F470819
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 630 | 336 | 614 | 273 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10042082|Ga0105247_100420822 |
| Length | 322 |
| Sequence | MATYAIGDIQGCFQGLQLLLDEIGFDLLSDRLWFVGDMVNRGPDSLATLRFVRGLGERAVAVLGNHDLHLLTVAEGLEKLRRDDTLDDVLAAPDREELLVWLRHRPLMHYEDGIAMVHAGLLPSWSVSRALELAAEIESKLRNESYRSFLAKMYGNRPDRWNESLTGYDRLRVIVNAMTRLRLCSTDGVMEFGHKGRLKALPSGYVPWFEAPGRRSRDTPVICGHWSALGLYASENLFALDTGCLWGRRLTALRIEDRKIFQISCRGLAGLSGRNSLFALACQVTAGLPADLDGRAKHQVGVQCWIAQYQAHRFQQRAIIRI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 2 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 3 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 4 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 5 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 6 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 7 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 8 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 9 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 10 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 11 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 12 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 13 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 14 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 15 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 16 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 17 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 18 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 19 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 203 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 210 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 213 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 216 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 219 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 220 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 221 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 222 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 223 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 224 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 226 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 231 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 239 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 243 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 249 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 250 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 251 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 252 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 253 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 254 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 255 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 256 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 257 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 258 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 259 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 260 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 261 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 262 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 263 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 264 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 265 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 266 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 267 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 281 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 288 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 291 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 292 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 293 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 294 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 295 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 298 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 318 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 324 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 325 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 336 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.46 |
| Metatranscriptomes | 0 |
| Isolates | 2.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.97 |
| Nodule | 0.32 |
| Rhizoplane | 1.59 |
| Rhizosphere | 85.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1011447 | 3300001976 | Bacteria | 1160 |
| 2 | JGI24750J21931_1007051 | 3300002070 | Bacteria | 1409 |
| 3 | JGI25151J46595_10000606 | 3300003187 | Bacteria | 31425 |
| 4 | JGI25406J46586_10011860 | 3300003203 | Bacteria | 3805 |
| 5 | Ga0055529_1001538 | 3300003763 | Bacteria | 6592 |
| 6 | Ga0070658_10654406 | 3300005327 | Bacteria | 911 |
| 7 | Ga0070683_100097814 | 3300005329 | Bacteria | 2761 |
| 8 | Ga0070690_100000082 | 3300005330 | Bacteria | 46700 |
| 9 | Ga0070690_100047924 | 3300005330 | Bacteria | 2719 |
| 10 | Ga0070690_100074421 | 3300005330 | Bacteria | 2212 |
| 11 | Ga0070690_100154835 | 3300005330 | Bacteria | 1566 |
| 12 | Ga0070670_100001931 | 3300005331 | Bacteria | 16973 |
| 13 | Ga0070670_100007759 | 3300005331 | Bacteria | 9129 |
| 14 | Ga0070677_10186538 | 3300005333 | Bacteria | 991 |
| 15 | Ga0068869_100000044 | 3300005334 | Bacteria | 52351 |
| 16 | Ga0068869_100077260 | 3300005334 | Bacteria | 2476 |
| 17 | Ga0068869_100449209 | 3300005334 | Bacteria | 1068 |
| 18 | Ga0070666_10036676 | 3300005335 | Bacteria | 3256 |
| 19 | Ga0070666_10037618 | 3300005335 | Bacteria | 3218 |
| 20 | Ga0070680_100034292 | 3300005336 | Bacteria | 4092 |
| 21 | Ga0070680_100244994 | 3300005336 | Bacteria | 1515 |
| 22 | Ga0070680_100328881 | 3300005336 | Bacteria | 1298 |
| 23 | Ga0070682_100007785 | 3300005337 | Bacteria | 6035 |
| 24 | Ga0068868_100000458 | 3300005338 | Bacteria | 27113 |
| 25 | Ga0068868_100001015 | 3300005338 | Bacteria | 19169 |
| 26 | Ga0068868_100070416 | 3300005338 | Bacteria | 2789 |
| 27 | Ga0070689_100007655 | 3300005340 | Bacteria | 7566 |
| 28 | Ga0070689_100232583 | 3300005340 | Bacteria | 1515 |
| 29 | Ga0070691_10000573 | 3300005341 | Bacteria | 14042 |
| 30 | Ga0070687_100000034 | 3300005343 | Bacteria | 43229 |
| 31 | Ga0070687_100003898 | 3300005343 | Bacteria | 5866 |
| 32 | Ga0070687_100009500 | 3300005343 | Bacteria | 4171 |
| 33 | Ga0070687_100073346 | 3300005343 | Bacteria | 1844 |
| 34 | Ga0070661_100000366 | 3300005344 | Bacteria | 35667 |
| 35 | Ga0070692_10025480 | 3300005345 | Bacteria | 2915 |
| 36 | Ga0070692_10334654 | 3300005345 | Bacteria | 936 |
| 37 | Ga0070668_100050037 | 3300005347 | Bacteria | 3216 |
| 38 | Ga0070668_100091489 | 3300005347 | Bacteria | 2399 |
| 39 | Ga0070669_100088306 | 3300005353 | Bacteria | 2320 |
| 40 | Ga0070669_100099653 | 3300005353 | Bacteria | 2190 |
| 41 | Ga0070669_100333472 | 3300005353 | Bacteria | 1227 |
| 42 | Ga0070675_100000296 | 3300005354 | Bacteria | 33297 |
| 43 | Ga0070675_100042937 | 3300005354 | Bacteria | 3694 |
| 44 | Ga0070675_100100791 | 3300005354 | Bacteria | 2432 |
| 45 | Ga0070675_100101804 | 3300005354 | Bacteria | 2420 |
| 46 | Ga0070675_100134168 | 3300005354 | Bacteria | 2112 |
| 47 | Ga0070671_100001203 | 3300005355 | Bacteria | 19368 |
| 48 | Ga0070671_100080861 | 3300005355 | Bacteria | 2717 |
| 49 | Ga0070674_100030818 | 3300005356 | Bacteria | 3547 |
| 50 | Ga0070673_100000095 | 3300005364 | Bacteria | 39351 |
| 51 | Ga0070673_100016520 | 3300005364 | Bacteria | 5222 |
| 52 | Ga0070673_100037994 | 3300005364 | Bacteria | 3673 |
| 53 | Ga0070667_100275420 | 3300005367 | Bacteria | 1510 |
| 54 | Ga0070703_10004765 | 3300005406 | Bacteria | 3795 |
| 55 | Ga0070701_10000346 | 3300005438 | Bacteria | 15392 |
| 56 | Ga0070711_100096291 | 3300005439 | Bacteria | 2144 |
| 57 | Ga0070705_100000030 | 3300005440 | Bacteria | 71489 |
| 58 | Ga0070700_100000552 | 3300005441 | Bacteria | 18819 |
| 59 | Ga0070700_100121428 | 3300005441 | Bacteria | 1751 |
| 60 | Ga0070694_100000706 | 3300005444 | Bacteria | 18607 |
| 61 | Ga0070694_100078873 | 3300005444 | Bacteria | 2285 |
| 62 | Ga0070708_100096758 | 3300005445 | Bacteria | 2697 |
| 63 | Ga0070678_100000184 | 3300005456 | Bacteria | 27334 |
| 64 | Ga0070678_100027655 | 3300005456 | Bacteria | 3854 |
| 65 | Ga0070678_100100168 | 3300005456 | Bacteria | 2244 |
| 66 | Ga0070662_100129552 | 3300005457 | Bacteria | 1943 |
| 67 | Ga0070662_100472968 | 3300005457 | Bacteria | 1043 |
| 68 | Ga0070681_10054445 | 3300005458 | Bacteria | 3987 |
| 69 | Ga0070681_10071328 | 3300005458 | Bacteria | 3438 |
| 70 | Ga0068867_100000032 | 3300005459 | Bacteria | 84727 |
| 71 | Ga0068867_100002439 | 3300005459 | Bacteria | 13068 |
| 72 | Ga0068867_100177219 | 3300005459 | Bacteria | 1692 |
| 73 | Ga0068867_100236075 | 3300005459 | Bacteria | 1480 |
| 74 | Ga0070685_10008470 | 3300005466 | Bacteria | 5287 |
| 75 | Ga0070706_100083857 | 3300005467 | Bacteria | 2953 |
| 76 | Ga0070706_100124223 | 3300005467 | Bacteria | 2406 |
| 77 | Ga0070707_100063295 | 3300005468 | Bacteria | 3550 |
| 78 | Ga0070698_100078792 | 3300005471 | Bacteria | 3293 |
| 79 | Ga0070699_100044821 | 3300005518 | Bacteria | 3829 |
| 80 | Ga0070699_100111502 | 3300005518 | Bacteria | 2402 |
| 81 | Ga0070679_100003506 | 3300005530 | Bacteria | 14366 |
| 82 | Ga0070679_100268692 | 3300005530 | Bacteria | 1660 |
| 83 | Ga0070679_100365161 | 3300005530 | Bacteria | 1391 |
| 84 | Ga0070684_100075658 | 3300005535 | Bacteria | 2970 |
| 85 | Ga0070697_100043101 | 3300005536 | Bacteria | 3653 |
| 86 | Ga0070697_100084037 | 3300005536 | Bacteria | 2625 |
| 87 | Ga0068853_100012831 | 3300005539 | Bacteria | 6826 |
| 88 | Ga0070672_100000230 | 3300005543 | Bacteria | 31233 |
| 89 | Ga0070672_100459528 | 3300005543 | Bacteria | 1097 |
| 90 | Ga0070686_100001608 | 3300005544 | Bacteria | 12699 |
| 91 | Ga0070686_100005201 | 3300005544 | Bacteria | 7189 |
| 92 | Ga0070695_100000514 | 3300005545 | Bacteria | 20333 |
| 93 | Ga0070695_100039124 | 3300005545 | Bacteria | 2996 |
| 94 | Ga0070695_100059250 | 3300005545 | Bacteria | 2478 |
| 95 | Ga0070696_100000089 | 3300005546 | Bacteria | 44686 |
| 96 | Ga0070693_100000100 | 3300005547 | Bacteria | 38176 |
| 97 | Ga0070665_100056461 | 3300005548 | Bacteria | 3936 |
| 98 | Ga0070665_100068180 | 3300005548 | Bacteria | 3567 |
| 99 | Ga0070665_100527633 | 3300005548 | Bacteria | 1192 |
| 100 | Ga0070704_100001681 | 3300005549 | Bacteria | 12024 |
| 101 | Ga0070704_100005808 | 3300005549 | Bacteria | 7222 |
| 102 | Ga0070704_100014934 | 3300005549 | Bacteria | 4862 |
| 103 | Ga0068855_100000695 | 3300005563 | Bacteria | 41137 |
| 104 | Ga0070664_100000172 | 3300005564 | Bacteria | 45323 |
| 105 | Ga0068857_100274255 | 3300005577 | Bacteria | 1550 |
| 106 | Ga0068854_100002365 | 3300005578 | Bacteria | 11628 |
| 107 | Ga0068854_100055460 | 3300005578 | Bacteria | 2853 |
| 108 | Ga0068856_100014214 | 3300005614 | Bacteria | 7695 |
| 109 | Ga0068856_100062178 | 3300005614 | Bacteria | 3688 |
| 110 | Ga0070702_100000001 | 3300005615 | Bacteria | 87224 |
| 111 | Ga0070702_100007611 | 3300005615 | Bacteria | 5191 |
| 112 | Ga0070702_100162023 | 3300005615 | Bacteria | 1447 |
| 113 | Ga0068852_100001180 | 3300005616 | Bacteria | 17310 |
| 114 | Ga0068852_100123819 | 3300005616 | Bacteria | 2371 |
| 115 | Ga0068859_100000149 | 3300005617 | Bacteria | 66296 |
| 116 | Ga0068859_100010619 | 3300005617 | Bacteria | 9266 |
| 117 | Ga0068859_100085816 | 3300005617 | Bacteria | 3193 |
| 118 | Ga0068859_100149686 | 3300005617 | Bacteria | 2410 |
| 119 | Ga0068859_100588132 | 3300005617 | Bacteria | 1206 |
| 120 | Ga0068864_100001436 | 3300005618 | Bacteria | 19650 |
| 121 | Ga0068864_100007335 | 3300005618 | Bacteria | 9072 |
| 122 | Ga0068864_100087693 | 3300005618 | Bacteria | 2740 |
| 123 | Ga0068864_100232421 | 3300005618 | Bacteria | 1706 |
| 124 | Ga0068866_10000277 | 3300005718 | Bacteria | 24435 |
| 125 | Ga0068866_10037083 | 3300005718 | Bacteria | 2392 |
| 126 | Ga0068861_100000057 | 3300005719 | Bacteria | 52351 |
| 127 | Ga0068861_100211999 | 3300005719 | Bacteria | 1632 |
| 128 | Ga0068861_100317325 | 3300005719 | Bacteria | 1356 |
| 129 | Ga0068851_10000892 | 3300005834 | Bacteria | 12882 |
| 130 | Ga0068870_10015052 | 3300005840 | Bacteria | 3664 |
| 131 | Ga0068870_10041112 | 3300005840 | Bacteria | 2401 |
| 132 | Ga0068863_100020746 | 3300005841 | Bacteria | 6276 |
| 133 | Ga0068863_100040403 | 3300005841 | Bacteria | 4435 |
| 134 | Ga0068863_100057945 | 3300005841 | Bacteria | 3666 |
| 135 | Ga0068863_100260396 | 3300005841 | Bacteria | 1677 |
| 136 | Ga0068858_100000289 | 3300005842 | Bacteria | 54365 |
| 137 | Ga0068858_100008373 | 3300005842 | Bacteria | 9948 |
| 138 | Ga0068858_100008871 | 3300005842 | Bacteria | 9642 |
| 139 | Ga0068858_100712041 | 3300005842 | Bacteria | 977 |
| 140 | Ga0068860_100001090 | 3300005843 | Bacteria | 29921 |
| 141 | Ga0068860_100036010 | 3300005843 | Bacteria | 4744 |
| 142 | Ga0068860_100324827 | 3300005843 | Bacteria | 1510 |
| 143 | Ga0068860_100447918 | 3300005843 | Bacteria | 1283 |
| 144 | Ga0068862_100000409 | 3300005844 | Bacteria | 46422 |
| 145 | Ga0068862_100028276 | 3300005844 | Bacteria | 4720 |
| 146 | Ga0068862_100232417 | 3300005844 | Bacteria | 1673 |
| 147 | Ga0068862_100239497 | 3300005844 | Bacteria | 1649 |
| 148 | Ga0081539_10004364 | 3300005985 | Bacteria | 15760 |
| 149 | Ga0075364_10004227 | 3300006051 | Bacteria | 8247 |
| 150 | Ga0075364_10006499 | 3300006051 | Bacteria | 6873 |
| 151 | Ga0075364_10048089 | 3300006051 | Bacteria | 2779 |
| 152 | Ga0075364_10202908 | 3300006051 | Bacteria | 1344 |
| 153 | Ga0075364_10313467 | 3300006051 | Bacteria | 1068 |
| 154 | Ga0075367_10186424 | 3300006178 | Bacteria | 1294 |
| 155 | Ga0075369_10000244 | 3300006186 | Bacteria | 16160 |
| 156 | Ga0075366_10002077 | 3300006195 | Bacteria | 10171 |
| 157 | Ga0097621_100000958 | 3300006237 | Bacteria | 20242 |
| 158 | Ga0097621_100001810 | 3300006237 | Bacteria | 14687 |
| 159 | Ga0097621_100006784 | 3300006237 | Bacteria | 8136 |
| 160 | Ga0097621_100012717 | 3300006237 | Bacteria | 6252 |
| 161 | Ga0097621_100071759 | 3300006237 | Bacteria | 2862 |
| 162 | Ga0097621_100121962 | 3300006237 | Bacteria | 2211 |
| 163 | Ga0068871_100000297 | 3300006358 | Bacteria | 34596 |
| 164 | Ga0068871_100002111 | 3300006358 | Bacteria | 13456 |
| 165 | Ga0068871_100003523 | 3300006358 | Bacteria | 10773 |
| 166 | Ga0068871_100005274 | 3300006358 | Bacteria | 9048 |
| 167 | Ga0068871_100047471 | 3300006358 | Bacteria | 3463 |
| 168 | Ga0075428_100000083 | 3300006844 | Bacteria | 78689 |
| 169 | Ga0075428_100002437 | 3300006844 | Bacteria | 20209 |
| 170 | Ga0075428_100174036 | 3300006844 | Bacteria | 2332 |
| 171 | Ga0075430_100087096 | 3300006846 | Bacteria | 2614 |
| 172 | Ga0075433_10094711 | 3300006852 | Bacteria | 2643 |
| 173 | Ga0075434_100022878 | 3300006871 | Bacteria | 6084 |
| 174 | Ga0075434_100046636 | 3300006871 | Bacteria | 4301 |
| 175 | Ga0075434_100182534 | 3300006871 | Bacteria | 2119 |
| 176 | Ga0075429_100000480 | 3300006880 | Bacteria | 29845 |
| 177 | Ga0075429_100014547 | 3300006880 | Bacteria | 6819 |
| 178 | Ga0075429_100194254 | 3300006880 | Bacteria | 1778 |
| 179 | Ga0068865_100000059 | 3300006881 | Bacteria | 58856 |
| 180 | Ga0068865_100029476 | 3300006881 | Bacteria | 3642 |
| 181 | Ga0068865_100168293 | 3300006881 | Bacteria | 1678 |
| 182 | Ga0097620_100000149 | 3300006931 | Bacteria | 66296 |
| 183 | Ga0097620_100010619 | 3300006931 | Bacteria | 9266 |
| 184 | Ga0097620_100085814 | 3300006931 | Bacteria | 3193 |
| 185 | Ga0097620_100149681 | 3300006931 | Bacteria | 2410 |
| 186 | Ga0097620_100588132 | 3300006931 | Bacteria | 1206 |
| 187 | Ga0075435_100213877 | 3300007076 | Bacteria | 1636 |
| 188 | Ga0099794_10022580 | 3300007265 | Bacteria | 2870 |
| 189 | Ga0099794_10094931 | 3300007265 | Bacteria | 1483 |
| 190 | Ga0105240_10072714 | 3300009093 | Bacteria | 4249 |
| 191 | Ga0105240_10101898 | 3300009093 | Bacteria | 3490 |
| 192 | Ga0111539_10008973 | 3300009094 | Bacteria | 12659 |
| 193 | Ga0111539_10115230 | 3300009094 | Bacteria | 3152 |
| 194 | Ga0111539_10323621 | 3300009094 | Bacteria | 1794 |
| 195 | Ga0111539_10726972 | 3300009094 | Bacteria | 1156 |
| 196 | Ga0111539_10779714 | 3300009094 | Bacteria | 1113 |
| 197 | Ga0105245_10000075 | 3300009098 | Bacteria | 103550 |
| 198 | Ga0105245_10105546 | 3300009098 | Bacteria | 2613 |
| 199 | Ga0105247_10042082 | 3300009101 | Bacteria | 2796 |
| 200 | Ga0114129_10000210 | 3300009147 | Bacteria | 65476 |
| 201 | Ga0105243_10000622 | 3300009148 | Bacteria | 35310 |
| 202 | Ga0105243_10026709 | 3300009148 | Bacteria | 4421 |
| 203 | Ga0105243_10152337 | 3300009148 | Bacteria | 1985 |
| 204 | Ga0105242_10000407 | 3300009176 | Bacteria | 34281 |
| 205 | Ga0105242_10036748 | 3300009176 | Bacteria | 3931 |
| 206 | Ga0105242_10132658 | 3300009176 | Bacteria | 2152 |
| 207 | Ga0105248_10006699 | 3300009177 | Bacteria | 12636 |
| 208 | Ga0105248_10008148 | 3300009177 | Bacteria | 11507 |
| 209 | Ga0105248_10066361 | 3300009177 | Bacteria | 4052 |
| 210 | Ga0105248_10176223 | 3300009177 | Bacteria | 2409 |
| 211 | Ga0105248_10473760 | 3300009177 | Bacteria | 1411 |
| 212 | Ga0105237_10602050 | 3300009545 | Unclassified | 1106 |
| 213 | Ga0105237_10614202 | 3300009545 | Bacteria | 1094 |
| 214 | Ga0105238_10416490 | 3300009551 | Bacteria | 1338 |
| 215 | Ga0105238_10800333 | 3300009551 | Bacteria | 958 |
| 216 | Ga0105249_10003357 | 3300009553 | Bacteria | 13854 |
| 217 | Ga0105249_10268169 | 3300009553 | Bacteria | 1700 |
| 218 | Ga0105249_10390352 | 3300009553 | Bacteria | 1420 |
| 219 | Ga0105239_10084639 | 3300010375 | Bacteria | 3493 |
| 220 | Ga0105239_10107469 | 3300010375 | Bacteria | 3091 |
| 221 | Ga0105246_10032885 | 3300011119 | Bacteria | 3443 |
| 222 | Ga0105246_10241171 | 3300011119 | Bacteria | 1429 |
| 223 | Ga0157371_10036624 | 3300013102 | Bacteria | 3513 |
| 224 | Ga0157374_10000531 | 3300013296 | Bacteria | 34119 |
| 225 | Ga0157374_10003810 | 3300013296 | Bacteria | 12672 |
| 226 | Ga0157374_10025690 | 3300013296 | Bacteria | 5291 |
| 227 | Ga0157378_10000074 | 3300013297 | Bacteria | 90608 |
| 228 | Ga0157378_10003226 | 3300013297 | Bacteria | 14510 |
| 229 | Ga0157378_10205661 | 3300013297 | Bacteria | 1864 |
| 230 | Ga0163162_10004676 | 3300013306 | Bacteria | 13203 |
| 231 | Ga0163162_10134972 | 3300013306 | Bacteria | 2578 |
| 232 | Ga0163162_10170734 | 3300013306 | Bacteria | 2299 |
| 233 | Ga0163162_10221884 | 3300013306 | Bacteria | 2020 |
| 234 | Ga0163162_10253975 | 3300013306 | Bacteria | 1890 |
| 235 | Ga0163162_11133869 | 3300013306 | Bacteria | 886 |
| 236 | Ga0157375_10000588 | 3300013308 | Bacteria | 32287 |
| 237 | Ga0157375_10011760 | 3300013308 | Bacteria | 7740 |
| 238 | Ga0157375_10033046 | 3300013308 | Bacteria | 4912 |
| 239 | Ga0163163_10011506 | 3300014325 | Bacteria | 8032 |
| 240 | Ga0163163_10239305 | 3300014325 | Bacteria | 1865 |
| 241 | Ga0163163_10422388 | 3300014325 | Bacteria | 1392 |
| 242 | Ga0157380_10038870 | 3300014326 | Bacteria | 3697 |
| 243 | Ga0157380_10080050 | 3300014326 | Bacteria | 2670 |
| 244 | Ga0157380_10088922 | 3300014326 | Bacteria | 2543 |
| 245 | Ga0157380_10090070 | 3300014326 | Bacteria | 2529 |
| 246 | Ga0157380_10511036 | 3300014326 | Bacteria | 1169 |
| 247 | Ga0157377_10089447 | 3300014745 | Bacteria | 1815 |
| 248 | Ga0157379_10007628 | 3300014968 | Bacteria | 9363 |
| 249 | Ga0157379_10060827 | 3300014968 | Bacteria | 3377 |
| 250 | Ga0157379_10066249 | 3300014968 | Bacteria | 3228 |
| 251 | Ga0157376_10008732 | 3300014969 | Bacteria | 7324 |
| 252 | Ga0157376_10026605 | 3300014969 | Bacteria | 4574 |
| 253 | Ga0157376_10028599 | 3300014969 | Bacteria | 4432 |
| 254 | Ga0157376_10035724 | 3300014969 | Bacteria | 4021 |
| 255 | Ga0157376_10050765 | 3300014969 | Bacteria | 3443 |
| 256 | Ga0163161_10408255 | 3300017792 | Bacteria | 1090 |
| 257 | Ga0209258_103740 | 3300025242 | Bacteria | 3150 |
| 258 | Ga0209455_1001023 | 3300025272 | Bacteria | 13979 |
| 259 | Ga0209676_1002357 | 3300025292 | Bacteria | 13636 |
| 260 | Ga0209025_1000071 | 3300025294 | Bacteria | 287297 |
| 261 | Ga0209050_1005110 | 3300025298 | Bacteria | 8449 |
| 262 | Ga0209051_1019092 | 3300025303 | Bacteria | 3006 |
| 263 | Ga0207656_10000672 | 3300025321 | Bacteria | 11208 |
| 264 | Ga0207653_10034424 | 3300025885 | Bacteria | 1645 |
| 265 | Ga0207682_10006178 | 3300025893 | Bacteria | 4839 |
| 266 | Ga0207642_10001278 | 3300025899 | Bacteria | 7783 |
| 267 | Ga0207642_10029270 | 3300025899 | Bacteria | 2279 |
| 268 | Ga0207642_10075211 | 3300025899 | Bacteria | 1621 |
| 269 | Ga0207688_10009150 | 3300025901 | Bacteria | 5393 |
| 270 | Ga0207688_10064130 | 3300025901 | Bacteria | 2073 |
| 271 | Ga0207688_10272587 | 3300025901 | Bacteria | 1030 |
| 272 | Ga0207647_10032757 | 3300025904 | Bacteria | 3334 |
| 273 | Ga0207645_10006565 | 3300025907 | Bacteria | 8322 |
| 274 | Ga0207645_10124019 | 3300025907 | Bacteria | 1678 |
| 275 | Ga0207643_10003687 | 3300025908 | Bacteria | 8246 |
| 276 | Ga0207643_10013580 | 3300025908 | Bacteria | 4413 |
| 277 | Ga0207705_10196637 | 3300025909 | Bacteria | 1527 |
| 278 | Ga0207684_10277844 | 3300025910 | Bacteria | 1444 |
| 279 | Ga0207707_10088722 | 3300025912 | Bacteria | 2702 |
| 280 | Ga0207660_10021706 | 3300025917 | Bacteria | 4320 |
| 281 | Ga0207660_10295093 | 3300025917 | Bacteria | 1290 |
| 282 | Ga0207662_10000166 | 3300025918 | Bacteria | 31376 |
| 283 | Ga0207662_10007962 | 3300025918 | Bacteria | 5775 |
| 284 | Ga0207662_10014684 | 3300025918 | Bacteria | 4397 |
| 285 | Ga0207662_10029653 | 3300025918 | Bacteria | 3171 |
| 286 | Ga0207649_10002695 | 3300025920 | Bacteria | 9841 |
| 287 | Ga0207652_10017190 | 3300025921 | Bacteria | 5917 |
| 288 | Ga0207652_10687349 | 3300025921 | Bacteria | 913 |
| 289 | Ga0207646_10538434 | 3300025922 | Bacteria | 1050 |
| 290 | Ga0207681_10038509 | 3300025923 | Bacteria | 3168 |
| 291 | Ga0207681_10415591 | 3300025923 | Bacteria | 1089 |
| 292 | Ga0207650_10000698 | 3300025925 | Bacteria | 26244 |
| 293 | Ga0207650_10001764 | 3300025925 | Bacteria | 15299 |
| 294 | Ga0207659_10001270 | 3300025926 | Bacteria | 15120 |
| 295 | Ga0207659_10008733 | 3300025926 | Bacteria | 6308 |
| 296 | Ga0207659_10021915 | 3300025926 | Bacteria | 4249 |
| 297 | Ga0207659_10051869 | 3300025926 | Bacteria | 2920 |
| 298 | Ga0207687_10015669 | 3300025927 | Bacteria | 4974 |
| 299 | Ga0207644_10005694 | 3300025931 | Bacteria | 8111 |
| 300 | Ga0207644_10012832 | 3300025931 | Bacteria | 5572 |
| 301 | Ga0207706_10105610 | 3300025933 | Bacteria | 2478 |
| 302 | Ga0207706_10407579 | 3300025933 | Bacteria | 1178 |
| 303 | Ga0207686_10000243 | 3300025934 | Bacteria | 41698 |
| 304 | Ga0207709_10000973 | 3300025935 | Bacteria | 21397 |
| 305 | Ga0207709_10033312 | 3300025935 | Bacteria | 3024 |
| 306 | Ga0207709_10199448 | 3300025935 | Bacteria | 1428 |
| 307 | Ga0207670_10015654 | 3300025936 | Bacteria | 4537 |
| 308 | Ga0207670_10598490 | 3300025936 | Bacteria | 905 |
| 309 | Ga0207704_10000178 | 3300025938 | Bacteria | 33463 |
| 310 | Ga0207704_10076520 | 3300025938 | Bacteria | 2144 |
| 311 | Ga0207691_10000530 | 3300025940 | Bacteria | 38079 |
| 312 | Ga0207691_10092970 | 3300025940 | Bacteria | 2701 |
| 313 | Ga0207691_10438578 | 3300025940 | Bacteria | 1112 |
| 314 | Ga0207711_10125360 | 3300025941 | Bacteria | 2297 |
| 315 | Ga0207711_10190983 | 3300025941 | Bacteria | 1866 |
| 316 | Ga0207689_10000007 | 3300025942 | Bacteria | 132362 |
| 317 | Ga0207689_10088089 | 3300025942 | Bacteria | 2550 |
| 318 | Ga0207689_10107065 | 3300025942 | Bacteria | 2298 |
| 319 | Ga0207661_10000573 | 3300025944 | Bacteria | 23479 |
| 320 | Ga0207661_10021729 | 3300025944 | Bacteria | 4814 |
| 321 | Ga0207679_10001715 | 3300025945 | Bacteria | 13650 |
| 322 | Ga0207667_10013413 | 3300025949 | Bacteria | 9376 |
| 323 | Ga0207667_10465963 | 3300025949 | Bacteria | 1283 |
| 324 | Ga0207651_10000663 | 3300025960 | Bacteria | 14679 |
| 325 | Ga0207651_10005256 | 3300025960 | Bacteria | 6624 |
| 326 | Ga0207651_10140337 | 3300025960 | Bacteria | 1865 |
| 327 | Ga0207712_10013182 | 3300025961 | Bacteria | 5298 |
| 328 | Ga0207712_10054677 | 3300025961 | Bacteria | 2805 |
| 329 | Ga0207668_10057789 | 3300025972 | Bacteria | 2708 |
| 330 | Ga0207640_10005581 | 3300025981 | Bacteria | 6861 |
| 331 | Ga0207640_10008002 | 3300025981 | Bacteria | 5841 |
| 332 | Ga0207658_10045176 | 3300025986 | Bacteria | 3210 |
| 333 | Ga0207677_10000490 | 3300026023 | Bacteria | 25685 |
| 334 | Ga0207677_10001848 | 3300026023 | Bacteria | 11189 |
| 335 | Ga0207677_10022086 | 3300026023 | Bacteria | 3903 |
| 336 | Ga0207677_10050506 | 3300026023 | Bacteria | 2814 |
| 337 | Ga0207677_10491754 | 3300026023 | Bacteria | 1059 |
| 338 | Ga0207703_10008995 | 3300026035 | Bacteria | 7865 |
| 339 | Ga0207703_10038665 | 3300026035 | Bacteria | 3810 |
| 340 | Ga0207703_10045101 | 3300026035 | Bacteria | 3545 |
| 341 | Ga0207639_10312364 | 3300026041 | Bacteria | 1393 |
| 342 | Ga0207708_10000086 | 3300026075 | Bacteria | 73314 |
| 343 | Ga0207708_10012002 | 3300026075 | Bacteria | 6455 |
| 344 | Ga0207708_10355902 | 3300026075 | Bacteria | 1202 |
| 345 | Ga0207708_10463427 | 3300026075 | Bacteria | 1057 |
| 346 | Ga0207702_10588047 | 3300026078 | Bacteria | 1091 |
| 347 | Ga0207641_10008259 | 3300026088 | Bacteria | 8602 |
| 348 | Ga0207641_10043817 | 3300026088 | Bacteria | 3760 |
| 349 | Ga0207641_10127849 | 3300026088 | Bacteria | 2277 |
| 350 | Ga0207648_10000079 | 3300026089 | Bacteria | 92044 |
| 351 | Ga0207648_10012160 | 3300026089 | Bacteria | 8064 |
| 352 | Ga0207648_10031374 | 3300026089 | Bacteria | 4698 |
| 353 | Ga0207648_10048748 | 3300026089 | Bacteria | 3708 |
| 354 | Ga0207676_10010028 | 3300026095 | Bacteria | 6740 |
| 355 | Ga0207676_10018547 | 3300026095 | Bacteria | 5060 |
| 356 | Ga0207676_10053184 | 3300026095 | Bacteria | 3169 |
| 357 | Ga0207676_10204427 | 3300026095 | Bacteria | 1747 |
| 358 | Ga0207674_10021761 | 3300026116 | Bacteria | 6900 |
| 359 | Ga0207675_100000093 | 3300026118 | Bacteria | 70343 |
| 360 | Ga0207675_100020819 | 3300026118 | Bacteria | 6114 |
| 361 | Ga0207675_100166159 | 3300026118 | Bacteria | 2107 |
| 362 | Ga0207683_10001233 | 3300026121 | Bacteria | 23243 |
| 363 | Ga0207683_10014248 | 3300026121 | Bacteria | 6773 |
| 364 | Ga0207683_10449664 | 3300026121 | Bacteria | 1188 |
| 365 | Ga0207698_10012522 | 3300026142 | Bacteria | 5556 |
| 366 | Ga0207698_10138865 | 3300026142 | Bacteria | 2090 |
| 367 | Ga0207698_10245733 | 3300026142 | Bacteria | 1634 |
| 368 | Ga0209967_1003844 | 3300027364 | Bacteria | 1983 |
| 369 | Ga0210000_1000334 | 3300027462 | Bacteria | 6726 |
| 370 | Ga0209995_1000887 | 3300027471 | Bacteria | 4641 |
| 371 | Ga0209999_1002514 | 3300027543 | Bacteria | 3239 |
| 372 | Ga0209982_1006211 | 3300027552 | Bacteria | 1735 |
| 373 | Ga0209983_1012545 | 3300027665 | Bacteria | 1740 |
| 374 | Ga0209971_1006270 | 3300027682 | Bacteria | 2814 |
| 375 | Ga0209974_10004797 | 3300027876 | Bacteria | 4796 |
| 376 | Ga0207428_10000321 | 3300027907 | Bacteria | 62664 |
| 377 | Ga0207428_10016169 | 3300027907 | Bacteria | 6426 |
| 378 | Ga0268266_10072600 | 3300028379 | Bacteria | 2985 |
| 379 | Ga0268266_10151448 | 3300028379 | Bacteria | 2091 |
| 380 | Ga0268265_10001027 | 3300028380 | Bacteria | 25172 |
| 381 | Ga0268264_10001253 | 3300028381 | Bacteria | 24204 |
| 382 | Ga0268264_10051230 | 3300028381 | Bacteria | 3439 |
| 383 | Ga0268264_10422048 | 3300028381 | Bacteria | 1286 |
| 384 | Ga0268264_10498651 | 3300028381 | Bacteria | 1187 |
| 385 | Ga0265319_1008703 | 3300028563 | Bacteria | 4413 |
| 386 | Ga0265334_10000216 | 3300028573 | Bacteria | 33128 |
| 387 | Ga0265334_10001247 | 3300028573 | Bacteria | 12415 |
| 388 | Ga0265318_10001810 | 3300028577 | Bacteria | 12136 |
| 389 | Ga0265318_10063277 | 3300028577 | Bacteria | 1377 |
| 390 | Ga0265338_10072217 | 3300028800 | Bacteria | 2947 |
| 391 | Ga0265330_10005661 | 3300031235 | Bacteria | 6213 |
| 392 | Ga0265330_10011234 | 3300031235 | Bacteria | 4204 |
| 393 | Ga0265332_10000286 | 3300031238 | Bacteria | 39704 |
| 394 | Ga0265332_10002814 | 3300031238 | Bacteria | 8644 |
| 395 | Ga0265332_10003080 | 3300031238 | Bacteria | 8138 |
| 396 | Ga0265328_10002318 | 3300031239 | Bacteria | 8579 |
| 397 | Ga0265328_10008403 | 3300031239 | Bacteria | 4259 |
| 398 | Ga0265320_10012333 | 3300031240 | Bacteria | 4983 |
| 399 | Ga0265320_10020396 | 3300031240 | Bacteria | 3595 |
| 400 | Ga0265325_10005394 | 3300031241 | Bacteria | 7900 |
| 401 | Ga0265329_10010166 | 3300031242 | Bacteria | 3471 |
| 402 | Ga0265329_10026312 | 3300031242 | Bacteria | 1917 |
| 403 | Ga0265340_10044851 | 3300031247 | Bacteria | 2162 |
| 404 | Ga0265340_10137567 | 3300031247 | Bacteria | 1118 |
| 405 | Ga0265339_10014987 | 3300031249 | Bacteria | 4660 |
| 406 | Ga0265331_10000989 | 3300031250 | Bacteria | 22372 |
| 407 | Ga0265331_10003147 | 3300031250 | Bacteria | 10771 |
| 408 | Ga0265316_10056027 | 3300031344 | Bacteria | 3081 |
| 409 | Ga0265316_10057269 | 3300031344 | Bacteria | 3039 |
| 410 | Ga0265313_10000653 | 3300031595 | Bacteria | 35705 |
| 411 | Ga0316575_10008199 | 3300031665 | Bacteria | 3800 |
| 412 | Ga0265314_10013166 | 3300031711 | Bacteria | 6699 |
| 413 | Ga0265314_10014501 | 3300031711 | Bacteria | 6298 |
| 414 | Ga0265314_10091322 | 3300031711 | Bacteria | 1982 |
| 415 | Ga0265342_10013789 | 3300031712 | Bacteria | 5397 |
| 416 | Ga0316576_10048268 | 3300031727 | Bacteria | 3087 |
| 417 | Ga0316578_10006348 | 3300031728 | Bacteria | 5826 |
| 418 | Ga0316578_10089610 | 3300031728 | Bacteria | 1836 |
| 419 | Ga0307405_10569928 | 3300031731 | Bacteria | 919 |
| 420 | Ga0307407_10258208 | 3300031903 | Bacteria | 1197 |
| 421 | Ga0307412_10019973 | 3300031911 | Bacteria | 4069 |
| 422 | Ga0307411_10242315 | 3300032005 | Bacteria | 1412 |
| 423 | Ga0316580_10020278 | 3300032139 | Bacteria | 2047 |
| 424 | Ga0373930_0032229 | 3300034816 | Bacteria | 1084 |
| 425 | Ga0373948_0025674 | 3300034817 | Bacteria | 1157 |
| 426 | Ga0373958_0009443 | 3300034819 | Bacteria | 1606 |
| 427 | Ga0373958_0029303 | 3300034819 | Bacteria | 1070 |
| 428 | Ga0373938_0006799 | 3300034957 | Bacteria | 1990 |
| 429 | Ga0373926_0007307 | 3300035083 | Bacteria | 3680 |
| 430 | Ga0373928_0001979 | 3300035084 | Bacteria | 3991 |
| 431 | Ga0373929_0029612 | 3300035085 | Bacteria | 1163 |
| 432 | Ga0373929_0047254 | 3300035085 | Bacteria | 975 |
| 433 | Ga0373934_0033256 | 3300035086 | Bacteria | 2024 |
| 434 | Ga0373940_0090834 | 3300035088 | Bacteria | 914 |
| 435 | Ga0373949_0007755 | 3300035090 | Bacteria | 2352 |
| 436 | Ga0373932_0010079 | 3300035112 | Bacteria | 2281 |
| 437 | Ga0373939_0006610 | 3300035114 | Bacteria | 2798 |
| 438 | Ga0373939_0057892 | 3300035114 | Bacteria | 1224 |
| 439 | Ga0373941_0041439 | 3300035115 | Bacteria | 1425 |
| 440 | Ga0373953_0026472 | 3300035117 | Bacteria | 2222 |
| 441 | Ga0373954_0000002 | 3300035118 | Bacteria | 147478 |
| 442 | Ga0373960_0011728 | 3300035121 | Bacteria | 2164 |
| 443 | Ga0373943_0007447 | 3300035170 | Bacteria | 4918 |
| 444 | Ga0373946_0003571 | 3300035171 | Bacteria | 5518 |
| 445 | Ga0373942_0031109 | 3300035207 | Bacteria | 1409 |
| 446 | Ga0373962_0108704 | 3300035242 | Bacteria | 872 |
| 447 | Ga0316574_0006602 | 3300035398 | Bacteria | 6284 |
| 448 | Ga0316574_0012451 | 3300035398 | Bacteria | 4866 |
| 449 | Ga0373931_0000134 | 3300035691 | Bacteria | 33430 |
| 450 | Ga0373931_0008755 | 3300035691 | Bacteria | 4816 |
| 451 | Ga0373935_0004026 | 3300035692 | Bacteria | 8590 |
| 452 | Ga0373935_0185238 | 3300035692 | Bacteria | 1431 |
| 453 | Ga0373927_0009261 | 3300035695 | Bacteria | 6604 |
| 454 | Ga0373927_0442782 | 3300035695 | Unclassified | 858 |
| 455 | Ga0373933_0012205 | 3300035724 | Bacteria | 4746 |
| 456 | Ga0373937_0000646 | 3300036401 | Bacteria | 30603 |
| 457 | Ga0373937_0044086 | 3300036401 | Bacteria | 4074 |
| 458 | Ga0395900_0164690 | 3300037418 | Bacteria | 2260 |
| 459 | Ga0395905_0015084 | 3300037471 | Bacteria | 7356 |
| 460 | Ga0395901_0036213 | 3300038443 | Bacteria | 5099 |
| 461 | Ga0400484_36649 | 3300038725 | Bacteria | 28505 |
| 462 | Ga0400484_40677 | 3300038725 | Bacteria | 12695 |
| 463 | Ga0400490_00477 | 3300038726 | Bacteria | 3106 |
| 464 | Ga0400490_19580 | 3300038726 | Bacteria | 58285 |
| 465 | Ga0400490_24481 | 3300038726 | Bacteria | 28264 |
| 466 | Ga0400490_31277 | 3300038726 | Bacteria | 27517 |
| 467 | Ga0400490_40125 | 3300038726 | Bacteria | 3496 |
| 468 | Ga0400490_46324 | 3300038726 | Bacteria | 17823 |
| 469 | Ga0400485_21786 | 3300038735 | Bacteria | 5981 |
| 470 | Ga0400488_01398 | 3300038741 | Bacteria | 1368 |
| 471 | Ga0400488_49896 | 3300038741 | Bacteria | 4219 |
| 472 | Ga0400488_55744 | 3300038741 | Bacteria | 7427 |
| 473 | Ga0400488_61752 | 3300038741 | Bacteria | 1871 |
| 474 | Ga0400486_05222 | 3300038742 | Bacteria | 13089 |
| 475 | Ga0400486_18420 | 3300038742 | Bacteria | 1307 |
| 476 | Ga0400486_22694 | 3300038742 | Bacteria | 9443 |
| 477 | Ga0400486_32535 | 3300038742 | Bacteria | 6328 |
| 478 | Ga0400483_015147 | 3300039062 | Bacteria | 11373 |
| 479 | Ga0400483_098551 | 3300039062 | Bacteria | 3037 |
| 480 | Ga0400483_111606 | 3300039062 | Bacteria | 12518 |
| 481 | Ga0400483_134774 | 3300039062 | Bacteria | 3389 |
| 482 | Ga0400483_188322 | 3300039062 | Bacteria | 1492 |
| 483 | Ga0400483_285866 | 3300039062 | Bacteria | 9605 |
| 484 | Ga0400483_287441 | 3300039062 | Bacteria | 31618 |
| 485 | Ga0400489_48784 | 3300039093 | Bacteria | 41831 |
| 486 | Ga0400489_82601 | 3300039093 | Unclassified | 2011 |
| 487 | Ga0400487_02813 | 3300039110 | Bacteria | 3506 |
| 488 | Ga0400487_35338 | 3300039110 | Bacteria | 3871 |
| 489 | Ga0400487_51851 | 3300039110 | Bacteria | 1374 |
| 490 | Ga0451853_1179271 | 3300041512 | Bacteria | 1718 |
| 491 | Ga0439441_005807 | 3300042001 | Bacteria | 1932 |
| 492 | Ga0439443_000903 | 3300042003 | Bacteria | 3006 |
| 493 | Ga0439435_0001413 | 3300042436 | Bacteria | 4425 |
| 494 | Ga0439444_0000450 | 3300042437 | Bacteria | 4594 |
| 495 | Ga0439460_0000389 | 3300042461 | Bacteria | 9321 |
| 496 | Ga0451577_0000264 | 3300042876 | Bacteria | 103723 |
| 497 | Ga0451577_0039896 | 3300042876 | Bacteria | 4217 |
| 498 | Ga0451577_0159958 | 3300042876 | Bacteria | 2028 |
| 499 | Ga0451577_0452916 | 3300042876 | Bacteria | 1165 |
| 500 | Ga0453683_0000047 | 3300044673 | Bacteria | 207763 |
| 501 | Ga0466966_0027860 | 3300044684 | Bacteria | 3683 |
| 502 | Ga0453684_0000302 | 3300044712 | Bacteria | 207763 |
| 503 | Ga0453684_0006132 | 3300044712 | Bacteria | 23146 |
| 504 | Ga0453684_0010323 | 3300044712 | Bacteria | 15988 |
| 505 | Ga0453684_0020628 | 3300044712 | Bacteria | 9919 |
| 506 | Ga0451576_0000096 | 3300045051 | Bacteria | 221078 |
| 507 | Ga0451576_0000116 | 3300045051 | Bacteria | 207763 |
| 508 | Ga0451576_0001306 | 3300045051 | Bacteria | 43171 |
| 509 | Ga0451576_0011196 | 3300045051 | Bacteria | 10219 |
| 510 | Ga0451576_0125818 | 3300045051 | Bacteria | 2670 |
| 511 | Ga0495603_0005065 | 3300046455 | Bacteria | 7874 |
| 512 | Ga0495580_0001418 | 3300046472 | Bacteria | 21063 |
| 513 | Ga0495580_0290394 | 3300046472 | Bacteria | 1115 |
| 514 | Ga0495582_0046311 | 3300046473 | Bacteria | 2395 |
| 515 | Ga0495639_0003830 | 3300046475 | Bacteria | 6459 |
| 516 | Ga0495607_0000050 | 3300046501 | Bacteria | 120052 |
| 517 | Ga0495666_0016625 | 3300046526 | Bacteria | 3664 |
| 518 | Ga0495665_0219421 | 3300046531 | Bacteria | 983 |
| 519 | Ga0495586_0004075 | 3300046535 | Bacteria | 7831 |
| 520 | Ga0495588_0046550 | 3300046674 | Bacteria | 2225 |
| 521 | Ga0495658_0009927 | 3300046683 | Bacteria | 4750 |
| 522 | Ga0495658_0191690 | 3300046683 | Bacteria | 1271 |
| 523 | Ga0495669_0031846 | 3300046684 | Bacteria | 2316 |
| 524 | Ga0495680_0112473 | 3300047322 | Bacteria | 2017 |
| 525 | Ga0496101_0241706 | 3300048904 | Bacteria | 1405 |
| 526 | Ga0496104_0097099 | 3300048907 | Bacteria | 2820 |
| 527 | Ga0496105_0191914 | 3300048908 | Bacteria | 1670 |
| 528 | Ga0496108_0001128 | 3300048911 | Bacteria | 20893 |
| 529 | Ga0496108_0333104 | 3300048911 | Bacteria | 1324 |
| 530 | Ga0496109_0010127 | 3300048912 | Bacteria | 8044 |
| 531 | Ga0496110_0001483 | 3300048913 | Bacteria | 17008 |
| 532 | Ga0496112_0082105 | 3300048915 | Bacteria | 3188 |
| 533 | Ga0496114_0086267 | 3300048917 | Bacteria | 2660 |
| 534 | Ga0496116_0062957 | 3300048919 | Bacteria | 2392 |
| 535 | Ga0496117_0054133 | 3300048920 | Bacteria | 2813 |
| 536 | Ga0496118_0055775 | 3300048921 | Bacteria | 2977 |
| 537 | Ga0496118_0084706 | 3300048921 | Bacteria | 2210 |
| 538 | Ga0496119_0078705 | 3300048922 | Bacteria | 1906 |
| 539 | Ga0496119_0118119 | 3300048922 | Bacteria | 1461 |
| 540 | Ga0496120_0004722 | 3300048923 | Bacteria | 11219 |
| 541 | Ga0496121_0002222 | 3300048924 | Bacteria | 30310 |
| 542 | Ga0496121_0028177 | 3300048924 | Bacteria | 5235 |
| 543 | Ga0496121_0114102 | 3300048924 | Bacteria | 2054 |
| 544 | Ga0496122_0001897 | 3300048925 | Bacteria | 31637 |
| 545 | Ga0496123_0016201 | 3300048926 | Bacteria | 6068 |
| 546 | Ga0496124_0000088 | 3300048927 | Bacteria | 194644 |
| 547 | Ga0496125_0000096 | 3300048928 | Bacteria | 205618 |
| 548 | Ga0501298_006808 | 3300049521 | Bacteria | 1881 |
| 549 | Ga0501032_0001373 | 3300049569 | Bacteria | 19318 |
| 550 | Ga0501033_0012697 | 3300049570 | Bacteria | 6423 |
| 551 | Ga0501034_0000641 | 3300049571 | Bacteria | 54300 |
| 552 | Ga0501034_0020598 | 3300049571 | Bacteria | 6735 |
| 553 | Ga0501034_0119887 | 3300049571 | Bacteria | 2617 |
| 554 | Ga0501036_0049516 | 3300049572 | Bacteria | 3557 |
| 555 | Ga0501037_0000474 | 3300049573 | Bacteria | 32555 |
| 556 | Ga0501038_0008209 | 3300049574 | Bacteria | 9604 |
| 557 | Ga0501038_0188827 | 3300049574 | Bacteria | 1659 |
| 558 | Ga0501039_0013197 | 3300049575 | Bacteria | 6314 |
| 559 | Ga0501039_0025347 | 3300049575 | Bacteria | 4555 |
| 560 | Ga0501040_0003365 | 3300049576 | Bacteria | 10322 |
| 561 | Ga0501040_0010917 | 3300049576 | Bacteria | 5940 |
| 562 | Ga0501040_0055784 | 3300049576 | Bacteria | 2710 |
| 563 | Ga0501041_0021683 | 3300049577 | Bacteria | 3847 |
| 564 | Ga0501042_0012886 | 3300049578 | Bacteria | 5678 |
| 565 | Ga0501043_0014893 | 3300049579 | Bacteria | 6087 |
| 566 | Ga0501043_0102854 | 3300049579 | Bacteria | 2245 |
| 567 | Ga0501046_0012703 | 3300049580 | Bacteria | 7161 |
| 568 | Ga0501047_0010044 | 3300049581 | Bacteria | 8946 |
| 569 | Ga0501048_0042413 | 3300049582 | Bacteria | 3258 |
| 570 | Ga0501048_0063677 | 3300049582 | Bacteria | 2607 |
| 571 | Ga0501067_0187117 | 3300049583 | Bacteria | 1153 |
| 572 | Ga0501068_0000140 | 3300049584 | Bacteria | 33214 |
| 573 | Ga0501068_0002905 | 3300049584 | Bacteria | 9121 |
| 574 | Ga0501072_0005894 | 3300049588 | Bacteria | 9335 |
| 575 | Ga0501072_0342115 | 3300049588 | Bacteria | 1188 |
| 576 | Ga0501073_0014507 | 3300049589 | Bacteria | 5726 |
| 577 | Ga0501075_0281701 | 3300049591 | Bacteria | 1267 |
| 578 | Ga0501257_066802 | 3300049686 | Bacteria | 914 |
| 579 | Ga0501079_0537908 | 3300049741 | Bacteria | 919 |
| 580 | Ga0501080_0149995 | 3300049742 | Bacteria | 2155 |
| 581 | Ga0501080_0291692 | 3300049742 | Bacteria | 1481 |
| 582 | Ga0501035_0015367 | 3300049822 | Bacteria | 7064 |
| 583 | Ga0501035_0029110 | 3300049822 | Bacteria | 5037 |
| 584 | Ga0501035_0450577 | 3300049822 | Bacteria | 1064 |
| 585 | Ga0501044_0000231 | 3300049823 | Bacteria | 70134 |
| 586 | Ga0501044_0009991 | 3300049823 | Bacteria | 10310 |
| 587 | Ga0501044_0023765 | 3300049823 | Bacteria | 6517 |
| 588 | Ga0501045_0003419 | 3300049824 | Bacteria | 10863 |
| 589 | nmdc:mga00v17_22766_c1 | 3300050491 | Bacteria | 3619 |
| 590 | nmdc:mga00v17_298749_c1 | 3300050491 | Bacteria | 1046 |
| 591 | nmdc:mga00v17_304151_c1 | 3300050491 | Bacteria | 1036 |
| 592 | nmdc:mga00v17_5593_c1 | 3300050491 | Bacteria | 6626 |
| 593 | nmdc:mga00v17_8189_c1 | 3300050491 | Bacteria | 5619 |
| 594 | nmdc:mga0k408_2784_c1 | 3300050493 | Bacteria | 9292 |
| 595 | nmdc:mga0k408_3933_c1 | 3300050493 | Bacteria | 7880 |
| 596 | nmdc:mga06z11_281558_c1 | 3300050494 | Bacteria | 985 |
| 597 | nmdc:mga05p37_132_c1 | 3300050507 | Bacteria | 68371 |
| 598 | nmdc:mga05p37_402813_c1 | 3300050507 | Bacteria | 1597 |
| 599 | nmdc:mga09592_187364_c1 | 3300050508 | Bacteria | 1791 |
| 600 | nmdc:mga09592_418_c1 | 3300050508 | Bacteria | 31192 |
| 601 | nmdc:mga0qj67_175257_c1 | 3300050509 | Bacteria | 1741 |
| 602 | nmdc:mga06r32_611121_c1 | 3300050510 | Bacteria | 1060 |
| 603 | nmdc:mga08y16_10406_c1 | 3300050511 | Bacteria | 9757 |
| 604 | nmdc:mga08y16_307573_c1 | 3300050511 | Bacteria | 1633 |
| 605 | nmdc:mga08y16_373598_c1 | 3300050511 | Bacteria | 1462 |
| 606 | nmdc:mga08y16_730976_c1 | 3300050511 | Bacteria | 987 |
| 607 | nmdc:mga0n895_21008_c1 | 3300050512 | Bacteria | 6099 |
| 608 | nmdc:mga0n895_46935_c1 | 3300050512 | Bacteria | 4222 |
| 609 | nmdc:mga08x19_55_c1 | 3300050514 | Bacteria | 120851 |
| 610 | nmdc:mga0a205_34161_c1 | 3300050515 | Bacteria | 4879 |
| 611 | nmdc:mga0a205_561358_c1 | 3300050515 | Bacteria | 996 |
| 612 | nmdc:mga0sz30_18417_c1 | 3300050516 | Bacteria | 2794 |
| 613 | Ga0466962_0069043 | 3300061719 | Bacteria | 1688 |
| 614 | Ga0530510_0041090 | 3300061734 | Bacteria | 3339 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035085 | Ga0373929_0047254 | Ga0373929_0047254_59_721 | 215 |
| 2 | 3300032139 | Ga0316580_10020278 | Ga0316580_100202782 | 253 |
| 3 | 3300031727 | Ga0316576_10048268 | Ga0316576_100482683 | 258 |
| 4 | iso_pu_bacteria | 2690315857 | 2691331528 | 259 |
| 5 | iso_pu_bacteria | 2919534386 | 2919535098 | 259 |
| 6 | 3300038726 | Ga0400490_00477 | Ga0400490_00477_1410_2249 | 260 |
| 7 | 3300031247 | Ga0265340_10137567 | Ga0265340_101375672 | 261 |
| 8 | 3300031711 | Ga0265314_10091322 | Ga0265314_100913223 | 261 |
| 9 | 3300038726 | Ga0400490_40125 | Ga0400490_40125_1478_2317 | 262 |
| 10 | 3300039062 | Ga0400483_098551 | Ga0400483_098551_1756_2595 | 262 |
| 11 | 3300039093 | Ga0400489_82601 | Ga0400489_82601_818_1657 | 262 |
| 12 | 3300005471 | Ga0070698_100078792 | Ga0070698_1000787922 | 263 |
| 13 | 3300006871 | Ga0075434_100022878 | Ga0075434_1000228783 | 263 |
| 14 | 3300050512 | nmdc:mga0n895_21008_c1 | nmdc:mga0n895_21008_c1_2730_3602 | 263 |
| 15 | 3300031903 | Ga0307407_10258208 | Ga0307407_102582081 | 264 |
| 16 | 3300041512 | Ga0451853_1179271 | Ga0451853_1179271_331_1155 | 264 |
| 17 | 3300049686 | Ga0501257_066802 | Ga0501257_066802_35_862 | 264 |
| 18 | 3300003203 | JGI25406J46586_10011860 | JGI25406J46586_100118605 | 265 |
| 19 | 3300005330 | Ga0070690_100074421 | Ga0070690_1000744213 | 265 |
| 20 | 3300005334 | Ga0068869_100449209 | Ga0068869_1004492092 | 265 |
| 21 | 3300005441 | Ga0070700_100121428 | Ga0070700_1001214282 | 265 |
| 22 | 3300005444 | Ga0070694_100078873 | Ga0070694_1000788732 | 265 |
| 23 | 3300005536 | Ga0070697_100043101 | Ga0070697_1000431014 | 265 |
| 24 | 3300005615 | Ga0070702_100162023 | Ga0070702_1001620231 | 265 |
| 25 | 3300005844 | Ga0068862_100028276 | Ga0068862_1000282763 | 265 |
| 26 | 3300005985 | Ga0081539_10004364 | Ga0081539_100043648 | 265 |
| 27 | 3300006846 | Ga0075430_100087096 | Ga0075430_1000870964 | 265 |
| 28 | 3300007076 | Ga0075435_100213877 | Ga0075435_1002138772 | 265 |
| 29 | 3300009094 | Ga0111539_10323621 | Ga0111539_103236212 | 265 |
| 30 | 3300014326 | Ga0157380_10080050 | Ga0157380_100800502 | 265 |
| 31 | 3300014745 | Ga0157377_10089447 | Ga0157377_100894472 | 265 |
| 32 | 3300025926 | Ga0207659_10051869 | Ga0207659_100518693 | 265 |
| 33 | 3300025936 | Ga0207670_10598490 | Ga0207670_105984901 | 265 |
| 34 | 3300025942 | Ga0207689_10088089 | Ga0207689_100880893 | 265 |
| 35 | 3300026075 | Ga0207708_10355902 | Ga0207708_103559022 | 265 |
| 36 | 3300031731 | Ga0307405_10569928 | Ga0307405_105699281 | 265 |
| 37 | 3300034817 | Ga0373948_0025674 | Ga0373948_0025674_81_890 | 265 |
| 38 | 3300034819 | Ga0373958_0029303 | Ga0373958_0029303_64_873 | 265 |
| 39 | 3300034957 | Ga0373938_0006799 | Ga0373938_0006799_286_1095 | 265 |
| 40 | 3300035084 | Ga0373928_0001979 | Ga0373928_0001979_949_1758 | 265 |
| 41 | 3300035085 | Ga0373929_0029612 | Ga0373929_0029612_53_862 | 265 |
| 42 | 3300035088 | Ga0373940_0090834 | Ga0373940_0090834_51_860 | 265 |
| 43 | 3300035090 | Ga0373949_0007755 | Ga0373949_0007755_416_1228 | 265 |
| 44 | 3300035112 | Ga0373932_0010079 | Ga0373932_0010079_450_1259 | 265 |
| 45 | 3300035114 | Ga0373939_0006610 | Ga0373939_0006610_1021_1830 | 265 |
| 46 | 3300035121 | Ga0373960_0011728 | Ga0373960_0011728_517_1326 | 265 |
| 47 | 3300035207 | Ga0373942_0031109 | Ga0373942_0031109_587_1396 | 265 |
| 48 | 3300035242 | Ga0373962_0108704 | Ga0373962_0108704_49_858 | 265 |
| 49 | 3300035691 | Ga0373931_0000134 | Ga0373931_0000134_29908_30717 | 265 |
| 50 | 3300038741 | Ga0400488_01398 | Ga0400488_01398_22_861 | 265 |
| 51 | 3300038741 | Ga0400488_61752 | Ga0400488_61752_670_1509 | 265 |
| 52 | 3300039062 | Ga0400483_188322 | Ga0400483_188322_126_965 | 265 |
| 53 | 3300042001 | Ga0439441_005807 | Ga0439441_005807_107_919 | 265 |
| 54 | 3300045051 | Ga0451576_0125818 | Ga0451576_0125818_457_1266 | 265 |
| 55 | 3300049521 | Ga0501298_006808 | Ga0501298_006808_485_1297 | 265 |
| 56 | 3300049575 | Ga0501039_0013197 | Ga0501039_0013197_3354_4166 | 265 |
| 57 | 3300049576 | Ga0501040_0010917 | Ga0501040_0010917_5081_5893 | 265 |
| 58 | 3300049577 | Ga0501041_0021683 | Ga0501041_0021683_1230_2042 | 265 |
| 59 | 3300049582 | Ga0501048_0042413 | Ga0501048_0042413_1921_2733 | 265 |
| 60 | 3300049588 | Ga0501072_0342115 | Ga0501072_0342115_52_864 | 265 |
| 61 | 3300049741 | Ga0501079_0537908 | Ga0501079_0537908_40_852 | 265 |
| 62 | 3300050507 | nmdc:mga05p37_402813_c1 | nmdc:mga05p37_402813_c1_83_892 | 265 |
| 63 | 3300050511 | nmdc:mga08y16_730976_c1 | nmdc:mga08y16_730976_c1_61_873 | 265 |
| 64 | 3300050514 | nmdc:mga08x19_55_c1 | nmdc:mga08x19_55_c1_61029_61841 | 265 |
| 65 | 3300050515 | nmdc:mga0a205_561358_c1 | nmdc:mga0a205_561358_c1_150_959 | 265 |
| 66 | 3300061734 | Ga0530510_0041090 | Ga0530510_0041090_2296_3108 | 265 |
| 67 | 3300002070 | JGI24750J21931_1007051 | JGI24750J21931_10070512 | 266 |
| 68 | 3300003763 | Ga0055529_1001538 | Ga0055529_10015388 | 266 |
| 69 | 3300005329 | Ga0070683_100097814 | Ga0070683_1000978142 | 266 |
| 70 | 3300005330 | Ga0070690_100000082 | Ga0070690_10000008236 | 266 |
| 71 | 3300005334 | Ga0068869_100000044 | Ga0068869_10000004431 | 266 |
| 72 | 3300005336 | Ga0070680_100034292 | Ga0070680_1000342924 | 266 |
| 73 | 3300005337 | Ga0070682_100007785 | Ga0070682_1000077852 | 266 |
| 74 | 3300005338 | Ga0068868_100000458 | Ga0068868_10000045828 | 266 |
| 75 | 3300005340 | Ga0070689_100007655 | Ga0070689_10000765510 | 266 |
| 76 | 3300005341 | Ga0070691_10000573 | Ga0070691_100005736 | 266 |
| 77 | 3300005343 | Ga0070687_100000034 | Ga0070687_10000003424 | 266 |
| 78 | 3300005343 | Ga0070687_100009500 | Ga0070687_1000095003 | 266 |
| 79 | 3300005345 | Ga0070692_10025480 | Ga0070692_100254802 | 266 |
| 80 | 3300005406 | Ga0070703_10004765 | Ga0070703_100047656 | 266 |
| 81 | 3300005438 | Ga0070701_10000346 | Ga0070701_1000034614 | 266 |
| 82 | 3300005440 | Ga0070705_100000030 | Ga0070705_10000003063 | 266 |
| 83 | 3300005441 | Ga0070700_100000552 | Ga0070700_1000005526 | 266 |
| 84 | 3300005444 | Ga0070694_100000706 | Ga0070694_10000070617 | 266 |
| 85 | 3300005458 | Ga0070681_10071328 | Ga0070681_100713283 | 266 |
| 86 | 3300005459 | Ga0068867_100000032 | Ga0068867_10000003234 | 266 |
| 87 | 3300005518 | Ga0070699_100111502 | Ga0070699_1001115024 | 266 |
| 88 | 3300005530 | Ga0070679_100003506 | Ga0070679_10000350611 | 266 |
| 89 | 3300005535 | Ga0070684_100075658 | Ga0070684_1000756583 | 266 |
| 90 | 3300005539 | Ga0068853_100012831 | Ga0068853_1000128313 | 266 |
| 91 | 3300005543 | Ga0070672_100459528 | Ga0070672_1004595282 | 266 |
| 92 | 3300005544 | Ga0070686_100001608 | Ga0070686_1000016084 | 266 |
| 93 | 3300005544 | Ga0070686_100005201 | Ga0070686_1000052013 | 266 |
| 94 | 3300005545 | Ga0070695_100000514 | Ga0070695_1000005145 | 266 |
| 95 | 3300005545 | Ga0070695_100039124 | Ga0070695_1000391244 | 266 |
| 96 | 3300005546 | Ga0070696_100000089 | Ga0070696_10000008914 | 266 |
| 97 | 3300005547 | Ga0070693_100000100 | Ga0070693_10000010010 | 266 |
| 98 | 3300005549 | Ga0070704_100001681 | Ga0070704_1000016816 | 266 |
| 99 | 3300005563 | Ga0068855_100000695 | Ga0068855_10000069535 | 266 |
| 100 | 3300005578 | Ga0068854_100055460 | Ga0068854_1000554602 | 266 |
| 101 | 3300005614 | Ga0068856_100062178 | Ga0068856_1000621786 | 266 |
| 102 | 3300005615 | Ga0070702_100000001 | Ga0070702_10000000156 | 266 |
| 103 | 3300005616 | Ga0068852_100123819 | Ga0068852_1001238192 | 266 |
| 104 | 3300005617 | Ga0068859_100000149 | Ga0068859_10000014961 | 266 |
| 105 | 3300005617 | Ga0068859_100588132 | Ga0068859_1005881322 | 266 |
| 106 | 3300005718 | Ga0068866_10000277 | Ga0068866_100002776 | 266 |
| 107 | 3300005719 | Ga0068861_100000057 | Ga0068861_10000005731 | 266 |
| 108 | 3300005841 | Ga0068863_100260396 | Ga0068863_1002603962 | 266 |
| 109 | 3300005842 | Ga0068858_100000289 | Ga0068858_10000028935 | 266 |
| 110 | 3300005843 | Ga0068860_100001090 | Ga0068860_10000109033 | 266 |
| 111 | 3300005844 | Ga0068862_100000409 | Ga0068862_1000004092 | 266 |
| 112 | 3300006237 | Ga0097621_100001810 | Ga0097621_1000018107 | 266 |
| 113 | 3300006237 | Ga0097621_100012717 | Ga0097621_1000127175 | 266 |
| 114 | 3300006358 | Ga0068871_100002111 | Ga0068871_10000211114 | 266 |
| 115 | 3300006358 | Ga0068871_100003523 | Ga0068871_10000352313 | 266 |
| 116 | 3300006844 | Ga0075428_100000083 | Ga0075428_10000008335 | 266 |
| 117 | 3300006871 | Ga0075434_100182534 | Ga0075434_1001825342 | 266 |
| 118 | 3300006880 | Ga0075429_100000480 | Ga0075429_10000048031 | 266 |
| 119 | 3300006881 | Ga0068865_100000059 | Ga0068865_10000005954 | 266 |
| 120 | 3300006931 | Ga0097620_100000149 | Ga0097620_10000014914 | 266 |
| 121 | 3300006931 | Ga0097620_100588132 | Ga0097620_1005881322 | 266 |
| 122 | 3300007265 | Ga0099794_10022580 | Ga0099794_100225802 | 266 |
| 123 | 3300007265 | Ga0099794_10094931 | Ga0099794_100949312 | 266 |
| 124 | 3300009094 | Ga0111539_10115230 | Ga0111539_101152304 | 266 |
| 125 | 3300009094 | Ga0111539_10779714 | Ga0111539_107797141 | 266 |
| 126 | 3300009098 | Ga0105245_10000075 | Ga0105245_1000007535 | 266 |
| 127 | 3300009147 | Ga0114129_10000210 | Ga0114129_1000021017 | 266 |
| 128 | 3300009148 | Ga0105243_10000622 | Ga0105243_100006226 | 266 |
| 129 | 3300009176 | Ga0105242_10000407 | Ga0105242_100004076 | 266 |
| 130 | 3300009177 | Ga0105248_10176223 | Ga0105248_101762234 | 266 |
| 131 | 3300009545 | Ga0105237_10602050 | Ga0105237_106020502 | 266 |
| 132 | 3300009545 | Ga0105237_10614202 | Ga0105237_106142021 | 266 |
| 133 | 3300009551 | Ga0105238_10800333 | Ga0105238_108003331 | 266 |
| 134 | 3300009553 | Ga0105249_10003357 | Ga0105249_100033574 | 266 |
| 135 | 3300010375 | Ga0105239_10084639 | Ga0105239_100846394 | 266 |
| 136 | 3300011119 | Ga0105246_10241171 | Ga0105246_102411711 | 266 |
| 137 | 3300013297 | Ga0157378_10000074 | Ga0157378_1000007460 | 266 |
| 138 | 3300013306 | Ga0163162_10221884 | Ga0163162_102218841 | 266 |
| 139 | 3300014326 | Ga0157380_10038870 | Ga0157380_100388702 | 266 |
| 140 | 3300014968 | Ga0157379_10060827 | Ga0157379_100608272 | 266 |
| 141 | 3300014969 | Ga0157376_10026605 | Ga0157376_100266054 | 266 |
| 142 | 3300014969 | Ga0157376_10035724 | Ga0157376_100357242 | 266 |
| 143 | 3300025242 | Ga0209258_103740 | Ga0209258_1037402 | 266 |
| 144 | 3300025272 | Ga0209455_1001023 | Ga0209455_10010237 | 266 |
| 145 | 3300025885 | Ga0207653_10034424 | Ga0207653_100344241 | 266 |
| 146 | 3300025899 | Ga0207642_10001278 | Ga0207642_100012789 | 266 |
| 147 | 3300025901 | Ga0207688_10064130 | Ga0207688_100641302 | 266 |
| 148 | 3300025904 | Ga0207647_10032757 | Ga0207647_100327574 | 266 |
| 149 | 3300025908 | Ga0207643_10003687 | Ga0207643_100036872 | 266 |
| 150 | 3300025912 | Ga0207707_10088722 | Ga0207707_100887222 | 266 |
| 151 | 3300025917 | Ga0207660_10021706 | Ga0207660_100217062 | 266 |
| 152 | 3300025918 | Ga0207662_10000166 | Ga0207662_1000016614 | 266 |
| 153 | 3300025918 | Ga0207662_10014684 | Ga0207662_100146843 | 266 |
| 154 | 3300025921 | Ga0207652_10017190 | Ga0207652_100171904 | 266 |
| 155 | 3300025927 | Ga0207687_10015669 | Ga0207687_100156693 | 266 |
| 156 | 3300025934 | Ga0207686_10000243 | Ga0207686_1000024344 | 266 |
| 157 | 3300025935 | Ga0207709_10000973 | Ga0207709_1000097314 | 266 |
| 158 | 3300025936 | Ga0207670_10015654 | Ga0207670_100156542 | 266 |
| 159 | 3300025938 | Ga0207704_10000178 | Ga0207704_1000017814 | 266 |
| 160 | 3300025940 | Ga0207691_10438578 | Ga0207691_104385781 | 266 |
| 161 | 3300025941 | Ga0207711_10125360 | Ga0207711_101253604 | 266 |
| 162 | 3300025942 | Ga0207689_10000007 | Ga0207689_10000007105 | 266 |
| 163 | 3300025944 | Ga0207661_10021729 | Ga0207661_100217293 | 266 |
| 164 | 3300025949 | Ga0207667_10013413 | Ga0207667_100134139 | 266 |
| 165 | 3300025961 | Ga0207712_10013182 | Ga0207712_100131826 | 266 |
| 166 | 3300025981 | Ga0207640_10005581 | Ga0207640_100055817 | 266 |
| 167 | 3300026023 | Ga0207677_10001848 | Ga0207677_1000184811 | 266 |
| 168 | 3300026035 | Ga0207703_10045101 | Ga0207703_100451014 | 266 |
| 169 | 3300026041 | Ga0207639_10312364 | Ga0207639_103123642 | 266 |
| 170 | 3300026075 | Ga0207708_10000086 | Ga0207708_1000008639 | 266 |
| 171 | 3300026089 | Ga0207648_10000079 | Ga0207648_1000007934 | 266 |
| 172 | 3300026118 | Ga0207675_100000093 | Ga0207675_10000009336 | 266 |
| 173 | 3300026142 | Ga0207698_10138865 | Ga0207698_101388652 | 266 |
| 174 | 3300027907 | Ga0207428_10000321 | Ga0207428_1000032137 | 266 |
| 175 | 3300028380 | Ga0268265_10001027 | Ga0268265_100010278 | 266 |
| 176 | 3300028381 | Ga0268264_10001253 | Ga0268264_1000125322 | 266 |
| 177 | 3300031665 | Ga0316575_10008199 | Ga0316575_100081996 | 266 |
| 178 | 3300032005 | Ga0307411_10242315 | Ga0307411_102423152 | 266 |
| 179 | 3300034816 | Ga0373930_0032229 | Ga0373930_0032229_81_893 | 266 |
| 180 | 3300034819 | Ga0373958_0009443 | Ga0373958_0009443_756_1568 | 266 |
| 181 | 3300035083 | Ga0373926_0007307 | Ga0373926_0007307_2749_3564 | 266 |
| 182 | 3300035114 | Ga0373939_0057892 | Ga0373939_0057892_305_1117 | 266 |
| 183 | 3300035115 | Ga0373941_0041439 | Ga0373941_0041439_375_1187 | 266 |
| 184 | 3300035170 | Ga0373943_0007447 | Ga0373943_0007447_540_1355 | 266 |
| 185 | 3300035171 | Ga0373946_0003571 | Ga0373946_0003571_2236_3051 | 266 |
| 186 | 3300035398 | Ga0316574_0012451 | Ga0316574_0012451_2971_3786 | 266 |
| 187 | 3300035691 | Ga0373931_0008755 | Ga0373931_0008755_1037_1849 | 266 |
| 188 | 3300035692 | Ga0373935_0004026 | Ga0373935_0004026_4925_5740 | 266 |
| 189 | 3300035692 | Ga0373935_0185238 | Ga0373935_0185238_153_965 | 266 |
| 190 | 3300035695 | Ga0373927_0009261 | Ga0373927_0009261_3100_3915 | 266 |
| 191 | 3300038726 | Ga0400490_24481 | Ga0400490_24481_4307_5125 | 266 |
| 192 | 3300042876 | Ga0451577_0452916 | Ga0451577_0452916_280_1092 | 266 |
| 193 | 3300045051 | Ga0451576_0001306 | Ga0451576_0001306_25011_25823 | 266 |
| 194 | 3300045051 | Ga0451576_0011196 | Ga0451576_0011196_5923_6735 | 266 |
| 195 | 3300046455 | Ga0495603_0005065 | Ga0495603_0005065_4426_5241 | 266 |
| 196 | 3300046472 | Ga0495580_0001418 | Ga0495580_0001418_3172_3987 | 266 |
| 197 | 3300046473 | Ga0495582_0046311 | Ga0495582_0046311_539_1354 | 266 |
| 198 | 3300046475 | Ga0495639_0003830 | Ga0495639_0003830_818_1633 | 266 |
| 199 | 3300046526 | Ga0495666_0016625 | Ga0495666_0016625_603_1418 | 266 |
| 200 | 3300046531 | Ga0495665_0219421 | Ga0495665_0219421_127_942 | 266 |
| 201 | 3300046535 | Ga0495586_0004075 | Ga0495586_0004075_3753_4568 | 266 |
| 202 | 3300046674 | Ga0495588_0046550 | Ga0495588_0046550_633_1448 | 266 |
| 203 | 3300046683 | Ga0495658_0009927 | Ga0495658_0009927_3302_4117 | 266 |
| 204 | 3300048924 | Ga0496121_0028177 | Ga0496121_0028177_2984_3799 | 266 |
| 205 | 3300048927 | Ga0496124_0000088 | Ga0496124_0000088_143892_144707 | 266 |
| 206 | 3300049591 | Ga0501075_0281701 | Ga0501075_0281701_289_1104 | 266 |
| 207 | 3300049822 | Ga0501035_0450577 | Ga0501035_0450577_146_961 | 266 |
| 208 | 3300050507 | nmdc:mga05p37_132_c1 | nmdc:mga05p37_132_c1_22532_23344 | 266 |
| 209 | 3300050508 | nmdc:mga09592_418_c1 | nmdc:mga09592_418_c1_18741_19553 | 266 |
| 210 | 3300050510 | nmdc:mga06r32_611121_c1 | nmdc:mga06r32_611121_c1_231_1046 | 266 |
| 211 | 3300050511 | nmdc:mga08y16_307573_c1 | nmdc:mga08y16_307573_c1_10_822 | 266 |
| 212 | 3300050511 | nmdc:mga08y16_373598_c1 | nmdc:mga08y16_373598_c1_618_1430 | 266 |
| 213 | iso_pu_bacteria | 2547132512 | 2548847102 | 266 |
| 214 | iso_pu_bacteria | 2857576091 | 2857577853 | 266 |
| 215 | 3300005353 | Ga0070669_100099653 | Ga0070669_1000996532 | 267 |
| 216 | 3300005617 | Ga0068859_100149686 | Ga0068859_1001496863 | 267 |
| 217 | 3300005618 | Ga0068864_100232421 | Ga0068864_1002324213 | 267 |
| 218 | 3300005843 | Ga0068860_100447918 | Ga0068860_1004479182 | 267 |
| 219 | 3300006931 | Ga0097620_100149681 | Ga0097620_1001496813 | 267 |
| 220 | 3300013306 | Ga0163162_10253975 | Ga0163162_102539752 | 267 |
| 221 | 3300025961 | Ga0207712_10054677 | Ga0207712_100546772 | 267 |
| 222 | 3300026075 | Ga0207708_10463427 | Ga0207708_104634272 | 267 |
| 223 | 3300026095 | Ga0207676_10204427 | Ga0207676_102044272 | 267 |
| 224 | 3300026118 | Ga0207675_100166159 | Ga0207675_1001661592 | 267 |
| 225 | 3300028381 | Ga0268264_10422048 | Ga0268264_104220482 | 267 |
| 226 | 3300035086 | Ga0373934_0033256 | Ga0373934_0033256_300_1118 | 267 |
| 227 | 3300035117 | Ga0373953_0026472 | Ga0373953_0026472_60_878 | 267 |
| 228 | 3300035118 | Ga0373954_0000002 | Ga0373954_0000002_86104_86922 | 267 |
| 229 | 3300035724 | Ga0373933_0012205 | Ga0373933_0012205_3342_4160 | 267 |
| 230 | 3300036401 | Ga0373937_0000646 | Ga0373937_0000646_23637_24455 | 267 |
| 231 | 3300038741 | Ga0400488_49896 | Ga0400488_49896_2494_3318 | 267 |
| 232 | 3300038742 | Ga0400486_05222 | Ga0400486_05222_11177_12001 | 267 |
| 233 | 3300039062 | Ga0400483_134774 | Ga0400483_134774_2224_3048 | 267 |
| 234 | 3300039062 | Ga0400483_287441 | Ga0400483_287441_1244_2068 | 267 |
| 235 | 3300039110 | Ga0400487_02813 | Ga0400487_02813_2280_3104 | 267 |
| 236 | 3300042003 | Ga0439443_000903 | Ga0439443_000903_647_1465 | 267 |
| 237 | 3300042436 | Ga0439435_0001413 | Ga0439435_0001413_1713_2531 | 267 |
| 238 | 3300042437 | Ga0439444_0000450 | Ga0439444_0000450_661_1479 | 267 |
| 239 | 3300042461 | Ga0439460_0000389 | Ga0439460_0000389_7977_8795 | 267 |
| 240 | 3300047322 | Ga0495680_0112473 | Ga0495680_0112473_490_1302 | 267 |
| 241 | 3300049576 | Ga0501040_0055784 | Ga0501040_0055784_1804_2622 | 267 |
| 242 | 3300028573 | Ga0265334_10000216 | Ga0265334_1000021611 | 268 |
| 243 | 3300031728 | Ga0316578_10089610 | Ga0316578_100896102 | 268 |
| 244 | 3300046683 | Ga0495658_0191690 | Ga0495658_0191690_263_1078 | 268 |
| 245 | iso_pu_bacteria | 2599185292 | 2599904657 | 268 |
| 246 | iso_pu_bacteria | 2643221569 | 2643861208 | 268 |
| 247 | iso_pu_bacteria | 2643221594 | 2643983326 | 268 |
| 248 | iso_pu_bacteria | 2643221621 | 2644124560 | 268 |
| 249 | iso_pu_bacteria | 2808606395 | 2809032756 | 268 |
| 250 | iso_pu_bacteria | 2857537821 | 2857540568 | 268 |
| 251 | iso_pu_bacteria | 2858950400 | 2858951362 | 268 |
| 252 | iso_pu_bacteria | 2941479691 | 2941485928 | 268 |
| 253 | 3300005842 | Ga0068858_100712041 | Ga0068858_1007120411 | 269 |
| 254 | 3300005844 | Ga0068862_100239497 | Ga0068862_1002394972 | 269 |
| 255 | 3300009177 | Ga0105248_10473760 | Ga0105248_104737602 | 269 |
| 256 | 3300013102 | Ga0157371_10036624 | Ga0157371_100366241 | 269 |
| 257 | 3300025292 | Ga0209676_1002357 | Ga0209676_100235710 | 269 |
| 258 | 3300025298 | Ga0209050_1005110 | Ga0209050_10051101 | 269 |
| 259 | 3300025303 | Ga0209051_1019092 | Ga0209051_10190921 | 269 |
| 260 | 3300025923 | Ga0207681_10415591 | Ga0207681_104155912 | 269 |
| 261 | 3300028563 | Ga0265319_1008703 | Ga0265319_10087034 | 269 |
| 262 | 3300028573 | Ga0265334_10001247 | Ga0265334_100012476 | 269 |
| 263 | 3300028800 | Ga0265338_10072217 | Ga0265338_100722172 | 269 |
| 264 | 3300031235 | Ga0265330_10005661 | Ga0265330_100056614 | 269 |
| 265 | 3300031238 | Ga0265332_10002814 | Ga0265332_100028146 | 269 |
| 266 | 3300031239 | Ga0265328_10008403 | Ga0265328_100084034 | 269 |
| 267 | 3300031240 | Ga0265320_10020396 | Ga0265320_100203965 | 269 |
| 268 | 3300031241 | Ga0265325_10005394 | Ga0265325_100053947 | 269 |
| 269 | 3300031242 | Ga0265329_10026312 | Ga0265329_100263123 | 269 |
| 270 | 3300031247 | Ga0265340_10044851 | Ga0265340_100448513 | 269 |
| 271 | 3300031249 | Ga0265339_10014987 | Ga0265339_100149874 | 269 |
| 272 | 3300031250 | Ga0265331_10003147 | Ga0265331_100031475 | 269 |
| 273 | 3300031344 | Ga0265316_10057269 | Ga0265316_100572694 | 269 |
| 274 | 3300031595 | Ga0265313_10000653 | Ga0265313_1000065326 | 269 |
| 275 | 3300031711 | Ga0265314_10013166 | Ga0265314_100131664 | 269 |
| 276 | 3300031728 | Ga0316578_10006348 | Ga0316578_100063487 | 269 |
| 277 | 3300031911 | Ga0307412_10019973 | Ga0307412_100199735 | 269 |
| 278 | 3300035398 | Ga0316574_0006602 | Ga0316574_0006602_3278_4147 | 269 |
| 279 | 3300038725 | Ga0400484_40677 | Ga0400484_40677_9560_10399 | 269 |
| 280 | 3300044712 | Ga0453684_0010323 | Ga0453684_0010323_2019_2849 | 269 |
| 281 | 3300048904 | Ga0496101_0241706 | Ga0496101_0241706_102_935 | 269 |
| 282 | 3300048919 | Ga0496116_0062957 | Ga0496116_0062957_1074_1907 | 269 |
| 283 | 3300048920 | Ga0496117_0054133 | Ga0496117_0054133_1888_2721 | 269 |
| 284 | 3300048921 | Ga0496118_0055775 | Ga0496118_0055775_97_930 | 269 |
| 285 | 3300048921 | Ga0496118_0084706 | Ga0496118_0084706_1315_2148 | 269 |
| 286 | 3300048922 | Ga0496119_0078705 | Ga0496119_0078705_976_1809 | 269 |
| 287 | 3300048922 | Ga0496119_0118119 | Ga0496119_0118119_149_982 | 269 |
| 288 | 3300048923 | Ga0496120_0004722 | Ga0496120_0004722_10182_11015 | 269 |
| 289 | 3300048924 | Ga0496121_0002222 | Ga0496121_0002222_21530_22363 | 269 |
| 290 | 3300048924 | Ga0496121_0114102 | Ga0496121_0114102_123_956 | 269 |
| 291 | 3300048925 | Ga0496122_0001897 | Ga0496122_0001897_751_1584 | 269 |
| 292 | 3300048926 | Ga0496123_0016201 | Ga0496123_0016201_5026_5859 | 269 |
| 293 | 3300048928 | Ga0496125_0000096 | Ga0496125_0000096_7223_8056 | 269 |
| 294 | 3300049574 | Ga0501038_0188827 | Ga0501038_0188827_279_1109 | 269 |
| 295 | 3300049581 | Ga0501047_0010044 | Ga0501047_0010044_1092_1949 | 269 |
| 296 | 3300049822 | Ga0501035_0015367 | Ga0501035_0015367_4289_5119 | 269 |
| 297 | 3300049822 | Ga0501035_0029110 | Ga0501035_0029110_3327_4184 | 269 |
| 298 | 3300049823 | Ga0501044_0000231 | Ga0501044_0000231_55090_55920 | 269 |
| 299 | 3300049823 | Ga0501044_0009991 | Ga0501044_0009991_1865_2722 | 269 |
| 300 | iso_pu_bacteria | 2855730933 | 2855735102 | 269 |
| 301 | iso_pu_bacteria | 2855767633 | 2855770886 | 269 |
| 302 | iso_pu_bacteria | 2881412998 | 2881418275 | 269 |
| 303 | iso_pu_bacteria | 2887375801 | 2887375846 | 269 |
| 304 | 3300001976 | JGI24752J21851_1011447 | JGI24752J21851_10114472 | 270 |
| 305 | 3300003187 | JGI25151J46595_10000606 | JGI25151J46595_1000060613 | 270 |
| 306 | 3300005327 | Ga0070658_10654406 | Ga0070658_106544061 | 270 |
| 307 | 3300005330 | Ga0070690_100047924 | Ga0070690_1000479242 | 270 |
| 308 | 3300005330 | Ga0070690_100154835 | Ga0070690_1001548352 | 270 |
| 309 | 3300005331 | Ga0070670_100001931 | Ga0070670_10000193114 | 270 |
| 310 | 3300005331 | Ga0070670_100007759 | Ga0070670_1000077599 | 270 |
| 311 | 3300005333 | Ga0070677_10186538 | Ga0070677_101865382 | 270 |
| 312 | 3300005334 | Ga0068869_100077260 | Ga0068869_1000772602 | 270 |
| 313 | 3300005335 | Ga0070666_10036676 | Ga0070666_100366762 | 270 |
| 314 | 3300005335 | Ga0070666_10037618 | Ga0070666_100376183 | 270 |
| 315 | 3300005336 | Ga0070680_100244994 | Ga0070680_1002449942 | 270 |
| 316 | 3300005336 | Ga0070680_100328881 | Ga0070680_1003288812 | 270 |
| 317 | 3300005338 | Ga0068868_100001015 | Ga0068868_10000101518 | 270 |
| 318 | 3300005338 | Ga0068868_100070416 | Ga0068868_1000704161 | 270 |
| 319 | 3300005340 | Ga0070689_100232583 | Ga0070689_1002325831 | 270 |
| 320 | 3300005343 | Ga0070687_100003898 | Ga0070687_1000038983 | 270 |
| 321 | 3300005343 | Ga0070687_100073346 | Ga0070687_1000733462 | 270 |
| 322 | 3300005344 | Ga0070661_100000366 | Ga0070661_10000036626 | 270 |
| 323 | 3300005345 | Ga0070692_10334654 | Ga0070692_103346541 | 270 |
| 324 | 3300005347 | Ga0070668_100050037 | Ga0070668_1000500373 | 270 |
| 325 | 3300005347 | Ga0070668_100091489 | Ga0070668_1000914894 | 270 |
| 326 | 3300005353 | Ga0070669_100088306 | Ga0070669_1000883062 | 270 |
| 327 | 3300005353 | Ga0070669_100333472 | Ga0070669_1003334722 | 270 |
| 328 | 3300005354 | Ga0070675_100000296 | Ga0070675_10000029618 | 270 |
| 329 | 3300005354 | Ga0070675_100042937 | Ga0070675_1000429375 | 270 |
| 330 | 3300005354 | Ga0070675_100100791 | Ga0070675_1001007912 | 270 |
| 331 | 3300005354 | Ga0070675_100101804 | Ga0070675_1001018042 | 270 |
| 332 | 3300005354 | Ga0070675_100134168 | Ga0070675_1001341682 | 270 |
| 333 | 3300005355 | Ga0070671_100001203 | Ga0070671_1000012032 | 270 |
| 334 | 3300005355 | Ga0070671_100080861 | Ga0070671_1000808612 | 270 |
| 335 | 3300005356 | Ga0070674_100030818 | Ga0070674_1000308182 | 270 |
| 336 | 3300005364 | Ga0070673_100000095 | Ga0070673_10000009521 | 270 |
| 337 | 3300005364 | Ga0070673_100016520 | Ga0070673_1000165205 | 270 |
| 338 | 3300005364 | Ga0070673_100037994 | Ga0070673_1000379942 | 270 |
| 339 | 3300005367 | Ga0070667_100275420 | Ga0070667_1002754202 | 270 |
| 340 | 3300005439 | Ga0070711_100096291 | Ga0070711_1000962913 | 270 |
| 341 | 3300005445 | Ga0070708_100096758 | Ga0070708_1000967582 | 270 |
| 342 | 3300005456 | Ga0070678_100000184 | Ga0070678_10000018425 | 270 |
| 343 | 3300005456 | Ga0070678_100027655 | Ga0070678_1000276551 | 270 |
| 344 | 3300005456 | Ga0070678_100100168 | Ga0070678_1001001684 | 270 |
| 345 | 3300005457 | Ga0070662_100129552 | Ga0070662_1001295522 | 270 |
| 346 | 3300005457 | Ga0070662_100472968 | Ga0070662_1004729681 | 270 |
| 347 | 3300005458 | Ga0070681_10054445 | Ga0070681_100544452 | 270 |
| 348 | 3300005459 | Ga0068867_100002439 | Ga0068867_1000024396 | 270 |
| 349 | 3300005459 | Ga0068867_100177219 | Ga0068867_1001772191 | 270 |
| 350 | 3300005459 | Ga0068867_100236075 | Ga0068867_1002360752 | 270 |
| 351 | 3300005466 | Ga0070685_10008470 | Ga0070685_100084702 | 270 |
| 352 | 3300005467 | Ga0070706_100083857 | Ga0070706_1000838573 | 270 |
| 353 | 3300005467 | Ga0070706_100124223 | Ga0070706_1001242231 | 270 |
| 354 | 3300005468 | Ga0070707_100063295 | Ga0070707_1000632952 | 270 |
| 355 | 3300005518 | Ga0070699_100044821 | Ga0070699_1000448212 | 270 |
| 356 | 3300005530 | Ga0070679_100268692 | Ga0070679_1002686922 | 270 |
| 357 | 3300005530 | Ga0070679_100365161 | Ga0070679_1003651612 | 270 |
| 358 | 3300005536 | Ga0070697_100084037 | Ga0070697_1000840372 | 270 |
| 359 | 3300005543 | Ga0070672_100000230 | Ga0070672_10000023017 | 270 |
| 360 | 3300005545 | Ga0070695_100059250 | Ga0070695_1000592503 | 270 |
| 361 | 3300005548 | Ga0070665_100056461 | Ga0070665_1000564614 | 270 |
| 362 | 3300005548 | Ga0070665_100068180 | Ga0070665_1000681802 | 270 |
| 363 | 3300005548 | Ga0070665_100527633 | Ga0070665_1005276332 | 270 |
| 364 | 3300005549 | Ga0070704_100005808 | Ga0070704_1000058083 | 270 |
| 365 | 3300005549 | Ga0070704_100014934 | Ga0070704_1000149344 | 270 |
| 366 | 3300005564 | Ga0070664_100000172 | Ga0070664_10000017223 | 270 |
| 367 | 3300005577 | Ga0068857_100274255 | Ga0068857_1002742552 | 270 |
| 368 | 3300005578 | Ga0068854_100002365 | Ga0068854_1000023656 | 270 |
| 369 | 3300005614 | Ga0068856_100014214 | Ga0068856_1000142148 | 270 |
| 370 | 3300005615 | Ga0070702_100007611 | Ga0070702_1000076114 | 270 |
| 371 | 3300005616 | Ga0068852_100001180 | Ga0068852_10000118016 | 270 |
| 372 | 3300005617 | Ga0068859_100010619 | Ga0068859_1000106195 | 270 |
| 373 | 3300005617 | Ga0068859_100085816 | Ga0068859_1000858162 | 270 |
| 374 | 3300005618 | Ga0068864_100001436 | Ga0068864_1000014363 | 270 |
| 375 | 3300005618 | Ga0068864_100007335 | Ga0068864_1000073354 | 270 |
| 376 | 3300005618 | Ga0068864_100087693 | Ga0068864_1000876932 | 270 |
| 377 | 3300005718 | Ga0068866_10037083 | Ga0068866_100370832 | 270 |
| 378 | 3300005719 | Ga0068861_100211999 | Ga0068861_1002119992 | 270 |
| 379 | 3300005719 | Ga0068861_100317325 | Ga0068861_1003173251 | 270 |
| 380 | 3300005834 | Ga0068851_10000892 | Ga0068851_100008927 | 270 |
| 381 | 3300005840 | Ga0068870_10015052 | Ga0068870_100150525 | 270 |
| 382 | 3300005840 | Ga0068870_10041112 | Ga0068870_100411122 | 270 |
| 383 | 3300005841 | Ga0068863_100020746 | Ga0068863_1000207465 | 270 |
| 384 | 3300005841 | Ga0068863_100040403 | Ga0068863_1000404036 | 270 |
| 385 | 3300005841 | Ga0068863_100057945 | Ga0068863_1000579452 | 270 |
| 386 | 3300005842 | Ga0068858_100008373 | Ga0068858_1000083735 | 270 |
| 387 | 3300005842 | Ga0068858_100008871 | Ga0068858_1000088717 | 270 |
| 388 | 3300005843 | Ga0068860_100036010 | Ga0068860_1000360105 | 270 |
| 389 | 3300005843 | Ga0068860_100324827 | Ga0068860_1003248272 | 270 |
| 390 | 3300005844 | Ga0068862_100232417 | Ga0068862_1002324172 | 270 |
| 391 | 3300006051 | Ga0075364_10004227 | Ga0075364_100042278 | 270 |
| 392 | 3300006051 | Ga0075364_10006499 | Ga0075364_100064994 | 270 |
| 393 | 3300006051 | Ga0075364_10048089 | Ga0075364_100480893 | 270 |
| 394 | 3300006051 | Ga0075364_10202908 | Ga0075364_102029082 | 270 |
| 395 | 3300006051 | Ga0075364_10313467 | Ga0075364_103134672 | 270 |
| 396 | 3300006178 | Ga0075367_10186424 | Ga0075367_101864242 | 270 |
| 397 | 3300006186 | Ga0075369_10000244 | Ga0075369_1000024415 | 270 |
| 398 | 3300006195 | Ga0075366_10002077 | Ga0075366_100020773 | 270 |
| 399 | 3300006237 | Ga0097621_100000958 | Ga0097621_1000009584 | 270 |
| 400 | 3300006237 | Ga0097621_100006784 | Ga0097621_1000067847 | 270 |
| 401 | 3300006237 | Ga0097621_100071759 | Ga0097621_1000717593 | 270 |
| 402 | 3300006237 | Ga0097621_100121962 | Ga0097621_1001219623 | 270 |
| 403 | 3300006358 | Ga0068871_100000297 | Ga0068871_10000029720 | 270 |
| 404 | 3300006358 | Ga0068871_100005274 | Ga0068871_1000052745 | 270 |
| 405 | 3300006358 | Ga0068871_100047471 | Ga0068871_1000474713 | 270 |
| 406 | 3300006844 | Ga0075428_100002437 | Ga0075428_1000024373 | 270 |
| 407 | 3300006844 | Ga0075428_100174036 | Ga0075428_1001740361 | 270 |
| 408 | 3300006852 | Ga0075433_10094711 | Ga0075433_100947112 | 270 |
| 409 | 3300006871 | Ga0075434_100046636 | Ga0075434_1000466363 | 270 |
| 410 | 3300006880 | Ga0075429_100014547 | Ga0075429_1000145478 | 270 |
| 411 | 3300006880 | Ga0075429_100194254 | Ga0075429_1001942542 | 270 |
| 412 | 3300006881 | Ga0068865_100029476 | Ga0068865_1000294762 | 270 |
| 413 | 3300006881 | Ga0068865_100168293 | Ga0068865_1001682932 | 270 |
| 414 | 3300006931 | Ga0097620_100010619 | Ga0097620_1000106195 | 270 |
| 415 | 3300006931 | Ga0097620_100085814 | Ga0097620_1000858143 | 270 |
| 416 | 3300009093 | Ga0105240_10072714 | Ga0105240_100727144 | 270 |
| 417 | 3300009093 | Ga0105240_10101898 | Ga0105240_101018984 | 270 |
| 418 | 3300009094 | Ga0111539_10008973 | Ga0111539_100089733 | 270 |
| 419 | 3300009094 | Ga0111539_10726972 | Ga0111539_107269722 | 270 |
| 420 | 3300009098 | Ga0105245_10105546 | Ga0105245_101055462 | 270 |
| 421 | 3300009101 | Ga0105247_10042082 | Ga0105247_100420822 | 270 |
| 422 | 3300009148 | Ga0105243_10026709 | Ga0105243_100267093 | 270 |
| 423 | 3300009148 | Ga0105243_10152337 | Ga0105243_101523371 | 270 |
| 424 | 3300009176 | Ga0105242_10036748 | Ga0105242_100367484 | 270 |
| 425 | 3300009176 | Ga0105242_10132658 | Ga0105242_101326582 | 270 |
| 426 | 3300009177 | Ga0105248_10006699 | Ga0105248_100066997 | 270 |
| 427 | 3300009177 | Ga0105248_10008148 | Ga0105248_1000814812 | 270 |
| 428 | 3300009177 | Ga0105248_10066361 | Ga0105248_100663614 | 270 |
| 429 | 3300009551 | Ga0105238_10416490 | Ga0105238_104164901 | 270 |
| 430 | 3300009553 | Ga0105249_10268169 | Ga0105249_102681692 | 270 |
| 431 | 3300009553 | Ga0105249_10390352 | Ga0105249_103903522 | 270 |
| 432 | 3300010375 | Ga0105239_10107469 | Ga0105239_101074694 | 270 |
| 433 | 3300011119 | Ga0105246_10032885 | Ga0105246_100328854 | 270 |
| 434 | 3300013296 | Ga0157374_10000531 | Ga0157374_1000053121 | 270 |
| 435 | 3300013296 | Ga0157374_10003810 | Ga0157374_100038108 | 270 |
| 436 | 3300013296 | Ga0157374_10025690 | Ga0157374_100256904 | 270 |
| 437 | 3300013297 | Ga0157378_10003226 | Ga0157378_1000322613 | 270 |
| 438 | 3300013297 | Ga0157378_10205661 | Ga0157378_102056612 | 270 |
| 439 | 3300013306 | Ga0163162_10004676 | Ga0163162_1000467613 | 270 |
| 440 | 3300013306 | Ga0163162_10134972 | Ga0163162_101349722 | 270 |
| 441 | 3300013306 | Ga0163162_10170734 | Ga0163162_101707344 | 270 |
| 442 | 3300013306 | Ga0163162_11133869 | Ga0163162_111338691 | 270 |
| 443 | 3300013308 | Ga0157375_10000588 | Ga0157375_1000058830 | 270 |
| 444 | 3300013308 | Ga0157375_10011760 | Ga0157375_1001176010 | 270 |
| 445 | 3300013308 | Ga0157375_10033046 | Ga0157375_100330465 | 270 |
| 446 | 3300014325 | Ga0163163_10011506 | Ga0163163_100115066 | 270 |
| 447 | 3300014325 | Ga0163163_10239305 | Ga0163163_102393052 | 270 |
| 448 | 3300014325 | Ga0163163_10422388 | Ga0163163_104223882 | 270 |
| 449 | 3300014326 | Ga0157380_10088922 | Ga0157380_100889223 | 270 |
| 450 | 3300014326 | Ga0157380_10090070 | Ga0157380_100900702 | 270 |
| 451 | 3300014326 | Ga0157380_10511036 | Ga0157380_105110361 | 270 |
| 452 | 3300014968 | Ga0157379_10007628 | Ga0157379_100076286 | 270 |
| 453 | 3300014968 | Ga0157379_10066249 | Ga0157379_100662493 | 270 |
| 454 | 3300014969 | Ga0157376_10008732 | Ga0157376_100087327 | 270 |
| 455 | 3300014969 | Ga0157376_10028599 | Ga0157376_100285993 | 270 |
| 456 | 3300014969 | Ga0157376_10050765 | Ga0157376_100507653 | 270 |
| 457 | 3300017792 | Ga0163161_10408255 | Ga0163161_104082552 | 270 |
| 458 | 3300025294 | Ga0209025_1000071 | Ga0209025_1000071141 | 270 |
| 459 | 3300025321 | Ga0207656_10000672 | Ga0207656_1000067211 | 270 |
| 460 | 3300025893 | Ga0207682_10006178 | Ga0207682_100061783 | 270 |
| 461 | 3300025899 | Ga0207642_10029270 | Ga0207642_100292703 | 270 |
| 462 | 3300025899 | Ga0207642_10075211 | Ga0207642_100752112 | 270 |
| 463 | 3300025901 | Ga0207688_10009150 | Ga0207688_100091506 | 270 |
| 464 | 3300025901 | Ga0207688_10272587 | Ga0207688_102725871 | 270 |
| 465 | 3300025907 | Ga0207645_10006565 | Ga0207645_100065656 | 270 |
| 466 | 3300025907 | Ga0207645_10124019 | Ga0207645_101240192 | 270 |
| 467 | 3300025908 | Ga0207643_10013580 | Ga0207643_100135802 | 270 |
| 468 | 3300025909 | Ga0207705_10196637 | Ga0207705_101966372 | 270 |
| 469 | 3300025910 | Ga0207684_10277844 | Ga0207684_102778442 | 270 |
| 470 | 3300025917 | Ga0207660_10295093 | Ga0207660_102950931 | 270 |
| 471 | 3300025918 | Ga0207662_10007962 | Ga0207662_100079622 | 270 |
| 472 | 3300025918 | Ga0207662_10029653 | Ga0207662_100296532 | 270 |
| 473 | 3300025920 | Ga0207649_10002695 | Ga0207649_100026958 | 270 |
| 474 | 3300025921 | Ga0207652_10687349 | Ga0207652_106873491 | 270 |
| 475 | 3300025922 | Ga0207646_10538434 | Ga0207646_105384341 | 270 |
| 476 | 3300025923 | Ga0207681_10038509 | Ga0207681_100385093 | 270 |
| 477 | 3300025925 | Ga0207650_10000698 | Ga0207650_1000069810 | 270 |
| 478 | 3300025925 | Ga0207650_10001764 | Ga0207650_100017646 | 270 |
| 479 | 3300025926 | Ga0207659_10001270 | Ga0207659_1000127014 | 270 |
| 480 | 3300025926 | Ga0207659_10008733 | Ga0207659_100087335 | 270 |
| 481 | 3300025926 | Ga0207659_10021915 | Ga0207659_100219155 | 270 |
| 482 | 3300025931 | Ga0207644_10005694 | Ga0207644_100056947 | 270 |
| 483 | 3300025931 | Ga0207644_10012832 | Ga0207644_100128323 | 270 |
| 484 | 3300025933 | Ga0207706_10105610 | Ga0207706_101056103 | 270 |
| 485 | 3300025933 | Ga0207706_10407579 | Ga0207706_104075791 | 270 |
| 486 | 3300025935 | Ga0207709_10033312 | Ga0207709_100333122 | 270 |
| 487 | 3300025935 | Ga0207709_10199448 | Ga0207709_101994482 | 270 |
| 488 | 3300025938 | Ga0207704_10076520 | Ga0207704_100765202 | 270 |
| 489 | 3300025940 | Ga0207691_10000530 | Ga0207691_1000053027 | 270 |
| 490 | 3300025940 | Ga0207691_10092970 | Ga0207691_100929702 | 270 |
| 491 | 3300025941 | Ga0207711_10190983 | Ga0207711_101909832 | 270 |
| 492 | 3300025942 | Ga0207689_10107065 | Ga0207689_101070652 | 270 |
| 493 | 3300025944 | Ga0207661_10000573 | Ga0207661_1000057311 | 270 |
| 494 | 3300025945 | Ga0207679_10001715 | Ga0207679_100017155 | 270 |
| 495 | 3300025949 | Ga0207667_10465963 | Ga0207667_104659632 | 270 |
| 496 | 3300025960 | Ga0207651_10000663 | Ga0207651_100006639 | 270 |
| 497 | 3300025960 | Ga0207651_10005256 | Ga0207651_100052565 | 270 |
| 498 | 3300025960 | Ga0207651_10140337 | Ga0207651_101403372 | 270 |
| 499 | 3300025972 | Ga0207668_10057789 | Ga0207668_100577892 | 270 |
| 500 | 3300025981 | Ga0207640_10008002 | Ga0207640_100080022 | 270 |
| 501 | 3300025986 | Ga0207658_10045176 | Ga0207658_100451761 | 270 |
| 502 | 3300026023 | Ga0207677_10000490 | Ga0207677_1000049011 | 270 |
| 503 | 3300026023 | Ga0207677_10022086 | Ga0207677_100220862 | 270 |
| 504 | 3300026023 | Ga0207677_10050506 | Ga0207677_100505061 | 270 |
| 505 | 3300026023 | Ga0207677_10491754 | Ga0207677_104917541 | 270 |
| 506 | 3300026035 | Ga0207703_10008995 | Ga0207703_100089956 | 270 |
| 507 | 3300026035 | Ga0207703_10038665 | Ga0207703_100386653 | 270 |
| 508 | 3300026075 | Ga0207708_10012002 | Ga0207708_100120021 | 270 |
| 509 | 3300026078 | Ga0207702_10588047 | Ga0207702_105880471 | 270 |
| 510 | 3300026088 | Ga0207641_10008259 | Ga0207641_100082598 | 270 |
| 511 | 3300026088 | Ga0207641_10043817 | Ga0207641_100438173 | 270 |
| 512 | 3300026088 | Ga0207641_10127849 | Ga0207641_101278492 | 270 |
| 513 | 3300026089 | Ga0207648_10012160 | Ga0207648_100121603 | 270 |
| 514 | 3300026089 | Ga0207648_10031374 | Ga0207648_100313743 | 270 |
| 515 | 3300026089 | Ga0207648_10048748 | Ga0207648_100487484 | 270 |
| 516 | 3300026095 | Ga0207676_10010028 | Ga0207676_100100286 | 270 |
| 517 | 3300026095 | Ga0207676_10018547 | Ga0207676_100185473 | 270 |
| 518 | 3300026095 | Ga0207676_10053184 | Ga0207676_100531842 | 270 |
| 519 | 3300026116 | Ga0207674_10021761 | Ga0207674_100217616 | 270 |
| 520 | 3300026118 | Ga0207675_100020819 | Ga0207675_1000208194 | 270 |
| 521 | 3300026121 | Ga0207683_10001233 | Ga0207683_1000123321 | 270 |
| 522 | 3300026121 | Ga0207683_10014248 | Ga0207683_100142486 | 270 |
| 523 | 3300026121 | Ga0207683_10449664 | Ga0207683_104496642 | 270 |
| 524 | 3300026142 | Ga0207698_10012522 | Ga0207698_100125226 | 270 |
| 525 | 3300026142 | Ga0207698_10245733 | Ga0207698_102457332 | 270 |
| 526 | 3300027364 | Ga0209967_1003844 | Ga0209967_10038442 | 270 |
| 527 | 3300027462 | Ga0210000_1000334 | Ga0210000_10003348 | 270 |
| 528 | 3300027471 | Ga0209995_1000887 | Ga0209995_10008871 | 270 |
| 529 | 3300027543 | Ga0209999_1002514 | Ga0209999_10025142 | 270 |
| 530 | 3300027552 | Ga0209982_1006211 | Ga0209982_10062112 | 270 |
| 531 | 3300027665 | Ga0209983_1012545 | Ga0209983_10125452 | 270 |
| 532 | 3300027682 | Ga0209971_1006270 | Ga0209971_10062703 | 270 |
| 533 | 3300027876 | Ga0209974_10004797 | Ga0209974_100047972 | 270 |
| 534 | 3300027907 | Ga0207428_10016169 | Ga0207428_100161698 | 270 |
| 535 | 3300028379 | Ga0268266_10072600 | Ga0268266_100726004 | 270 |
| 536 | 3300028379 | Ga0268266_10151448 | Ga0268266_101514482 | 270 |
| 537 | 3300028381 | Ga0268264_10051230 | Ga0268264_100512304 | 270 |
| 538 | 3300028381 | Ga0268264_10498651 | Ga0268264_104986512 | 270 |
| 539 | 3300028577 | Ga0265318_10001810 | Ga0265318_100018104 | 270 |
| 540 | 3300028577 | Ga0265318_10063277 | Ga0265318_100632772 | 270 |
| 541 | 3300031235 | Ga0265330_10011234 | Ga0265330_100112344 | 270 |
| 542 | 3300031238 | Ga0265332_10000286 | Ga0265332_1000028620 | 270 |
| 543 | 3300031238 | Ga0265332_10003080 | Ga0265332_100030808 | 270 |
| 544 | 3300031239 | Ga0265328_10002318 | Ga0265328_100023188 | 270 |
| 545 | 3300031240 | Ga0265320_10012333 | Ga0265320_100123337 | 270 |
| 546 | 3300031242 | Ga0265329_10010166 | Ga0265329_100101663 | 270 |
| 547 | 3300031250 | Ga0265331_10000989 | Ga0265331_1000098913 | 270 |
| 548 | 3300031344 | Ga0265316_10056027 | Ga0265316_100560272 | 270 |
| 549 | 3300031711 | Ga0265314_10014501 | Ga0265314_100145013 | 270 |
| 550 | 3300031712 | Ga0265342_10013789 | Ga0265342_100137897 | 270 |
| 551 | 3300035695 | Ga0373927_0442782 | Ga0373927_0442782_19_846 | 270 |
| 552 | 3300036401 | Ga0373937_0044086 | Ga0373937_0044086_2970_3821 | 270 |
| 553 | 3300037418 | Ga0395900_0164690 | Ga0395900_0164690_194_1012 | 270 |
| 554 | 3300037471 | Ga0395905_0015084 | Ga0395905_0015084_1519_2337 | 270 |
| 555 | 3300038443 | Ga0395901_0036213 | Ga0395901_0036213_422_1240 | 270 |
| 556 | 3300038725 | Ga0400484_36649 | Ga0400484_36649_20798_21643 | 270 |
| 557 | 3300038726 | Ga0400490_19580 | Ga0400490_19580_15334_16173 | 270 |
| 558 | 3300038726 | Ga0400490_31277 | Ga0400490_31277_2471_3316 | 270 |
| 559 | 3300038726 | Ga0400490_46324 | Ga0400490_46324_6219_7064 | 270 |
| 560 | 3300038735 | Ga0400485_21786 | Ga0400485_21786_2307_3152 | 270 |
| 561 | 3300038741 | Ga0400488_55744 | Ga0400488_55744_1385_2230 | 270 |
| 562 | 3300038742 | Ga0400486_18420 | Ga0400486_18420_323_1168 | 270 |
| 563 | 3300038742 | Ga0400486_22694 | Ga0400486_22694_6174_7019 | 270 |
| 564 | 3300038742 | Ga0400486_32535 | Ga0400486_32535_635_1480 | 270 |
| 565 | 3300039062 | Ga0400483_015147 | Ga0400483_015147_4699_5544 | 270 |
| 566 | 3300039062 | Ga0400483_111606 | Ga0400483_111606_2708_3547 | 270 |
| 567 | 3300039062 | Ga0400483_285866 | Ga0400483_285866_1615_2460 | 270 |
| 568 | 3300039093 | Ga0400489_48784 | Ga0400489_48784_19341_20186 | 270 |
| 569 | 3300039110 | Ga0400487_35338 | Ga0400487_35338_640_1485 | 270 |
| 570 | 3300039110 | Ga0400487_51851 | Ga0400487_51851_116_961 | 270 |
| 571 | 3300042876 | Ga0451577_0000264 | Ga0451577_0000264_26866_27702 | 270 |
| 572 | 3300042876 | Ga0451577_0039896 | Ga0451577_0039896_1867_2703 | 270 |
| 573 | 3300042876 | Ga0451577_0159958 | Ga0451577_0159958_1007_1828 | 270 |
| 574 | 3300044673 | Ga0453683_0000047 | Ga0453683_0000047_160144_160965 | 270 |
| 575 | 3300044684 | Ga0466966_0027860 | Ga0466966_0027860_1416_2234 | 270 |
| 576 | 3300044712 | Ga0453684_0000302 | Ga0453684_0000302_46799_47620 | 270 |
| 577 | 3300044712 | Ga0453684_0006132 | Ga0453684_0006132_3922_4758 | 270 |
| 578 | 3300044712 | Ga0453684_0020628 | Ga0453684_0020628_3504_4349 | 270 |
| 579 | 3300045051 | Ga0451576_0000096 | Ga0451576_0000096_79912_80748 | 270 |
| 580 | 3300045051 | Ga0451576_0000116 | Ga0451576_0000116_160144_160965 | 270 |
| 581 | 3300046472 | Ga0495580_0290394 | Ga0495580_0290394_278_1105 | 270 |
| 582 | 3300046501 | Ga0495607_0000050 | Ga0495607_0000050_51388_52209 | 270 |
| 583 | 3300046684 | Ga0495669_0031846 | Ga0495669_0031846_1292_2104 | 270 |
| 584 | 3300048907 | Ga0496104_0097099 | Ga0496104_0097099_1308_2135 | 270 |
| 585 | 3300048908 | Ga0496105_0191914 | Ga0496105_0191914_16_843 | 270 |
| 586 | 3300048911 | Ga0496108_0001128 | Ga0496108_0001128_17319_18146 | 270 |
| 587 | 3300048911 | Ga0496108_0333104 | Ga0496108_0333104_283_1095 | 270 |
| 588 | 3300048912 | Ga0496109_0010127 | Ga0496109_0010127_1357_2184 | 270 |
| 589 | 3300048913 | Ga0496110_0001483 | Ga0496110_0001483_1156_1983 | 270 |
| 590 | 3300048915 | Ga0496112_0082105 | Ga0496112_0082105_20_847 | 270 |
| 591 | 3300048917 | Ga0496114_0086267 | Ga0496114_0086267_928_1740 | 270 |
| 592 | 3300049569 | Ga0501032_0001373 | Ga0501032_0001373_1026_1853 | 270 |
| 593 | 3300049570 | Ga0501033_0012697 | Ga0501033_0012697_2040_2867 | 270 |
| 594 | 3300049571 | Ga0501034_0000641 | Ga0501034_0000641_39567_40379 | 270 |
| 595 | 3300049571 | Ga0501034_0020598 | Ga0501034_0020598_2248_3075 | 270 |
| 596 | 3300049571 | Ga0501034_0119887 | Ga0501034_0119887_120_941 | 270 |
| 597 | 3300049572 | Ga0501036_0049516 | Ga0501036_0049516_503_1330 | 270 |
| 598 | 3300049573 | Ga0501037_0000474 | Ga0501037_0000474_13753_14580 | 270 |
| 599 | 3300049574 | Ga0501038_0008209 | Ga0501038_0008209_7268_8095 | 270 |
| 600 | 3300049575 | Ga0501039_0025347 | Ga0501039_0025347_888_1715 | 270 |
| 601 | 3300049576 | Ga0501040_0003365 | Ga0501040_0003365_9317_10144 | 270 |
| 602 | 3300049578 | Ga0501042_0012886 | Ga0501042_0012886_4113_4940 | 270 |
| 603 | 3300049579 | Ga0501043_0014893 | Ga0501043_0014893_4192_5019 | 270 |
| 604 | 3300049579 | Ga0501043_0102854 | Ga0501043_0102854_728_1555 | 270 |
| 605 | 3300049580 | Ga0501046_0012703 | Ga0501046_0012703_4151_4978 | 270 |
| 606 | 3300049582 | Ga0501048_0063677 | Ga0501048_0063677_1224_2051 | 270 |
| 607 | 3300049583 | Ga0501067_0187117 | Ga0501067_0187117_102_914 | 270 |
| 608 | 3300049584 | Ga0501068_0000140 | Ga0501068_0000140_4794_5606 | 270 |
| 609 | 3300049584 | Ga0501068_0002905 | Ga0501068_0002905_7143_7970 | 270 |
| 610 | 3300049588 | Ga0501072_0005894 | Ga0501072_0005894_2740_3552 | 270 |
| 611 | 3300049589 | Ga0501073_0014507 | Ga0501073_0014507_4695_5507 | 270 |
| 612 | 3300049742 | Ga0501080_0149995 | Ga0501080_0149995_996_1808 | 270 |
| 613 | 3300049742 | Ga0501080_0291692 | Ga0501080_0291692_33_845 | 270 |
| 614 | 3300049823 | Ga0501044_0023765 | Ga0501044_0023765_1359_2186 | 270 |
| 615 | 3300049824 | Ga0501045_0003419 | Ga0501045_0003419_1246_2073 | 270 |
| 616 | 3300050491 | nmdc:mga00v17_22766_c1 | nmdc:mga00v17_22766_c1_2060_2881 | 270 |
| 617 | 3300050491 | nmdc:mga00v17_298749_c1 | nmdc:mga00v17_298749_c1_173_1006 | 270 |
| 618 | 3300050491 | nmdc:mga00v17_304151_c1 | nmdc:mga00v17_304151_c1_92_928 | 270 |
| 619 | 3300050491 | nmdc:mga00v17_5593_c1 | nmdc:mga00v17_5593_c1_1528_2361 | 270 |
| 620 | 3300050491 | nmdc:mga00v17_8189_c1 | nmdc:mga00v17_8189_c1_3238_4071 | 270 |
| 621 | 3300050493 | nmdc:mga0k408_2784_c1 | nmdc:mga0k408_2784_c1_5436_6272 | 270 |
| 622 | 3300050493 | nmdc:mga0k408_3933_c1 | nmdc:mga0k408_3933_c1_6035_6856 | 270 |
| 623 | 3300050494 | nmdc:mga06z11_281558_c1 | nmdc:mga06z11_281558_c1_34_855 | 270 |
| 624 | 3300050508 | nmdc:mga09592_187364_c1 | nmdc:mga09592_187364_c1_364_1191 | 270 |
| 625 | 3300050509 | nmdc:mga0qj67_175257_c1 | nmdc:mga0qj67_175257_c1_388_1215 | 270 |
| 626 | 3300050511 | nmdc:mga08y16_10406_c1 | nmdc:mga08y16_10406_c1_1403_2230 | 270 |
| 627 | 3300050512 | nmdc:mga0n895_46935_c1 | nmdc:mga0n895_46935_c1_1130_1957 | 270 |
| 628 | 3300050515 | nmdc:mga0a205_34161_c1 | nmdc:mga0a205_34161_c1_1343_2170 | 270 |
| 629 | 3300050516 | nmdc:mga0sz30_18417_c1 | nmdc:mga0sz30_18417_c1_1354_2175 | 270 |
| 630 | 3300061719 | Ga0466962_0069043 | Ga0466962_0069043_265_1083 | 270 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dfj-assembly1.cif.gz_B | crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a | 0.9692 | 2 | 262 |
| 2dfj-assembly1.cif.gz_B | crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a | 0.9444 | 2 | 262 |
| 2qjc-assembly1.cif.gz_A | crystal structure of a putative diadenosine tetraphosphatase | 0.8576 | 2 | 262 |
| 2qjc-assembly1.cif.gz_A | crystal structure of a putative diadenosine tetraphosphatase | 0.7885 | 2 | 262 |
| 4j6o-assembly2.cif.gz_B | crystal structure of the phosphatase domain of c. thermocellum (bacterial) pnkp | 0.6765 | 2 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dfjA00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9725 | 2 | 264 | 3.60.21.10 |
| 2dfjA00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9547 | 2 | 264 | 3.60.21.10 |
| af_Q4E243_1_156_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8914 | 5 | 67 | 3.60.21.10 |
| af_A0A0R0FVP8_67_225_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8826 | 3 | 67 | 3.60.21.10 |
| af_U4PM66_856_953_2.60.40.60 | Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins | 0.8331 | 249 | 263 | 2.60.40.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536WUC0-F1-model_v4 | Symmetrical bis(5'-nucleosyl)-tetraphosphatase (EC 3.6.1.41) | 0.9951 | 1 | 185 |
GO:0008803
|
| AF-A0A1M3GY89-F1-model_v4 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) (EC 3.6.1.41) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) (Diadenosine tetraphosphatase) | 0.993 | 1 | 226 |
GO:0008803
|
| AF-A0A0K9NXR9-F1-model_v4 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) (EC 3.6.1.41) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) (Diadenosine tetraphosphatase) | 0.9919 | 1 | 257 |
GO:0008803
GO:0009055 GO:0016020 GO:0020037 GO:0046872 |
| AF-A0A7V3CFW4-F1-model_v4 | Diadenosine tetraphosphatase | 0.9911 | 1 | 97 |
GO:0005737
GO:0008803 GO:0016791 GO:0110154 |
| AF-A0A1G3Y8J9-F1-model_v4 | Bis(5'-nucleosyl)-tetraphosphatase, symmetrical (EC 3.6.1.41) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) (Diadenosine tetraphosphatase) | 0.9906 | 1 | 262 |
GO:0008803
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar