga0316576_10000788 3300031727 Bacteria 15928
250 Ga0316576_10001893 3300031727 Bacteria 11643
251 Ga0316576_10089783 3300031727 Bacteria 2288
252 Ga0316578_10002580 3300031728 Bacteria 8010
253 Ga0316578_10017406 3300031728 Bacteria 3909
254 Ga0316578_10048453 3300031728 Bacteria 2481
255 Ga0307516_10007114 3300031730 Bacteria 12929
256 Ga0307516_10012388 3300031730 Bacteria 9196
257 Ga0307405_10150676 3300031731 Bacteria 1635
258 Ga0307405_10558498 3300031731 Bacteria 927
259 Ga0316577_10036156 3300031733 Bacteria 2761
260 Ga0307413_10085639 3300031824 Bacteria 2035
261 Ga0307410_10010084 3300031852 Bacteria 5336
262 Ga0307410_10013335 3300031852 Bacteria 4792
263 Ga0307406_10000351 3300031901 Bacteria 26871
264 Ga0307406_10024208 3300031901 Bacteria 3623
265 Ga0307406_10037144 3300031901 Bacteria 3006
266 Ga0307407_10017562 3300031903 Bacteria 3595
267 Ga0307407_10031676 3300031903 Bacteria 2867
268 Ga0307412_10130544 3300031911 Bacteria 1824
269 Ga0307412_10439233 3300031911 Bacteria 1072
270 Ga0307409_100000384 3300031995 Bacteria 18744
271 Ga0307409_100122576 3300031995 Bacteria 2204
272 Ga0307409_100502789 3300031995 Bacteria 1181
273 Ga0307416_100000202 3300032002 Bacteria 31241
274 Ga0307416_100026206 3300032002 Bacteria 4291
275 Ga0307414_10042079 3300032004 Bacteria 3101
276 Ga0307414_10115164 3300032004 Bacteria 2055
277 Ga0307411_10073510 3300032005 Bacteria 2326
278 Ga0307411_10081397 3300032005 Bacteria 2230
279 Ga0307415_100013857 3300032126 Bacteria 4720
280 Ga0316583_10050731 3300032133 Bacteria 1460
281 Ga0316585_10111749 3300032137 Bacteria 898
282 Ga0316580_10004593 3300032139 Bacteria 4010
283 Ga0307507_10024824 3300033179 Bacteria 6518
284 Ga0307507_10130792 3300033179 Bacteria 1964
285 Ga0307507_10143428 3300033179 Bacteria 1823
286 Ga0307510_10023755 3300033180 Bacteria 7100
287 Ga0307510_10077980 3300033180 Bacteria 3244
288 Ga0307510_10389852 3300033180 Bacteria 837
289 Ga0316214_1010824 3300033545 Bacteria 1239
290 Ga0316212_1010372 3300033547 Bacteria 1335
291 Ga0373934_0026424 3300035086 Bacteria 2252
292 Ga0316574_0002679 3300035398 Bacteria 8998
293 Ga0316574_0004704 3300035398 Bacteria 7196
294 Ga0316574_0007907 3300035398 Bacteria 5868
295 Ga0316574_0017713 3300035398 Bacteria 4174
296 Ga0316582_0006564 3300036647 Bacteria 6123
297 Ga0316582_0037548 3300036647 Bacteria 3004
298 Ga0316584_0012108 3300036712 Bacteria 6076
299 Ga0316584_0549131 3300036712 Bacteria 807
300 Ga0373925_0000070 3300037068 Bacteria 107528
301 Ga0395899_0099237 3300037312 Bacteria 2104
302 Ga0395900_0071554 3300037418 Bacteria 3565
303 Ga0395898_0001337 3300037466 Bacteria 35615
304 Ga0395898_0017519 3300037466 Bacteria 7314
305 Ga0395898_0053823 3300037466 Bacteria 3929
306 Ga0395898_0769273 3300037466 Bacteria 904
307 Ga0395905_0527475 3300037471 Bacteria 1081
308 Ga0436364_0068424 3300037853 Bacteria 7082
309 Ga0436364_0542878 3300037853 Bacteria 12255
310 Ga0436364_1164493 3300037853 Bacteria 1155
311 Ga0436364_1494248 3300037853 Bacteria 1432
312 Ga0395901_0180826 3300038443 Bacteria 2212
313 Ga0395901_0243557 3300038443 Bacteria 1874
314 Ga0395901_0245117 3300038443 Bacteria 1868
315 Ga0395901_0246636 3300038443 Bacteria 1861
316 Ga0395901_0508648 3300038443 Bacteria 1225
317 Ga0436363_0425102 3300039450 Bacteria 1486
318 Ga0439439_0056570 3300041406 Bacteria 1037
319 Ga0439461_0001304 3300041410 Bacteria 3831
320 Ga0439466_0004989 3300041411 Bacteria 5093
321 Ga0439465_0009226 3300041413 Bacteria 3109
322 Ga0439465_0179147 3300041413 Bacteria 766
323 Ga0451793_0334330 3300041452 Bacteria 1427
324 Ga0451793_0597900 3300041452 Bacteria 1366
325 Ga0451793_1548608 3300041452 Bacteria 2296
326 Ga0451797_1273634 3300041453 Bacteria 2187
327 Ga0451797_1321321 3300041453 Bacteria 1523
328 Ga0451800_0122989 3300041459 Bacteria 901
329 Ga0451802_1889812 3300041460 Bacteria 1448
330 Ga0451806_151393 3300041462 Bacteria 1211
331 Ga0451806_553355 3300041462 Bacteria 1199
332 Ga0451833_0553594 3300041491 Bacteria 1290
333 Ga0451835_0441631 3300041492 Bacteria 838
334 Ga0451837_0303922 3300041494 Bacteria 3251
335 Ga0451839_0591314 3300041496 Bacteria 1565
336 Ga0451841_0973683 3300041498 Bacteria 1402
337 Ga0451841_1386440 3300041498 Bacteria 2345
338 Ga0451841_1392353 3300041498 Bacteria 1842
339 Ga0451853_0320331 3300041512 Bacteria 2338
340 Ga0451853_1265679 3300041512 Bacteria 7874
341 Ga0451853_3357292 3300041512 Bacteria 1564
342 Ga0439431_0002848 3300041997 Bacteria 3805
343 Ga0439433_0022091 3300041999 Bacteria 1425
344 Ga0439445_0008482 3300042004 Bacteria 2404
345 Ga0439448_0003774 3300042005 Bacteria 4226
346 Ga0439448_0011537 3300042005 Bacteria 2635
347 Ga0439449_0023583 3300042007 Bacteria 2300
348 Ga0439455_0063658 3300042012 Bacteria 981
349 Ga0439457_004429 3300042014 Bacteria 3658
350 Ga0439462_0007917 3300042015 Bacteria 2669
351 Ga0439462_0063835 3300042015 Bacteria 997
352 Ga0439463_050439 3300042016 Bacteria 1061
353 Ga0450905_030945 3300042142 Bacteria 825
354 Ga0439458_0000757 3300042157 Bacteria 8273
355 Ga0439434_0000565 3300042435 Bacteria 10673
356 Ga0439444_0008099 3300042437 Bacteria 1632
357 Ga0439460_0003458 3300042461 Bacteria 3821
358 Ga0439440_0008143 3300042993 Bacteria 2147
359 Ga0466969_0032085 3300044656 Bacteria 2671
360 Ga0466969_0074007 3300044656 Bacteria 1634
361 Ga0466969_0226037 3300044656 Bacteria 851
362 Ga0466972_0003466 3300044658 Bacteria 7828
363 Ga0466972_0018734 3300044658 Bacteria 3461
364 Ga0466972_0039682 3300044658 Bacteria 2296
365 Ga0466965_0012677 3300044683 Bacteria 3970
366 Ga0466965_0045872 3300044683 Bacteria 2163
367 Ga0466966_0003786 3300044684 Bacteria 9978
368 Ga0466966_0031536 3300044684 Bacteria 3436
369 Ga0466966_0253923 3300044684 Bacteria 1059
370 Ga0466961_0013905 3300044693 Bacteria 5157
371 Ga0466961_0147636 3300044693 Bacteria 1470
372 Ga0466963_0117532 3300044694 Bacteria 1828
373 Ga0466963_0204243 3300044694 Bacteria 1382
374 Ga0466964_0391567 3300044706 Bacteria 724
375 Ga0466971_0055180 3300044719 Bacteria 1791
376 Ga0466968_0008086 3300044735 Bacteria 4022
377 Ga0466968_0143020 3300044735 Bacteria 1095
378 Ga0466970_0022919 3300044765 Bacteria 3257
379 Ga0466970_0059792 3300044765 Bacteria 2041
380 Ga0466957_0022611 3300044842 Bacteria 3711
381 Ga0466957_0106901 3300044842 Bacteria 1770
382 Ga0466957_0193868 3300044842 Bacteria 1332
383 Ga0466960_0002473 3300044901 Bacteria 6954
384 Ga0466960_0012455 3300044901 Bacteria 3590
385 Ga0466960_0090396 3300044901 Bacteria 1559
386 Ga0466960_0355264 3300044901 Bacteria 836
387 Ga0466960_0404554 3300044901 Bacteria 787
388 Ga0466959_0006762 3300045049 Bacteria 7987
389 Ga0466959_0058118 3300045049 Bacteria 2817
390 Ga0466959_0119579 3300045049 Bacteria 1874
391 Ga0466959_0131278 3300045049 Bacteria 1775
392 Ga0466958_0019437 3300045836 Bacteria 3954
393 Ga0466967_0010867 3300045976 Bacteria 6858
394 Ga0466967_0044351 3300045976 Bacteria 3857
395 Ga0466967_0056145 3300045976 Bacteria 3471
396 Ga0466967_0058768 3300045976 Bacteria 3400
397 Ga0466967_0101812 3300045976 Bacteria 2626
398 Ga0466967_0225404 3300045976 Bacteria 1783
399 Ga0466967_0275606 3300045976 Bacteria 1613
400 Ga0466967_1357491 3300045976 Bacteria 708
401 Ga0495627_084842 3300046453 Bacteria 915
402 Ga0495592_0119119 3300046454 Bacteria 1859
403 Ga0495603_0001101 3300046455 Bacteria 15686
404 Ga0495603_0012534 3300046455 Bacteria 5132
405 Ga0495629_0001113 3300046459 Bacteria 21262
406 Ga0495651_0002018 3300046462 Bacteria 15670
407 Ga0495651_0181903 3300046462 Bacteria 1487
408 Ga0495653_0015285 3300046463 Bacteria 6256
409 Ga0495594_0002332 3300046499 Bacteria 9882
410 Ga0495596_0175239 3300046500 Bacteria 834
411 Ga0495607_0053148 3300046501 Bacteria 2342
412 Ga0495608_0003978 3300046511 Bacteria 10611
413 Ga0495628_0491751 3300046516 Bacteria 887
414 Ga0495665_0016573 3300046531 Bacteria 3969
415 Ga0495640_0079410 3300046533 Bacteria 2184
416 Ga0495609_0296645 3300046538 Bacteria 659
417 Ga0495597_0032827 3300046542 Bacteria 2354
418 Ga0495597_0046653 3300046542 Bacteria 1919
419 Ga0495645_0061691 3300046543 Bacteria 2716
420 Ga0495645_0340896 3300046543 Bacteria 968
421 Ga0495622_0165352 3300046557 Bacteria 996
422 Ga0495667_0022658 3300046559 Bacteria 4231
423 Ga0495634_0239313 3300046642 Bacteria 1114
424 Ga0495625_0199177 3300046660 Bacteria 1323
425 Ga0495588_0001333 3300046674 Bacteria 10542
426 Ga0495588_0156613 3300046674 Bacteria 1204
427 Ga0495657_0398942 3300046675 Bacteria 809
428 Ga0495613_0001500 3300046689 Bacteria 17769
429 Ga0495613_0036742 3300046689 Bacteria 3632
430 Ga0495613_0055317 3300046689 Bacteria 2915
431 Ga0495624_0437298 3300046690 Bacteria 784
432 Ga0495676_0009550 3300047321 Bacteria 8833
433 Ga0495676_0012011 3300047321 Bacteria 7811
434 Ga0495676_0044789 3300047321 Bacteria 3608
435 Ga0495676_0372209 3300047321 Bacteria 952
436 Ga0495687_000798 3300047443 Bacteria 33919
437 Ga0495675_0075067 3300047444 Bacteria 2130
438 Ga0495675_0267633 3300047444 Bacteria 1022
439 Ga0495675_0385543 3300047444 Bacteria 819
440 Ga0495686_0184746 3300047472 Bacteria 1206
441 Ga0495614_0001138 3300048089 Bacteria 11412
442 Ga0496100_0482028 3300048903 Bacteria 954
443 Ga0496101_0152907 3300048904 Bacteria 1766
444 Ga0496102_0012688 3300048905 Bacteria 7297
445 Ga0496102_0183423 3300048905 Bacteria 1972
446 Ga0496102_0237936 3300048905 Bacteria 1717
447 Ga0496102_0804175 3300048905 Bacteria 862
448 Ga0496103_0050901 3300048906 Bacteria 2563
449 Ga0496103_0286928 3300048906 Bacteria 1059
450 Ga0496104_0241687 3300048907 Bacteria 1718
451 Ga0496104_0843849 3300048907 Bacteria 822
452 Ga0496104_0877413 3300048907 Bacteria 802
453 Ga0496104_0982743 3300048907 Bacteria 748
454 Ga0496104_1225879 3300048907 Bacteria 653
455 Ga0496105_0209236 3300048908 Bacteria 1590
456 Ga0496105_0265725 3300048908 Bacteria 1386
457 Ga0496108_0068542 3300048911 Bacteria 2993
458 Ga0496108_0560824 3300048911 Bacteria 996
459 Ga0496109_0019811 3300048912 Bacteria 5935
460 Ga0496109_0533971 3300048912 Bacteria 1107
461 Ga0496110_0008166 3300048913 Bacteria 8411
462 Ga0496110_0084023 3300048913 Bacteria 2841
463 Ga0496111_0063320 3300048914 Bacteria 2682
464 Ga0496113_0276007 3300048916 Bacteria 1344
465 Ga0496114_0006773 3300048917 Bacteria 9027
466 Ga0496114_0008434 3300048917 Bacteria 8162
467 Ga0496114_0015458 3300048917 Bacteria 6138
468 Ga0496114_0062977 3300048917 Bacteria 3105
469 Ga0496114_0093679 3300048917 Bacteria 2554
470 Ga0496114_0166863 3300048917 Bacteria 1917
471 Ga0496115_0155022 3300048918 Bacteria 1892
472 Ga0496115_0455337 3300048918 Bacteria 1033
473 Ga0496119_0056732 3300048922 Bacteria 2372
474 Ga0496120_0080599 3300048923 Bacteria 1764
475 Ga0496122_0073280 3300048925 Bacteria 2429
476 Ga0496123_0014774 3300048926 Bacteria 6446
477 Ga0496123_0099540 3300048926 Bacteria 1697
478 Ga0496126_0678816 3300048929 Bacteria 803
479 Ga0501321_005925 3300049537 Bacteria 1226
480 Ga0501325_002689 3300049541 Bacteria 1237
481 Ga0501031_0000156 3300049568 Bacteria 38816
482 Ga0501032_0001239 3300049569 Bacteria 20482
483 Ga0501032_0033769 3300049569 Bacteria 3505
484 Ga0501032_0061645 3300049569 Bacteria 2514
485 Ga0501033_0007166 3300049570 Bacteria 8700
486 Ga0501033_0074855 3300049570 Bacteria 2486
487 Ga0501034_0038502 3300049571 Bacteria 4841
488 Ga0501034_0482280 3300049571 Bacteria 1155
489 Ga0501036_0001565 3300049572 Bacteria 17677
490 Ga0501036_0294892 3300049572 Bacteria 1356
491 Ga0501037_0012633 3300049573 Bacteria 6222
492 Ga0501037_0124878 3300049573 Bacteria 1848
493 Ga0501037_0137283 3300049573 Bacteria 1751
494 Ga0501038_0002134 3300049574 Bacteria 18360
495 Ga0501038_0005429 3300049574 Bacteria 11845
496 Ga0501038_0180011 3300049574 Bacteria 1706
497 Ga0501038_0413895 3300049574 Bacteria 1041
498 Ga0501039_0002871 3300049575 Bacteria 12892
499 Ga0501039_0714058 3300049575 Bacteria 783
500 Ga0501039_0838501 3300049575 Bacteria 717
501 Ga0501040_0060424 3300049576 Bacteria 2604
502 Ga0501040_0160906 3300049576 Bacteria 1587
503 Ga0501041_0088221 3300049577 Bacteria 1914
504 Ga0501041_0324265 3300049577 Bacteria 972
505 Ga0501042_0027877 3300049578 Bacteria 3974
506 Ga0501042_0167176 3300049578 Bacteria 1587
507 Ga0501043_0030657 3300049579 Bacteria 4227
508 Ga0501043_0074677 3300049579 Bacteria 2663
509 Ga0501043_0254724 3300049579 Bacteria 1351
510 Ga0501043_0568752 3300049579 Bacteria 840
511 Ga0501046_0000631 3300049580 Bacteria 34597
512 Ga0501046_0026150 3300049580 Bacteria 4768
513 Ga0501047_0000098 3300049581 Bacteria 106464
514 Ga0501047_0044791 3300049581 Bacteria 4276
515 Ga0501047_0050719 3300049581 Bacteria 4007
516 Ga0501047_0089719 3300049581 Bacteria 2951
517 Ga0501047_0146895 3300049581 Bacteria 2234
518 Ga0501048_0005440 3300049582 Bacteria 9683
519 Ga0501048_0062552 3300049582 Bacteria 2634
520 Ga0501068_0071814 3300049584 Bacteria 2113
521 Ga0501069_0035604 3300049585 Bacteria 2743
522 Ga0501069_0228562 3300049585 Bacteria 1083
523 Ga0501070_0001342 3300049586 Bacteria 22005
524 Ga0501071_0074677 3300049587 Bacteria 2474
525 Ga0501071_0243802 3300049587 Bacteria 1355
526 Ga0501072_0046873 3300049588 Bacteria 3403
527 Ga0501072_0160426 3300049588 Bacteria 1794
528 Ga0501073_0003517 3300049589 Bacteria 11771
529 Ga0501074_0008613 3300049590 Bacteria 7386
530 Ga0501074_0507285 3300049590 Bacteria 854
531 Ga0501075_0114187 3300049591 Bacteria 2053
532 Ga0501076_0048833 3300049592 Bacteria 3344
533 Ga0501077_0099681 3300049593 Bacteria 1841
534 Ga0501207_063580 3300049654 Bacteria 681
535 Ga0501209_020275 3300049656 Bacteria 1565
536 Ga0501243_028584 3300049675 Bacteria 944
537 Ga0501256_007642 3300049685 Bacteria 996
538 Ga0501079_0346660 3300049741 Bacteria 1163
539 Ga0501080_0001365 3300049742 Bacteria 20415
540 Ga0501080_0252690 3300049742 Bacteria 1607
541 Ga0501081_0163117 3300049743 Bacteria 1607
542 Ga0501083_0004632 3300049744 Bacteria 9712
543 Ga0501035_0022179 3300049822 Bacteria 5833
544 Ga0501035_0102295 3300049822 Bacteria 2513
545 Ga0501035_0177161 3300049822 Bacteria 1838
546 Ga0501035_0277811 3300049822 Bacteria 1416
547 Ga0501035_0328140 3300049822 Bacteria 1284
548 Ga0501044_0047530 3300049823 Bacteria 4438
549 Ga0501044_0060814 3300049823 Bacteria 3866
550 Ga0501044_0067716 3300049823 Bacteria 3637
551 Ga0501044_0185176 3300049823 Bacteria 2047
552 Ga0501044_0238780 3300049823 Bacteria 1761
553 Ga0501044_0377847 3300049823 Bacteria 1332
554 Ga0501044_0687675 3300049823 Bacteria 909
555 Ga0501044_0968607 3300049823 Bacteria 723
556 nmdc:mga00v17_32684_c1 3300050491 Bacteria 3077
557 nmdc:mga00v17_382383_c1 3300050491 Bacteria 915
558 nmdc:mga00v17_45950_c1 3300050491 Bacteria 2640
559 nmdc:mga00v17_754_c1 3300050491 Bacteria 17588
560 nmdc:mga05p37_1124189_c1 3300050507 Bacteria 820
561 nmdc:mga05p37_5220_c1 3300050507 Bacteria 15246
562 nmdc:mga09592_5748_c1 3300050508 Bacteria 10114
563 nmdc:mga0qj67_7643_c1 3300050509 Bacteria 7988
564 nmdc:mga06r32_52574_c1 3300050510 Bacteria 3902
565 nmdc:mga08y16_41557_c1 3300050511 Bacteria 4817
566 nmdc:mga0rr50_515070_c1 3300050513 Bacteria 1018
567 nmdc:mga0sz30_27556_c1 3300050516 Bacteria 2334
568 Ga0495601_0039290 3300053077 Bacteria 2963
569 Ga0495655_0109373 3300053083 Bacteria 828
570 Ga0495619_0136275 3300053085 Bacteria 1689
571 Ga0500583_0228358 3300053092 Bacteria 922
572 Ga0500650_0255540 3300053098 Bacteria 785
573 Ga0500573_0135697 3300053140 Bacteria 1359
574 Ga0500577_0016883 3300053142 Bacteria 2312
575 Ga0500630_125752 3300053159 Bacteria 1128
576 Ga0501084_0015779 3300054114 Bacteria 6265
577 Ga0501082_0126820 3300060353 Bacteria 2213
578 Ga0466962_0036334 3300061719 Bacteria 2358
579 Ga0530510_0312294 3300061734 Bacteria 1177
580 Ga0530510_0421982 3300061734 Bacteria 1007
581 2583151250 2582580736 Bacteria 5325865
582 2501944069 2501939600 Bacteria 6907073
583 2643853313 2643221567 Bacteria 4163945
584 2644137273 2643221624 Bacteria 4384879
585 2644441762 2643221678 Bacteria 9540101
586 2644490682 2643221687 Bacteria 6500351
587 2644636978 2643221715 Bacteria 6671032
588 2645722296 2643221961 Bacteria 3919167
589 2645725174 2643221962 Bacteria 3874254
590 2676491150 2675903060 Bacteria 10051191
591 2774396334 2773857762 Bacteria 5971770
592 2784585986 2784132148 Bacteria 8627943
593 2786667149 2786546132 Bacteria 10419719
594 2791909833 2791354901 Bacteria 8322202
595 2795782920 2795385470 Bacteria 8317180
596 2795792748 2795385472 Bacteria 6627535
597 2808846787 2808606359 Bacteria 9866990
598 2808874719 2808606365 Bacteria 4301966
599 2809229487 2808606448 Bacteria 8656184
600 2812353321 2811994878 Bacteria 5992952
601 2812361608 2811994879 Bacteria 9313447
602 2816426579 2816332119 Bacteria 8120218
603 2819696094 2818991463 Bacteria 7948711
604 2844853686 2844852863 Bacteria 3849151
605 2852641684 2852635781 Bacteria 8251373
606 2862282320 2862281513 Bacteria 9621493
607 2866612183 2866612099 Bacteria 7543886
608 2867305302 2867302475 Bacteria 7087181
609 2877684334 2877676314 Bacteria 9512378
610 2891559464 2891554331 Bacteria 8812224
611 2895439061 2895427314 Bacteria 13147766
612 2899365452 2899359706 Bacteria 10940472
613 2899375265 2899370129 Bacteria 6781179
614 2902814880 2902810491 Bacteria 6794147
615 2902838457 2902837492 Bacteria 6697721
616 2912723728 2912715099 Bacteria 9460473
617 2919447032 2919446982 Bacteria 3994487
618 2919473806 2919468124 Bacteria 9133025
619 2929221809 2929219909 Bacteria 6984360
620 2946064557 2946064051 Bacteria 8957905
621 2946072983 2946072368 Bacteria 8999607
622 2954682236 2954673503 Bacteria 9685905
623 2954690688 2954682443 Bacteria 9862841
624 2954700516 2954691527 Bacteria 10720516
625 2995464771 2995463766 Bacteria 8577691
626 3006400002 3006393351 Bacteria 6615579
627 8047716431 8047710418 Bacteria 11023148
628 8055413999 8055412473 Bacteria 6257500
629 8056040483 8056037122 Bacteria 3854319
630 8056448502 8056447290 Bacteria 7680491
631 8056835003 8056829672 Bacteria 9045328
632 JGI24739J22299_10040345
633 JGI24735J21928_10016369
634 JGI25406J46586_10001637
635 JGI25406J46586_10003725
636 rootH1_10003415
637 rootH2_10183783
638 rootL2_10014789
639 rootH1_10145035
640 Ga0006562J51391_1103456
641 Ga0055540_1002007
642 Ga0055540_1003433
643 Ga0055540_1006416
644 Ga0070658_10096748
645 Ga0070683_100047783
646 Ga0070683_100291133
647 Ga0068869_100121106
648 Ga0070680_100608637
649 Ga0070682_100088645
650 Ga0070682_100157851
651 Ga0070682_100172550
652 Ga0070682_100375873
653 Ga0070682_100433088
654 Ga0070660_100145427
655 Ga0070668_100103773
656 Ga0070669_100516143
657 Ga0070674_100268092
658 Ga0070709_10047550
659 Ga0070714_100002594
660 Ga0070714_100016154
661 Ga0070714_100135919
662 Ga0070714_100147202
663 Ga0070714_100202508
664 Ga0070714_100468662
665 Ga0070714_100713357
666 Ga0070713_100004275
667 Ga0070713_100113909
668 Ga0070713_100131836
669 Ga0070713_100212933
670 Ga0070713_100538874
671 Ga0070713_100745717
672 Ga0070710_10216937
673 Ga0070711_100057108
674 Ga0070705_100418083
675 Ga0070700_100000004
676 Ga0070708_100002178
677 Ga0070708_100128832
678 Ga0070663_100021781
679 Ga0070663_100212845
680 Ga0070662_100201403
681 Ga0070681_10034417
682 Ga0068867_100693467
683 Ga0070698_100047971
684 Ga0070679_100160353
685 Ga0070679_100486669
686 Ga0070679_100766318
687 Ga0070693_100034918
688 Ga0070665_100282844
689 Ga0068855_100024221
690 Ga0068855_100288270
691 Ga0068857_100011524
692 Ga0068857_100086897
693 Ga0068857_100149319
694 Ga0068854_100015888
695 Ga0068856_100076829
696 Ga0068856_100226816
697 Ga0070702_100002838
698 Ga0068852_101334281
699 Ga0068866_10060061
700 Ga0068861_100554130
701 Ga0081455_10002447
702 Ga0081455_10003072
703 Ga0081455_10012577
704 Ga0081455_10016606
705 Ga0081455_10024374
706 Ga0081455_10036749
707 Ga0081455_10194741
708 Ga0081539_10000070
709 Ga0081539_10000254
710 Ga0070717_10027491
711 Ga0070717_10097984
712 Ga0075365_10081481
713 Ga0075363_100081645
714 Ga0075363_100265887
715 Ga0075364_10001141
716 Ga0075364_10259259
717 Ga0070715_10076242
718 Ga0070712_100120879
719 Ga0070712_100262324
720 Ga0075367_10001685
721 Ga0075369_10012941
722 Ga0075369_10116749
723 Ga0075370_10005917
724 Ga0075370_10066105
725 Ga0075428_100000757
726 Ga0075428_100018665
727 Ga0075428_100585704
728 Ga0075430_100000817
729 Ga0075431_100001797
730 Ga0075434_100000259
731 Ga0075429_100001237
732 Ga0068865_100065478
733 Ga0105240_10213606
734 Ga0111539_11105338
735 Ga0105245_10031359
736 Ga0114129_10001234
737 Ga0114129_10002198
738 Ga0114129_10207985
739 Ga0105243_10142040
740 Ga0105242_10023921
741 Ga0105238_10053394
742 Ga0105249_10085153
743 Ga0105239_10070111
744 Ga0105246_10416349
745 Ga0157329_1001350
746 Ga0157319_1006178
747 Ga0157313_1006778
748 Ga0157371_10093316
749 Ga0157369_10041625
750 Ga0157369_10247934
751 Ga0157369_10371910
752 Ga0157369_10982381
753 Ga0157369_11304241
754 Ga0157369_11360040
755 Ga0157378_10011256
756 Ga0157378_10291398
757 Ga0163162_10102712
758 Ga0157372_10088589
759 Ga0157372_10113250
760 Ga0157372_10135015
761 Ga0157375_10089733
762 Ga0157375_10484633
763 Ga0157375_10834001
764 Ga0163163_11230070
765 Ga0157380_10102347
766 Ga0157380_10196761
767 Ga0163161_10093344
768 Ga0163161_10201137
769 Ga0197907_10914288
770 Ga0206354_10996845
771 Ga0206354_11257981
772 Ga0206353_10330845
773 Ga0206353_11352776
774 Ga0206353_11619359
775 Ga0213875_10002535
776 Ga0213875_10032956
777 Ga0209673_1041673
778 Ga0207426_1010888
779 Ga0209051_1000642
780 Ga0209051_1002013
781 Ga0209051_1002782
782 Ga0207692_10075195
783 Ga0207692_10337443
784 Ga0207688_10007682
785 Ga0207647_10009757
786 Ga0207685_10070493
787 Ga0207699_10021411
788 Ga0207699_10508831
789 Ga0207705_10068918
790 Ga0207707_10058201
791 Ga0207695_10167760
792 Ga0207693_10071272
793 Ga0207693_10160894
794 Ga0207693_10236317
795 Ga0207660_10110128
796 Ga0207657_10043019
797 Ga0207652_10156847
798 Ga0207652_10371205
799 Ga0207694_10039622
800 Ga0207650_10299994
801 Ga0207687_10031971
802 Ga0207700_10032649
803 Ga0207700_10103145
804 Ga0207700_10251032
805 Ga0207700_10436661
806 Ga0207664_10003810
807 Ga0207664_10009642
808 Ga0207664_10813807
809 Ga0207706_10002019
810 Ga0207709_10021578
811 Ga0207709_10082261
812 Ga0207669_10286763
813 Ga0207669_10485726
814 Ga0207665_10112181
815 Ga0207691_10360635
816 Ga0207689_10132669
817 Ga0207661_10027724
818 Ga0207661_10357533
819 Ga0207661_10965626
820 Ga0207667_10046497
821 Ga0207667_10103853
822 Ga0207712_10179283
823 Ga0207668_10021530
824 Ga0207668_10138047
825 Ga0207658_10053249
826 Ga0207678_10127075
827 Ga0207678_10492296
828 Ga0207708_10000008
829 Ga0207708_10070023
830 Ga0207702_10080593
831 Ga0207702_10456545
832 Ga0207648_10088774
833 Ga0207674_10033183
834 Ga0207674_10087952
835 Ga0207675_100003090
836 Ga0207698_10271074
837 Ga0207698_10467494
838 Ga0268264_10112449
839 Ga0265337_1000139
840 Ga0265326_10001897
841 Ga0265319_1001580
842 Ga0265334_10000881
843 Ga0265318_10008159
844 Ga0265322_10008419
845 Ga0265336_10001858
846 Ga0307517_10001013
847 Ga0307515_10092155
848 Ga0265338_10001072
849 Ga0265338_10003430
850 Ga0265324_10002085
851 Ga0307511_10000716
852 Ga0307511_10246958
853 Ga0307512_10003223
854 Ga0307512_10044093
855 Ga0307512_10100058
856 Ga0316181_1271580
857 Ga0316182_1115344
858 Ga0265320_10008860
859 Ga0265325_10011746
860 Ga0265340_10002439
861 Ga0265327_10000001
862 Ga0265316_10049682
863 Ga0307509_10053620
864 Ga0307408_100003935
865 Ga0307408_100046020
866 Ga0307408_100382878
867 Ga0307508_10000420
868 Ga0307508_10013931
869 Ga0307508_10022040
870 Ga0307508_10172505
871 Ga0307508_10229685
872 Ga0307514_10005876
873 Ga0307514_10032208
874 Ga0316575_10001555
875 Ga0316575_10101314
876 Ga0316579_10004999
877 Ga0316579_10106210
878 Ga0265314_10009482
879 Ga0265342_10001481
880 Ga0316576_10000788
881 Ga0316576_10001893
882 Ga0316576_10089783
883 Ga0316578_10002580
884 Ga0316578_10017406
885 Ga0316578_10048453
886 Ga0307516_10007114
887 Ga0307516_10012388
888 Ga0307405_10150676
889 Ga0307405_10558498
890 Ga0316577_10036156
891 Ga0307413_10085639
892 Ga0307410_10010084
893 Ga0307410_10013335
894 Ga0307406_10000351
895 Ga0307406_10024208
896 Ga0307406_10037144
897 Ga0307407_10017562
898 Ga0307407_10031676
899 Ga0307412_10130544
900 Ga0307412_10439233
901 Ga0307409_100000384
902 Ga0307409_100122576
903 Ga0307409_100502789
904 Ga0307416_100000202
905 Ga0307416_100026206
906 Ga0307414_10042079
907 Ga0307414_10115164
908 Ga0307411_10073510
909 Ga0307411_10081397
910 Ga0307415_100013857
911 Ga0316583_10050731
912 Ga0316585_10111749
913 Ga0316580_10004593
914 Ga0307507_10024824
915 Ga0307507_10130792
916 Ga0307507_10143428
917 Ga0307510_10023755
918 Ga0307510_10077980
919 Ga0307510_10389852
920 Ga0316214_1010824
921 Ga0316212_1010372
922 Ga0373934_0026424
923 Ga0316574_0002679
924 Ga0316574_0004704
925 Ga0316574_0007907
926 Ga0316574_0017713
927 Ga0316582_0006564
928 Ga0316582_0037548
929 Ga0316584_0012108
930 Ga0316584_0549131
931 Ga0373925_0000070
932 Ga0395899_0099237
933 Ga0395900_0071554
934 Ga0395898_0001337
935 Ga0395898_0017519
936 Ga0395898_0053823
937 Ga0395898_0769273
938 Ga0395905_0527475
939 Ga0436364_0068424
940 Ga0436364_0542878
941 Ga0436364_1164493
942 Ga0436364_1494248
943 Ga0395901_0180826
944 Ga0395901_0243557
945 Ga0395901_0245117
946 Ga0395901_0246636
947 Ga0395901_0508648
948 Ga0436363_0425102
949 Ga0439439_0056570
950 Ga0439461_0001304
951 Ga0439466_0004989
952 Ga0439465_0009226
953 Ga0439465_0179147
954 Ga0451793_0334330
955 Ga0451793_0597900
956 Ga0451793_1548608
957 Ga0451797_1273634
958 Ga0451797_1321321
959 Ga0451800_0122989
960 Ga0451802_1889812
961 Ga0451806_151393
962 Ga0451806_553355
963 Ga0451833_0553594
964 Ga0451835_0441631
965 Ga0451837_0303922
966 Ga0451839_0591314
967 Ga0451841_0973683
968 Ga0451841_1386440
969 Ga0451841_1392353
970 Ga0451853_0320331
971 Ga0451853_1265679
972 Ga0451853_3357292
973 Ga0439431_0002848
974 Ga0439433_0022091
975 Ga0439445_0008482
976 Ga0439448_0003774
977 Ga0439448_0011537
978 Ga0439449_0023583
979 Ga0439455_0063658
980 Ga0439457_004429
981 Ga0439462_0007917
982 Ga0439462_0063835
983 Ga0439463_050439
984 Ga0450905_030945
985 Ga0439458_0000757
986 Ga0439434_0000565
987 Ga0439444_0008099
988 Ga0439460_0003458
989 Ga0439440_0008143
990 Ga0466969_0032085
991 Ga0466969_0074007
992 Ga0466969_0226037
993 Ga0466972_0003466
994 Ga0466972_0018734
995 Ga0466972_0039682
996 Ga0466965_0012677
997 Ga0466965_0045872
998 Ga0466966_0003786
999 Ga0466966_0031536
1000 Ga0466966_0253923
1001 Ga0466961_0013905
1002 Ga0466961_0147636
1003 Ga0466963_0117532
1004 Ga0466963_0204243
1005 Ga0466964_0391567
1006 Ga0466971_0055180
1007 Ga0466968_0008086
1008 Ga0466968_0143020
1009 Ga0466970_0022919
1010 Ga0466970_0059792
1011 Ga0466957_0022611
1012 Ga0466957_0106901
1013 Ga0466957_0193868
1014 Ga0466960_0002473
1015 Ga0466960_0012455
1016 Ga0466960_0090396
1017 Ga0466960_0355264
1018 Ga0466960_0404554
1019 Ga0466959_0006762
1020 Ga0466959_0058118
1021 Ga0466959_0119579
1022 Ga0466959_0131278
1023 Ga0466958_0019437
1024 Ga0466967_0010867
1025 Ga0466967_0044351
1026 Ga0466967_0056145
1027 Ga0466967_0058768
1028 Ga0466967_0101812
1029 Ga0466967_0225404
1030 Ga0466967_0275606
1031 Ga0466967_1357491
1032 Ga0495627_084842
1033 Ga0495592_0119119
1034 Ga0495603_0001101
1035 Ga0495603_0012534
1036 Ga0495629_0001113
1037 Ga0495651_0002018
1038 Ga0495651_0181903
1039 Ga0495653_0015285
1040 Ga0495594_0002332
1041 Ga0495596_0175239
1042 Ga0495607_0053148
1043 Ga0495608_0003978
1044 Ga0495628_0491751
1045 Ga0495665_0016573
1046 Ga0495640_0079410
1047 Ga0495609_0296645
1048 Ga0495597_0032827
1049 Ga0495597_0046653
1050 Ga0495645_0061691
1051 Ga0495645_0340896
1052 Ga0495622_0165352
1053 Ga0495667_0022658
1054 Ga0495634_0239313
1055 Ga0495625_0199177
1056 Ga0495588_0001333
1057 Ga0495588_0156613
1058 Ga0495657_0398942
1059 Ga0495613_0001500
1060 Ga0495613_0036742
1061 Ga0495613_0055317
1062 Ga0495624_0437298
1063 Ga0495676_0009550
1064 Ga0495676_0012011
1065 Ga0495676_0044789
1066 Ga0495676_0372209
1067 Ga0495687_000798
1068 Ga0495675_0075067
1069 Ga0495675_0267633
1070 Ga0495675_0385543
1071 Ga0495686_0184746
1072 Ga0495614_0001138
1073 Ga0496100_0482028
1074 Ga0496101_0152907
1075 Ga0496102_0012688
1076 Ga0496102_0183423
1077 Ga0496102_0237936
1078 Ga0496102_0804175
1079 Ga0496103_0050901
1080 Ga0496103_0286928
1081 Ga0496104_0241687
1082 Ga0496104_0843849
1083 Ga0496104_0877413
1084 Ga0496104_0982743
1085 Ga0496104_1225879
1086 Ga0496105_0209236
1087 Ga0496105_0265725
1088 Ga0496108_0068542
1089 Ga0496108_0560824
1090 Ga0496109_0019811
1091 Ga0496109_0533971
1092 Ga0496110_0008166
1093 Ga0496110_0084023
1094 Ga0496111_0063320
1095 Ga0496113_0276007
1096 Ga0496114_0006773
1097 Ga0496114_0008434
1098 Ga0496114_0015458
1099 Ga0496114_0062977
1100 Ga0496114_0093679
1101 Ga0496114_0166863
1102 Ga0496115_0155022
1103 Ga0496115_0455337
1104 Ga0496119_0056732
1105 Ga0496120_0080599
1106 Ga0496122_0073280
1107 Ga0496123_0014774
1108 Ga0496123_0099540
1109 Ga0496126_0678816
1110 Ga0501321_005925
1111 Ga0501325_002689
1112 Ga0501031_0000156
1113 Ga0501032_0001239
1114 Ga0501032_0033769
1115 Ga0501032_0061645
1116 Ga0501033_0007166
1117 Ga0501033_0074855
1118 Ga0501034_0038502
1119 Ga0501034_0482280
1120 Ga0501036_0001565
1121 Ga0501036_0294892
1122 Ga0501037_0012633
1123 Ga0501037_0124878
1124 Ga0501037_0137283
1125 Ga0501038_0002134
1126 Ga0501038_0005429
1127 Ga0501038_0180011
1128 Ga0501038_0413895
1129 Ga0501039_0002871
1130 Ga0501039_0714058
1131 Ga0501039_0838501
1132 Ga0501040_0060424
1133 Ga0501040_0160906
1134 Ga0501041_0088221
1135 Ga0501041_0324265
1136 Ga0501042_0027877
1137 Ga0501042_0167176
1138 Ga0501043_0030657
1139 Ga0501043_0074677
1140 Ga0501043_0254724
1141 Ga0501043_0568752
1142 Ga0501046_0000631
1143 Ga0501046_0026150
1144 Ga0501047_0000098
1145 Ga0501047_0044791
1146 Ga0501047_0050719
1147 Ga0501047_0089719
1148 Ga0501047_0146895
1149 Ga0501048_0005440
1150 Ga0501048_0062552
1151 Ga0501068_0071814
1152 Ga0501069_0035604
1153 Ga0501069_0228562
1154 Ga0501070_0001342
1155 Ga0501071_0074677
1156 Ga0501071_0243802
1157 Ga0501072_0046873
1158 Ga0501072_0160426
1159 Ga0501073_0003517
1160 Ga0501074_0008613
1161 Ga0501074_0507285
1162 Ga0501075_0114187
1163 Ga0501076_0048833
1164 Ga0501077_0099681
1165 Ga0501207_063580
1166 Ga0501209_020275
1167 Ga0501243_028584
1168 Ga0501256_007642
1169 Ga0501079_0346660
1170 Ga0501080_0001365
1171 Ga0501080_0252690
1172 Ga0501081_0163117
1173 Ga0501083_0004632
1174 Ga0501035_0022179
1175 Ga0501035_0102295
1176 Ga0501035_0177161
1177 Ga0501035_0277811
1178 Ga0501035_0328140
1179 Ga0501044_0047530
1180 Ga0501044_0060814
1181 Ga0501044_0067716
1182 Ga0501044_0185176
1183 Ga0501044_0238780
1184 Ga0501044_0377847
1185 Ga0501044_0687675
1186 Ga0501044_0968607
1187 nmdc:mga00v17_32684_c1
1188 nmdc:mga00v17_382383_c1
1189 nmdc:mga00v17_45950_c1
1190 nmdc:mga00v17_754_c1
1191 nmdc:mga05p37_1124189_c1
1192 nmdc:mga05p37_5220_c1
1193 nmdc:mga09592_5748_c1
1194 nmdc:mga0qj67_7643_c1
1195 nmdc:mga06r32_52574_c1
1196 nmdc:mga08y16_41557_c1
1197 nmdc:mga0rr50_515070_c1
1198 nmdc:mga0sz30_27556_c1
1199 Ga0495601_0039290
1200 Ga0495655_0109373
1201 Ga0495619_0136275
1202 Ga0500583_0228358
1203 Ga0500650_0255540
1204 Ga0500573_0135697
1205 Ga0500577_0016883
1206 Ga0500630_125752
1207 Ga0501084_0015779
1208 Ga0501082_0126820
1209 Ga0466962_0036334
1210 Ga0530510_0312294
1211 Ga0530510_0421982
1212 2583151250
1213 2501944069
1214 2643853313
1215 2644137273
1216 2644441762
1217 2644490682
1218 2644636978
1219 2645722296
1220 2645725174
1221 2676491150
1222 2774396334
1223 2784585986
1224 2786667149
1225 2791909833
1226 2795782920
1227 2795792748
1228 2808846787
1229 2808874719
1230 2809229487
1231 2812353321
1232 2812361608
1233 2816426579
1234 2819696094
1235 2844853686
1236 2852641684
1237 2862282320
1238 2866612183
1239 2867305302
1240 2877684334
1241 2891559464
1242 2895439061
1243 2899365452
1244 2899375265
1245 2902814880
1246 2902838457
1247 2912723728
1248 2919447032
1249 2919473806
1250 2929221809
1251 2946064557
1252 2946072983
1253 2954682236
1254 2954690688
1255 2954700516
1256 2995464771
1257 3006400002
1258 8047716431
1259 8055413999
1260 8056040483
1261 8056448502
1262 8056835003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13532

2OG-FeII_Oxy_2

2OG-Fe(II) oxygenase superfamily

109

235

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rzl-assembly2.cif.gz_D duplex interrogation by a direct dna repair protein in the search of damage 0.8431 24 204
3buc-assembly1.cif.gz_A x-ray structure of human abh2 bound to dsdna with mn(ii) and 2kg 0.8314 24 204
3rzl-assembly1.cif.gz_A duplex interrogation by a direct dna repair protein in the search of damage 0.8282 22 204
3rzg-assembly1.cif.gz_A duplex interrogation by a direct dna repair protein in the search of damage 0.8271 24 204
6xwv-assembly1.cif.gz_A crystal structure of drosophila melanogaster cenp-c bound to cal1 0.8256 112 203
ID Description Score Start End Superfamily
af_L7N6A4_38_203_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9881 45 205 2.60.120.590
af_L7N6A4_38_203_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9529 45 205 2.60.120.590
af_Q9SIE0_90_314_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8498 24 203 2.60.120.590
3rzlA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8282 22 204 2.60.120.590
2iuwA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8138 17 204 2.60.120.590
ID Description Score Start End GO Terms
AF-A0A1U1W8Z7-F1-model_v4 deleted 0.9951 90 208
AF-A0A655ADR3-F1-model_v4 Conserved protein of uncharacterized function, thought to be regulated by Rv2720/LexA 0.9895 88 208 GO:0006307
GO:0051213
AF-A0A1M4EIB5-F1-model_v4 Alkylated DNA repair protein AlkB 0.9865 15 208 GO:0006307
GO:0051213
AF-A0A2E8Z0B1-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9852 18 208 GO:0006307
GO:0051213
AF-A0A0F4J0V1-F1-model_v4 deleted 0.9828 16 208

Map