F470819

General Info

Members Datasets Scaffolds Average Seq Length
630 336 614 273

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10042082|Ga0105247_100420822
Length 322
Sequence MATYAIGDIQGCFQGLQLLLDEIGFDLLSDRLWFVGDMVNRGPDSLATLRFVRGLGERAVAVLGNHDLHLLTVAEGLEKLRRDDTLDDVLAAPDREELLVWLRHRPLMHYEDGIAMVHAGLLPSWSVSRALELAAEIESKLRNESYRSFLAKMYGNRPDRWNESLTGYDRLRVIVNAMTRLRLCSTDGVMEFGHKGRLKALPSGYVPWFEAPGRRSRDTPVICGHWSALGLYASENLFALDTGCLWGRRLTALRIEDRKIFQISCRGLAGLSGRNSLFALACQVTAGLPADLDGRAKHQVGVQCWIAQYQAHRFQQRAIIRI

Samples

Sample ID Description Type Environment
1 2547132512 Azospira oryzae 6a3 Isolate Unclassified
2 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
3 2643221569 Achromobacter sp. Root565 Isolate Unclassified
4 2643221594 Achromobacter sp. Root170 Isolate Unclassified
5 2643221621 Achromobacter sp. Root83 Isolate Unclassified
6 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
7 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
8 2855730933 Achromobacter sp. HZ28 Isolate Nodule
9 2855767633 Achromobacter sp. HZ34 Isolate Nodule
10 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
11 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
12 2858950400 Achromobacter sp. K91 Isolate Unclassified
13 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
14 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
15 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
16 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
17 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
195 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
196 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
201 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
202 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
203 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
207 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
208 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
209 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
212 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
213 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
219 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
220 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
221 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
222 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
223 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
224 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
225 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
226 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
227 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
228 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
229 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
230 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
231 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
232 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
233 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
234 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
237 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
238 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
239 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
249 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
250 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
251 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
252 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
253 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
254 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
255 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
256 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
257 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
258 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
259 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
260 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
261 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
262 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
263 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
264 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
265 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
272 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
273 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
291 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
298 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
313 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
314 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
317 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
333 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
334 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
335 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
336 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.46
Metatranscriptomes 0
Isolates 2.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.97
Nodule 0.32
Rhizoplane 1.59
Rhizosphere 85.24
Stem 0
Stem Tuber 0
Unclassified 8.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1011447 3300001976 Bacteria 1160
2 JGI24750J21931_1007051 3300002070 Bacteria 1409
3 JGI25151J46595_10000606 3300003187 Bacteria 31425
4 JGI25406J46586_10011860 3300003203 Bacteria 3805
5 Ga0055529_1001538 3300003763 Bacteria 6592
6 Ga0070658_10654406 3300005327 Bacteria 911
7 Ga0070683_100097814 3300005329 Bacteria 2761
8 Ga0070690_100000082 3300005330 Bacteria 46700
9 Ga0070690_100047924 3300005330 Bacteria 2719
10 Ga0070690_100074421 3300005330 Bacteria 2212
11 Ga0070690_100154835 3300005330 Bacteria 1566
12 Ga0070670_100001931 3300005331 Bacteria 16973
13 Ga0070670_100007759 3300005331 Bacteria 9129
14 Ga0070677_10186538 3300005333 Bacteria 991
15 Ga0068869_100000044 3300005334 Bacteria 52351
16 Ga0068869_100077260 3300005334 Bacteria 2476
17 Ga0068869_100449209 3300005334 Bacteria 1068
18 Ga0070666_10036676 3300005335 Bacteria 3256
19 Ga0070666_10037618 3300005335 Bacteria 3218
20 Ga0070680_100034292 3300005336 Bacteria 4092
21 Ga0070680_100244994 3300005336 Bacteria 1515
22 Ga0070680_100328881 3300005336 Bacteria 1298
23 Ga0070682_100007785 3300005337 Bacteria 6035
24 Ga0068868_100000458 3300005338 Bacteria 27113
25 Ga0068868_100001015 3300005338 Bacteria 19169
26 Ga0068868_100070416 3300005338 Bacteria 2789
27 Ga0070689_100007655 3300005340 Bacteria 7566
28 Ga0070689_100232583 3300005340 Bacteria 1515
29 Ga0070691_10000573 3300005341 Bacteria 14042
30 Ga0070687_100000034 3300005343 Bacteria 43229
31 Ga0070687_100003898 3300005343 Bacteria 5866
32 Ga0070687_100009500 3300005343 Bacteria 4171
33 Ga0070687_100073346 3300005343 Bacteria 1844
34 Ga0070661_100000366 3300005344 Bacteria 35667
35 Ga0070692_10025480 3300005345 Bacteria 2915
36 Ga0070692_10334654 3300005345 Bacteria 936
37 Ga0070668_100050037 3300005347 Bacteria 3216
38 Ga0070668_100091489 3300005347 Bacteria 2399
39 Ga0070669_100088306 3300005353 Bacteria 2320
40 Ga0070669_100099653 3300005353 Bacteria 2190
41 Ga0070669_100333472 3300005353 Bacteria 1227
42 Ga0070675_100000296 3300005354 Bacteria 33297
43 Ga0070675_100042937 3300005354 Bacteria 3694
44 Ga0070675_100100791 3300005354 Bacteria 2432
45 Ga0070675_100101804 3300005354 Bacteria 2420
46 Ga0070675_100134168 3300005354 Bacteria 2112
47 Ga0070671_100001203 3300005355 Bacteria 19368
48 Ga0070671_100080861 3300005355 Bacteria 2717
49 Ga0070674_100030818 3300005356 Bacteria 3547
50 Ga0070673_100000095 3300005364 Bacteria 39351
51 Ga0070673_100016520 3300005364 Bacteria 5222
52 Ga0070673_100037994 3300005364 Bacteria 3673
53 Ga0070667_100275420 3300005367 Bacteria 1510
54 Ga0070703_10004765 3300005406 Bacteria 3795
55 Ga0070701_10000346 3300005438 Bacteria 15392
56 Ga0070711_100096291 3300005439 Bacteria 2144
57 Ga0070705_100000030 3300005440 Bacteria 71489
58 Ga0070700_100000552 3300005441 Bacteria 18819
59 Ga0070700_100121428 3300005441 Bacteria 1751
60 Ga0070694_100000706 3300005444 Bacteria 18607
61 Ga0070694_100078873 3300005444 Bacteria 2285
62 Ga0070708_100096758 3300005445 Bacteria 2697
63 Ga0070678_100000184 3300005456 Bacteria 27334
64 Ga0070678_100027655 3300005456 Bacteria 3854
65 Ga0070678_100100168 3300005456 Bacteria 2244
66 Ga0070662_100129552 3300005457 Bacteria 1943
67 Ga0070662_100472968 3300005457 Bacteria 1043
68 Ga0070681_10054445 3300005458 Bacteria 3987
69 Ga0070681_10071328 3300005458 Bacteria 3438
70 Ga0068867_100000032 3300005459 Bacteria 84727
71 Ga0068867_100002439 3300005459 Bacteria 13068
72 Ga0068867_100177219 3300005459 Bacteria 1692
73 Ga0068867_100236075 3300005459 Bacteria 1480
74 Ga0070685_10008470 3300005466 Bacteria 5287
75 Ga0070706_100083857 3300005467 Bacteria 2953
76 Ga0070706_100124223 3300005467 Bacteria 2406
77 Ga0070707_100063295 3300005468 Bacteria 3550
78 Ga0070698_100078792 3300005471 Bacteria 3293
79 Ga0070699_100044821 3300005518 Bacteria 3829
80 Ga0070699_100111502 3300005518 Bacteria 2402
81 Ga0070679_100003506 3300005530 Bacteria 14366
82 Ga0070679_100268692 3300005530 Bacteria 1660
83 Ga0070679_100365161 3300005530 Bacteria 1391
84 Ga0070684_100075658 3300005535 Bacteria 2970
85 Ga0070697_100043101 3300005536 Bacteria 3653
86 Ga0070697_100084037 3300005536 Bacteria 2625
87 Ga0068853_100012831 3300005539 Bacteria 6826
88 Ga0070672_100000230 3300005543 Bacteria 31233
89 Ga0070672_100459528 3300005543 Bacteria 1097
90 Ga0070686_100001608 3300005544 Bacteria 12699
91 Ga0070686_100005201 3300005544 Bacteria 7189
92 Ga0070695_100000514 3300005545 Bacteria 20333
93 Ga0070695_100039124 3300005545 Bacteria 2996
94 Ga0070695_100059250 3300005545 Bacteria 2478
95 Ga0070696_100000089 3300005546 Bacteria 44686
96 Ga0070693_100000100 3300005547 Bacteria 38176
97 Ga0070665_100056461 3300005548 Bacteria 3936
98 Ga0070665_100068180 3300005548 Bacteria 3567
99 Ga0070665_100527633 3300005548 Bacteria 1192
100 Ga0070704_100001681 3300005549 Bacteria 12024
101 Ga0070704_100005808 3300005549 Bacteria 7222
102 Ga0070704_100014934 3300005549 Bacteria 4862
103 Ga0068855_100000695 3300005563 Bacteria 41137
104 Ga0070664_100000172 3300005564 Bacteria 45323
105 Ga0068857_100274255 3300005577 Bacteria 1550
106 Ga0068854_100002365 3300005578 Bacteria 11628
107 Ga0068854_100055460 3300005578 Bacteria 2853
108 Ga0068856_100014214 3300005614 Bacteria 7695
109 Ga0068856_100062178 3300005614 Bacteria 3688
110 Ga0070702_100000001 3300005615 Bacteria 87224
111 Ga0070702_100007611 3300005615 Bacteria 5191
112 Ga0070702_100162023 3300005615 Bacteria 1447
113 Ga0068852_100001180 3300005616 Bacteria 17310
114 Ga0068852_100123819 3300005616 Bacteria 2371
115 Ga0068859_100000149 3300005617 Bacteria 66296
116 Ga0068859_100010619 3300005617 Bacteria 9266
117 Ga0068859_100085816 3300005617 Bacteria 3193
118 Ga0068859_100149686 3300005617 Bacteria 2410
119 Ga0068859_100588132 3300005617 Bacteria 1206
120 Ga0068864_100001436 3300005618 Bacteria 19650
121 Ga0068864_100007335 3300005618 Bacteria 9072
122 Ga0068864_100087693 3300005618 Bacteria 2740
123 Ga0068864_100232421 3300005618 Bacteria 1706
124 Ga0068866_10000277 3300005718 Bacteria 24435
125 Ga0068866_10037083 3300005718 Bacteria 2392
126 Ga0068861_100000057 3300005719 Bacteria 52351
127 Ga0068861_100211999 3300005719 Bacteria 1632
128 Ga0068861_100317325 3300005719 Bacteria 1356
129 Ga0068851_10000892 3300005834 Bacteria 12882
130 Ga0068870_10015052 3300005840 Bacteria 3664
131 Ga0068870_10041112 3300005840 Bacteria 2401
132 Ga0068863_100020746 3300005841 Bacteria 6276
133 Ga0068863_100040403 3300005841 Bacteria 4435
134 Ga0068863_100057945 3300005841 Bacteria 3666
135 Ga0068863_100260396 3300005841 Bacteria 1677
136 Ga0068858_100000289 3300005842 Bacteria 54365
137 Ga0068858_100008373 3300005842 Bacteria 9948
138 Ga0068858_100008871 3300005842 Bacteria 9642
139 Ga0068858_100712041 3300005842 Bacteria 977
140 Ga0068860_100001090 3300005843 Bacteria 29921
141 Ga0068860_100036010 3300005843 Bacteria 4744
142 Ga0068860_100324827 3300005843 Bacteria 1510
143 Ga0068860_100447918 3300005843 Bacteria 1283
144 Ga0068862_100000409 3300005844 Bacteria 46422
145 Ga0068862_100028276 3300005844 Bacteria 4720
146 Ga0068862_100232417 3300005844 Bacteria 1673
147 Ga0068862_100239497 3300005844 Bacteria 1649
148 Ga0081539_10004364 3300005985 Bacteria 15760
149 Ga0075364_10004227 3300006051 Bacteria 8247
150 Ga0075364_10006499 3300006051 Bacteria 6873
151 Ga0075364_10048089 3300006051 Bacteria 2779
152 Ga0075364_10202908 3300006051 Bacteria 1344
153 Ga0075364_10313467 3300006051 Bacteria 1068
154 Ga0075367_10186424 3300006178 Bacteria 1294
155 Ga0075369_10000244 3300006186 Bacteria 16160
156 Ga0075366_10002077 3300006195 Bacteria 10171
157 Ga0097621_100000958 3300006237 Bacteria 20242
158 Ga0097621_100001810 3300006237 Bacteria 14687
159 Ga0097621_100006784 3300006237 Bacteria 8136
160 Ga0097621_100012717 3300006237 Bacteria 6252
161 Ga0097621_100071759 3300006237 Bacteria 2862
162 Ga0097621_100121962 3300006237 Bacteria 2211
163 Ga0068871_100000297 3300006358 Bacteria 34596
164 Ga0068871_100002111 3300006358 Bacteria 13456
165 Ga0068871_100003523 3300006358 Bacteria 10773
166 Ga0068871_100005274 3300006358 Bacteria 9048
167 Ga0068871_100047471 3300006358 Bacteria 3463
168 Ga0075428_100000083 3300006844 Bacteria 78689
169 Ga0075428_100002437 3300006844 Bacteria 20209
170 Ga0075428_100174036 3300006844 Bacteria 2332
171 Ga0075430_100087096 3300006846 Bacteria 2614
172 Ga0075433_10094711 3300006852 Bacteria 2643
173 Ga0075434_100022878 3300006871 Bacteria 6084
174 Ga0075434_100046636 3300006871 Bacteria 4301
175 Ga0075434_100182534 3300006871 Bacteria 2119
176 Ga0075429_100000480 3300006880 Bacteria 29845
177 Ga0075429_100014547 3300006880 Bacteria 6819
178 Ga0075429_100194254 3300006880 Bacteria 1778
179 Ga0068865_100000059 3300006881 Bacteria 58856
180 Ga0068865_100029476 3300006881 Bacteria 3642
181 Ga0068865_100168293 3300006881 Bacteria 1678
182 Ga0097620_100000149 3300006931 Bacteria 66296
183 Ga0097620_100010619 3300006931 Bacteria 9266
184 Ga0097620_100085814 3300006931 Bacteria 3193
185 Ga0097620_100149681 3300006931 Bacteria 2410
186 Ga0097620_100588132 3300006931 Bacteria 1206
187 Ga0075435_100213877 3300007076 Bacteria 1636
188 Ga0099794_10022580 3300007265 Bacteria 2870
189 Ga0099794_10094931 3300007265 Bacteria 1483
190 Ga0105240_10072714 3300009093 Bacteria 4249
191 Ga0105240_10101898 3300009093 Bacteria 3490
192 Ga0111539_10008973 3300009094 Bacteria 12659
193 Ga0111539_10115230 3300009094 Bacteria 3152
194 Ga0111539_10323621 3300009094 Bacteria 1794
195 Ga0111539_10726972 3300009094 Bacteria 1156
196 Ga0111539_10779714 3300009094 Bacteria 1113
197 Ga0105245_10000075 3300009098 Bacteria 103550
198 Ga0105245_10105546 3300009098 Bacteria 2613
199 Ga0105247_10042082 3300009101 Bacteria 2796
200 Ga0114129_10000210 3300009147 Bacteria 65476
201 Ga0105243_10000622 3300009148 Bacteria 35310
202 Ga0105243_10026709 3300009148 Bacteria 4421
203 Ga0105243_10152337 3300009148 Bacteria 1985
204 Ga0105242_10000407 3300009176 Bacteria 34281
205 Ga0105242_10036748 3300009176 Bacteria 3931
206 Ga0105242_10132658 3300009176 Bacteria 2152
207 Ga0105248_10006699 3300009177 Bacteria 12636
208 Ga0105248_10008148 3300009177 Bacteria 11507
209 Ga0105248_10066361 3300009177 Bacteria 4052
210 Ga0105248_10176223 3300009177 Bacteria 2409
211 Ga0105248_10473760 3300009177 Bacteria 1411
212 Ga0105237_10602050 3300009545 Unclassified 1106
213 Ga0105237_10614202 3300009545 Bacteria 1094
214 Ga0105238_10416490 3300009551 Bacteria 1338
215 Ga0105238_10800333 3300009551 Bacteria 958
216 Ga0105249_10003357 3300009553 Bacteria 13854
217 Ga0105249_10268169 3300009553 Bacteria 1700
218 Ga0105249_10390352 3300009553 Bacteria 1420
219 Ga0105239_10084639 3300010375 Bacteria 3493
220 Ga0105239_10107469 3300010375 Bacteria 3091
221 Ga0105246_10032885 3300011119 Bacteria 3443
222 Ga0105246_10241171 3300011119 Bacteria 1429
223 Ga0157371_10036624 3300013102 Bacteria 3513
224 Ga0157374_10000531 3300013296 Bacteria 34119
225 Ga0157374_10003810 3300013296 Bacteria 12672
226 Ga0157374_10025690 3300013296 Bacteria 5291
227 Ga0157378_10000074 3300013297 Bacteria 90608
228 Ga0157378_10003226 3300013297 Bacteria 14510
229 Ga0157378_10205661 3300013297 Bacteria 1864
230 Ga0163162_10004676 3300013306 Bacteria 13203
231 Ga0163162_10134972 3300013306 Bacteria 2578
232 Ga0163162_10170734 3300013306 Bacteria 2299
233 Ga0163162_10221884 3300013306 Bacteria 2020
234 Ga0163162_10253975 3300013306 Bacteria 1890
235 Ga0163162_11133869 3300013306 Bacteria 886
236 Ga0157375_10000588 3300013308 Bacteria 32287
237 Ga0157375_10011760 3300013308 Bacteria 7740
238 Ga0157375_10033046 3300013308 Bacteria 4912
239 Ga0163163_10011506 3300014325 Bacteria 8032
240 Ga0163163_10239305 3300014325 Bacteria 1865
241 Ga0163163_10422388 3300014325 Bacteria 1392
242 Ga0157380_10038870 3300014326 Bacteria 3697
243 Ga0157380_10080050 3300014326 Bacteria 2670
244 Ga0157380_10088922 3300014326 Bacteria 2543
245 Ga0157380_10090070 3300014326 Bacteria 2529
246 Ga0157380_10511036 3300014326 Bacteria 1169
247 Ga0157377_10089447 3300014745 Bacteria 1815
248 Ga0157379_10007628 3300014968 Bacteria 9363
249 Ga0157379_10060827 3300014968 Bacteria 3377
250 Ga0157379_10066249 3300014968 Bacteria 3228
251 Ga0157376_10008732 3300014969 Bacteria 7324
252 Ga0157376_10026605 3300014969 Bacteria 4574
253 Ga0157376_10028599 3300014969 Bacteria 4432
254 Ga0157376_10035724 3300014969 Bacteria 4021
255 Ga0157376_10050765 3300014969 Bacteria 3443
256 Ga0163161_10408255 3300017792 Bacteria 1090
257 Ga0209258_103740 3300025242 Bacteria 3150
258 Ga0209455_1001023 3300025272 Bacteria 13979
259 Ga0209676_1002357 3300025292 Bacteria 13636
260 Ga0209025_1000071 3300025294 Bacteria 287297
261 Ga0209050_1005110 3300025298 Bacteria 8449
262 Ga0209051_1019092 3300025303 Bacteria 3006
263 Ga0207656_10000672 3300025321 Bacteria 11208
264 Ga0207653_10034424 3300025885 Bacteria 1645
265 Ga0207682_10006178 3300025893 Bacteria 4839
266 Ga0207642_10001278 3300025899 Bacteria 7783
267 Ga0207642_10029270 3300025899 Bacteria 2279
268 Ga0207642_10075211 3300025899 Bacteria 1621
269 Ga0207688_10009150 3300025901 Bacteria 5393
270 Ga0207688_10064130 3300025901 Bacteria 2073
271 Ga0207688_10272587 3300025901 Bacteria 1030
272 Ga0207647_10032757 3300025904 Bacteria 3334
273 Ga0207645_10006565 3300025907 Bacteria 8322
274 Ga0207645_10124019 3300025907 Bacteria 1678
275 Ga0207643_10003687 3300025908 Bacteria 8246
276 Ga0207643_10013580 3300025908 Bacteria 4413
277 Ga0207705_10196637 3300025909 Bacteria 1527
278 Ga0207684_10277844 3300025910 Bacteria 1444
279 Ga0207707_10088722 3300025912 Bacteria 2702
280 Ga0207660_10021706 3300025917 Bacteria 4320
281 Ga0207660_10295093 3300025917 Bacteria 1290
282 Ga0207662_10000166 3300025918 Bacteria 31376
283 Ga0207662_10007962 3300025918 Bacteria 5775
284 Ga0207662_10014684 3300025918 Bacteria 4397
285 Ga0207662_10029653 3300025918 Bacteria 3171
286 Ga0207649_10002695 3300025920 Bacteria 9841
287 Ga0207652_10017190 3300025921 Bacteria 5917
288 Ga0207652_10687349 3300025921 Bacteria 913
289 Ga0207646_10538434 3300025922 Bacteria 1050
290 Ga0207681_10038509 3300025923 Bacteria 3168
291 Ga0207681_10415591 3300025923 Bacteria 1089
292 Ga0207650_10000698 3300025925 Bacteria 26244
293 Ga0207650_10001764 3300025925 Bacteria 15299
294 Ga0207659_10001270 3300025926 Bacteria 15120
295 Ga0207659_10008733 3300025926 Bacteria 6308
296 Ga0207659_10021915 3300025926 Bacteria 4249
297 Ga0207659_10051869 3300025926 Bacteria 2920
298 Ga0207687_10015669 3300025927 Bacteria 4974
299 Ga0207644_10005694 3300025931 Bacteria 8111
300 Ga0207644_10012832 3300025931 Bacteria 5572
301 Ga0207706_10105610 3300025933 Bacteria 2478
302 Ga0207706_10407579 3300025933 Bacteria 1178
303 Ga0207686_10000243 3300025934 Bacteria 41698
304 Ga0207709_10000973 3300025935 Bacteria 21397
305 Ga0207709_10033312 3300025935 Bacteria 3024
306 Ga0207709_10199448 3300025935 Bacteria 1428
307 Ga0207670_10015654 3300025936 Bacteria 4537
308 Ga0207670_10598490 3300025936 Bacteria 905
309 Ga0207704_10000178 3300025938 Bacteria 33463
310 Ga0207704_10076520 3300025938 Bacteria 2144
311 Ga0207691_10000530 3300025940 Bacteria 38079
312 Ga0207691_10092970 3300025940 Bacteria 2701
313 Ga0207691_10438578 3300025940 Bacteria 1112
314 Ga0207711_10125360 3300025941 Bacteria 2297
315 Ga0207711_10190983 3300025941 Bacteria 1866
316 Ga0207689_10000007 3300025942 Bacteria 132362
317 Ga0207689_10088089 3300025942 Bacteria 2550
318 Ga0207689_10107065 3300025942 Bacteria 2298
319 Ga0207661_10000573 3300025944 Bacteria 23479
320 Ga0207661_10021729 3300025944 Bacteria 4814
321 Ga0207679_10001715 3300025945 Bacteria 13650
322 Ga0207667_10013413 3300025949 Bacteria 9376
323 Ga0207667_10465963 3300025949 Bacteria 1283
324 Ga0207651_10000663 3300025960 Bacteria 14679
325 Ga0207651_10005256 3300025960 Bacteria 6624
326 Ga0207651_10140337 3300025960 Bacteria 1865
327 Ga0207712_10013182 3300025961 Bacteria 5298
328 Ga0207712_10054677 3300025961 Bacteria 2805
329 Ga0207668_10057789 3300025972 Bacteria 2708
330 Ga0207640_10005581 3300025981 Bacteria 6861
331 Ga0207640_10008002 3300025981 Bacteria 5841
332 Ga0207658_10045176 3300025986 Bacteria 3210
333 Ga0207677_10000490 3300026023 Bacteria 25685
334 Ga0207677_10001848 3300026023 Bacteria 11189
335 Ga0207677_10022086 3300026023 Bacteria 3903
336 Ga0207677_10050506 3300026023 Bacteria 2814
337 Ga0207677_10491754 3300026023 Bacteria 1059
338 Ga0207703_10008995 3300026035 Bacteria 7865
339 Ga0207703_10038665 3300026035 Bacteria 3810
340 Ga0207703_10045101 3300026035 Bacteria 3545
341 Ga0207639_10312364 3300026041 Bacteria 1393
342 Ga0207708_10000086 3300026075 Bacteria 73314
343 Ga0207708_10012002 3300026075 Bacteria 6455
344 Ga0207708_10355902 3300026075 Bacteria 1202
345 Ga0207708_10463427 3300026075 Bacteria 1057
346 Ga0207702_10588047 3300026078 Bacteria 1091
347 Ga0207641_10008259 3300026088 Bacteria 8602
348 Ga0207641_10043817 3300026088 Bacteria 3760
349 Ga0207641_10127849 3300026088 Bacteria 2277
350 Ga0207648_10000079 3300026089 Bacteria 92044
351 Ga0207648_10012160 3300026089 Bacteria 8064
352 Ga0207648_10031374 3300026089 Bacteria 4698
353 Ga0207648_10048748 3300026089 Bacteria 3708
354 Ga0207676_10010028 3300026095 Bacteria 6740
355 Ga0207676_10018547 3300026095 Bacteria 5060
356 Ga0207676_10053184 3300026095 Bacteria 3169
357 Ga0207676_10204427 3300026095 Bacteria 1747
358 Ga0207674_10021761 3300026116 Bacteria 6900
359 Ga0207675_100000093 3300026118 Bacteria 70343
360 Ga0207675_100020819 3300026118 Bacteria 6114
361 Ga0207675_100166159 3300026118 Bacteria 2107
362 Ga0207683_10001233 3300026121 Bacteria 23243
363 Ga0207683_10014248 3300026121 Bacteria 6773
364 Ga0207683_10449664 3300026121 Bacteria 1188
365 Ga0207698_10012522 3300026142 Bacteria 5556
366 Ga0207698_10138865 3300026142 Bacteria 2090
367 Ga0207698_10245733 3300026142 Bacteria 1634
368 Ga0209967_1003844 3300027364 Bacteria 1983
369 Ga0210000_1000334 3300027462 Bacteria 6726
370 Ga0209995_1000887 3300027471 Bacteria 4641
371 Ga0209999_1002514 3300027543 Bacteria 3239
372 Ga0209982_1006211 3300027552 Bacteria 1735
373 Ga0209983_1012545 3300027665 Bacteria 1740
374 Ga0209971_1006270 3300027682 Bacteria 2814
375 Ga0209974_10004797 3300027876 Bacteria 4796
376 Ga0207428_10000321 3300027907 Bacteria 62664
377 Ga0207428_10016169 3300027907 Bacteria 6426
378 Ga0268266_10072600 3300028379 Bacteria 2985
379 Ga0268266_10151448 3300028379 Bacteria 2091
380 Ga0268265_10001027 3300028380 Bacteria 25172
381 Ga0268264_10001253 3300028381 Bacteria 24204
382 Ga0268264_10051230 3300028381 Bacteria 3439
383 Ga0268264_10422048 3300028381 Bacteria 1286
384 Ga0268264_10498651 3300028381 Bacteria 1187
385 Ga0265319_1008703 3300028563 Bacteria 4413
386 Ga0265334_10000216 3300028573 Bacteria 33128
387 Ga0265334_10001247 3300028573 Bacteria 12415
388 Ga0265318_10001810 3300028577 Bacteria 12136
389 Ga0265318_10063277 3300028577 Bacteria 1377
390 Ga0265338_10072217 3300028800 Bacteria 2947
391 Ga0265330_10005661 3300031235 Bacteria 6213
392 Ga0265330_10011234 3300031235 Bacteria 4204
393 Ga0265332_10000286 3300031238 Bacteria 39704
394 Ga0265332_10002814 3300031238 Bacteria 8644
395 Ga0265332_10003080 3300031238 Bacteria 8138
396 Ga0265328_10002318 3300031239 Bacteria 8579
397 Ga0265328_10008403 3300031239 Bacteria 4259
398 Ga0265320_10012333 3300031240 Bacteria 4983
399 Ga0265320_10020396 3300031240 Bacteria 3595
400 Ga0265325_10005394 3300031241 Bacteria 7900
401 Ga0265329_10010166 3300031242 Bacteria 3471
402 Ga0265329_10026312 3300031242 Bacteria 1917
403 Ga0265340_10044851 3300031247 Bacteria 2162
404 Ga0265340_10137567 3300031247 Bacteria 1118
405 Ga0265339_10014987 3300031249 Bacteria 4660
406 Ga0265331_10000989 3300031250 Bacteria 22372
407 Ga0265331_10003147 3300031250 Bacteria 10771
408 Ga0265316_10056027 3300031344 Bacteria 3081
409 Ga0265316_10057269 3300031344 Bacteria 3039
410 Ga0265313_10000653 3300031595 Bacteria 35705
411 Ga0316575_10008199 3300031665 Bacteria 3800
412 Ga0265314_10013166 3300031711 Bacteria 6699
413 Ga0265314_10014501 3300031711 Bacteria 6298
414 Ga0265314_10091322 3300031711 Bacteria 1982
415 Ga0265342_10013789 3300031712 Bacteria 5397
416 Ga0316576_10048268 3300031727 Bacteria 3087
417 Ga0316578_10006348 3300031728 Bacteria 5826
418 Ga0316578_10089610 3300031728 Bacteria 1836
419 Ga0307405_10569928 3300031731 Bacteria 919
420 Ga0307407_10258208 3300031903 Bacteria 1197
421 Ga0307412_10019973 3300031911 Bacteria 4069
422 Ga0307411_10242315 3300032005 Bacteria 1412
423 Ga0316580_10020278 3300032139 Bacteria 2047
424 Ga0373930_0032229 3300034816 Bacteria 1084
425 Ga0373948_0025674 3300034817 Bacteria 1157
426 Ga0373958_0009443 3300034819 Bacteria 1606
427 Ga0373958_0029303 3300034819 Bacteria 1070
428 Ga0373938_0006799 3300034957 Bacteria 1990
429 Ga0373926_0007307 3300035083 Bacteria 3680
430 Ga0373928_0001979 3300035084 Bacteria 3991
431 Ga0373929_0029612 3300035085 Bacteria 1163
432 Ga0373929_0047254 3300035085 Bacteria 975
433 Ga0373934_0033256 3300035086 Bacteria 2024
434 Ga0373940_0090834 3300035088 Bacteria 914
435 Ga0373949_0007755 3300035090 Bacteria 2352
436 Ga0373932_0010079 3300035112 Bacteria 2281
437 Ga0373939_0006610 3300035114 Bacteria 2798
438 Ga0373939_0057892 3300035114 Bacteria 1224
439 Ga0373941_0041439 3300035115 Bacteria 1425
440 Ga0373953_0026472 3300035117 Bacteria 2222
441 Ga0373954_0000002 3300035118 Bacteria 147478
442 Ga0373960_0011728 3300035121 Bacteria 2164
443 Ga0373943_0007447 3300035170 Bacteria 4918
444 Ga0373946_0003571 3300035171 Bacteria 5518
445 Ga0373942_0031109 3300035207 Bacteria 1409
446 Ga0373962_0108704 3300035242 Bacteria 872
447 Ga0316574_0006602 3300035398 Bacteria 6284
448 Ga0316574_0012451 3300035398 Bacteria 4866
449 Ga0373931_0000134 3300035691 Bacteria 33430
450 Ga0373931_0008755 3300035691 Bacteria 4816
451 Ga0373935_0004026 3300035692 Bacteria 8590
452 Ga0373935_0185238 3300035692 Bacteria 1431
453 Ga0373927_0009261 3300035695 Bacteria 6604
454 Ga0373927_0442782 3300035695 Unclassified 858
455 Ga0373933_0012205 3300035724 Bacteria 4746
456 Ga0373937_0000646 3300036401 Bacteria 30603
457 Ga0373937_0044086 3300036401 Bacteria 4074
458 Ga0395900_0164690 3300037418 Bacteria 2260
459 Ga0395905_0015084 3300037471 Bacteria 7356
460 Ga0395901_0036213 3300038443 Bacteria 5099
461 Ga0400484_36649 3300038725 Bacteria 28505
462 Ga0400484_40677 3300038725 Bacteria 12695
463 Ga0400490_00477 3300038726 Bacteria 3106
464 Ga0400490_19580 3300038726 Bacteria 58285
465 Ga0400490_24481 3300038726 Bacteria 28264
466 Ga0400490_31277 3300038726 Bacteria 27517
467 Ga0400490_40125 3300038726 Bacteria 3496
468 Ga0400490_46324 3300038726 Bacteria 17823
469 Ga0400485_21786 3300038735 Bacteria 5981
470 Ga0400488_01398 3300038741 Bacteria 1368
471 Ga0400488_49896 3300038741 Bacteria 4219
472 Ga0400488_55744 3300038741 Bacteria 7427
473 Ga0400488_61752 3300038741 Bacteria 1871
474 Ga0400486_05222 3300038742 Bacteria 13089
475 Ga0400486_18420 3300038742 Bacteria 1307
476 Ga0400486_22694 3300038742 Bacteria 9443
477 Ga0400486_32535 3300038742 Bacteria 6328
478 Ga0400483_015147 3300039062 Bacteria 11373
479 Ga0400483_098551 3300039062 Bacteria 3037
480 Ga0400483_111606 3300039062 Bacteria 12518
481 Ga0400483_134774 3300039062 Bacteria 3389
482 Ga0400483_188322 3300039062 Bacteria 1492
483 Ga0400483_285866 3300039062 Bacteria 9605
484 Ga0400483_287441 3300039062 Bacteria 31618
485 Ga0400489_48784 3300039093 Bacteria 41831
486 Ga0400489_82601 3300039093 Unclassified 2011
487 Ga0400487_02813 3300039110 Bacteria 3506
488 Ga0400487_35338 3300039110 Bacteria 3871
489 Ga0400487_51851 3300039110 Bacteria 1374
490 Ga0451853_1179271 3300041512 Bacteria 1718
491 Ga0439441_005807 3300042001 Bacteria 1932
492 Ga0439443_000903 3300042003 Bacteria 3006
493 Ga0439435_0001413 3300042436 Bacteria 4425
494 Ga0439444_0000450 3300042437 Bacteria 4594
495 Ga0439460_0000389 3300042461 Bacteria 9321
496 Ga0451577_0000264 3300042876 Bacteria 103723
497 Ga0451577_0039896 3300042876 Bacteria 4217
498 Ga0451577_0159958 3300042876 Bacteria 2028
499 Ga0451577_0452916 3300042876 Bacteria 1165
500 Ga0453683_0000047 3300044673 Bacteria 207763
501 Ga0466966_0027860 3300044684 Bacteria 3683
502 Ga0453684_0000302 3300044712 Bacteria 207763
503 Ga0453684_0006132 3300044712 Bacteria 23146
504 Ga0453684_0010323 3300044712 Bacteria 15988
505 Ga0453684_0020628 3300044712 Bacteria 9919
506 Ga0451576_0000096 3300045051 Bacteria 221078
507 Ga0451576_0000116 3300045051 Bacteria 207763
508 Ga0451576_0001306 3300045051 Bacteria 43171
509 Ga0451576_0011196 3300045051 Bacteria 10219
510 Ga0451576_0125818 3300045051 Bacteria 2670
511 Ga0495603_0005065 3300046455 Bacteria 7874
512 Ga0495580_0001418 3300046472 Bacteria 21063
513 Ga0495580_0290394 3300046472 Bacteria 1115
514 Ga0495582_0046311 3300046473 Bacteria 2395
515 Ga0495639_0003830 3300046475 Bacteria 6459
516 Ga0495607_0000050 3300046501 Bacteria 120052
517 Ga0495666_0016625 3300046526 Bacteria 3664
518 Ga0495665_0219421 3300046531 Bacteria 983
519 Ga0495586_0004075 3300046535 Bacteria 7831
520 Ga0495588_0046550 3300046674 Bacteria 2225
521 Ga0495658_0009927 3300046683 Bacteria 4750
522 Ga0495658_0191690 3300046683 Bacteria 1271
523 Ga0495669_0031846 3300046684 Bacteria 2316
524 Ga0495680_0112473 3300047322 Bacteria 2017
525 Ga0496101_0241706 3300048904 Bacteria 1405
526 Ga0496104_0097099 3300048907 Bacteria 2820
527 Ga0496105_0191914 3300048908 Bacteria 1670
528 Ga0496108_0001128 3300048911 Bacteria 20893
529 Ga0496108_0333104 3300048911 Bacteria 1324
530 Ga0496109_0010127 3300048912 Bacteria 8044
531 Ga0496110_0001483 3300048913 Bacteria 17008
532 Ga0496112_0082105 3300048915 Bacteria 3188
533 Ga0496114_0086267 3300048917 Bacteria 2660
534 Ga0496116_0062957 3300048919 Bacteria 2392
535 Ga0496117_0054133 3300048920 Bacteria 2813
536 Ga0496118_0055775 3300048921 Bacteria 2977
537 Ga0496118_0084706 3300048921 Bacteria 2210
538 Ga0496119_0078705 3300048922 Bacteria 1906
539 Ga0496119_0118119 3300048922 Bacteria 1461
540 Ga0496120_0004722 3300048923 Bacteria 11219
541 Ga0496121_0002222 3300048924 Bacteria 30310
542 Ga0496121_0028177 3300048924 Bacteria 5235
543 Ga0496121_0114102 3300048924 Bacteria 2054
544 Ga0496122_0001897 3300048925 Bacteria 31637
545 Ga0496123_0016201 3300048926 Bacteria 6068
546 Ga0496124_0000088 3300048927 Bacteria 194644
547 Ga0496125_0000096 3300048928 Bacteria 205618
548 Ga0501298_006808 3300049521 Bacteria 1881
549 Ga0501032_0001373 3300049569 Bacteria 19318
550 Ga0501033_0012697 3300049570 Bacteria 6423
551 Ga0501034_0000641 3300049571 Bacteria 54300
552 Ga0501034_0020598 3300049571 Bacteria 6735
553 Ga0501034_0119887 3300049571 Bacteria 2617
554 Ga0501036_0049516 3300049572 Bacteria 3557
555 Ga0501037_0000474 3300049573 Bacteria 32555
556 Ga0501038_0008209 3300049574 Bacteria 9604
557 Ga0501038_0188827 3300049574 Bacteria 1659
558 Ga0501039_0013197 3300049575 Bacteria 6314
559 Ga0501039_0025347 3300049575 Bacteria 4555
560 Ga0501040_0003365 3300049576 Bacteria 10322
561 Ga0501040_0010917 3300049576 Bacteria 5940
562 Ga0501040_0055784 3300049576 Bacteria 2710
563 Ga0501041_0021683 3300049577 Bacteria 3847
564 Ga0501042_0012886 3300049578 Bacteria 5678
565 Ga0501043_0014893 3300049579 Bacteria 6087
566 Ga0501043_0102854 3300049579 Bacteria 2245
567 Ga0501046_0012703 3300049580 Bacteria 7161
568 Ga0501047_0010044 3300049581 Bacteria 8946
569 Ga0501048_0042413 3300049582 Bacteria 3258
570 Ga0501048_0063677 3300049582 Bacteria 2607
571 Ga0501067_0187117 3300049583 Bacteria 1153
572 Ga0501068_0000140 3300049584 Bacteria 33214
573 Ga0501068_0002905 3300049584 Bacteria 9121
574 Ga0501072_0005894 3300049588 Bacteria 9335
575 Ga0501072_0342115 3300049588 Bacteria 1188
576 Ga0501073_0014507 3300049589 Bacteria 5726
577 Ga0501075_0281701 3300049591 Bacteria 1267
578 Ga0501257_066802 3300049686 Bacteria 914
579 Ga0501079_0537908 3300049741 Bacteria 919
580 Ga0501080_0149995 3300049742 Bacteria 2155
581 Ga0501080_0291692 3300049742 Bacteria 1481
582 Ga0501035_0015367 3300049822 Bacteria 7064
583 Ga0501035_0029110 3300049822 Bacteria 5037
584 Ga0501035_0450577 3300049822 Bacteria 1064
585 Ga0501044_0000231 3300049823 Bacteria 70134
586 Ga0501044_0009991 3300049823 Bacteria 10310
587 Ga0501044_0023765 3300049823 Bacteria 6517
588 Ga0501045_0003419 3300049824 Bacteria 10863
589 nmdc:mga00v17_22766_c1 3300050491 Bacteria 3619
590 nmdc:mga00v17_298749_c1 3300050491 Bacteria 1046
591 nmdc:mga00v17_304151_c1 3300050491 Bacteria 1036
592 nmdc:mga00v17_5593_c1 3300050491 Bacteria 6626
593 nmdc:mga00v17_8189_c1 3300050491 Bacteria 5619
594 nmdc:mga0k408_2784_c1 3300050493 Bacteria 9292
595 nmdc:mga0k408_3933_c1 3300050493 Bacteria 7880
596 nmdc:mga06z11_281558_c1 3300050494 Bacteria 985
597 nmdc:mga05p37_132_c1 3300050507 Bacteria 68371
598 nmdc:mga05p37_402813_c1 3300050507 Bacteria 1597
599 nmdc:mga09592_187364_c1 3300050508 Bacteria 1791
600 nmdc:mga09592_418_c1 3300050508 Bacteria 31192
601 nmdc:mga0qj67_175257_c1 3300050509 Bacteria 1741
602 nmdc:mga06r32_611121_c1 3300050510 Bacteria 1060
603 nmdc:mga08y16_10406_c1 3300050511 Bacteria 9757
604 nmdc:mga08y16_307573_c1 3300050511 Bacteria 1633
605 nmdc:mga08y16_373598_c1 3300050511 Bacteria 1462
606 nmdc:mga08y16_730976_c1 3300050511 Bacteria 987
607 nmdc:mga0n895_21008_c1 3300050512 Bacteria 6099
608 nmdc:mga0n895_46935_c1 3300050512 Bacteria 4222
609 nmdc:mga08x19_55_c1 3300050514 Bacteria 120851
610 nmdc:mga0a205_34161_c1 3300050515 Bacteria 4879
611 nmdc:mga0a205_561358_c1 3300050515 Bacteria 996
612 nmdc:mga0sz30_18417_c1 3300050516 Bacteria 2794
613 Ga0466962_0069043 3300061719 Bacteria 1688
614 Ga0530510_0041090 3300061734 Bacteria 3339

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035085 Ga0373929_0047254 Ga0373929_0047254_59_721 215
2 3300032139 Ga0316580_10020278 Ga0316580_100202782 253
3 3300031727 Ga0316576_10048268 Ga0316576_100482683 258
4 iso_pu_bacteria 2690315857 2691331528 259
5 iso_pu_bacteria 2919534386 2919535098 259
6 3300038726 Ga0400490_00477 Ga0400490_00477_1410_2249 260
7 3300031247 Ga0265340_10137567 Ga0265340_101375672 261
8 3300031711 Ga0265314_10091322 Ga0265314_100913223 261
9 3300038726 Ga0400490_40125 Ga0400490_40125_1478_2317 262
10 3300039062 Ga0400483_098551 Ga0400483_098551_1756_2595 262
11 3300039093 Ga0400489_82601 Ga0400489_82601_818_1657 262
12 3300005471 Ga0070698_100078792 Ga0070698_1000787922 263
13 3300006871 Ga0075434_100022878 Ga0075434_1000228783 263
14 3300050512 nmdc:mga0n895_21008_c1 nmdc:mga0n895_21008_c1_2730_3602 263
15 3300031903 Ga0307407_10258208 Ga0307407_102582081 264
16 3300041512 Ga0451853_1179271 Ga0451853_1179271_331_1155 264
17 3300049686 Ga0501257_066802 Ga0501257_066802_35_862 264
18 3300003203 JGI25406J46586_10011860 JGI25406J46586_100118605 265
19 3300005330 Ga0070690_100074421 Ga0070690_1000744213 265
20 3300005334 Ga0068869_100449209 Ga0068869_1004492092 265
21 3300005441 Ga0070700_100121428 Ga0070700_1001214282 265
22 3300005444 Ga0070694_100078873 Ga0070694_1000788732 265
23 3300005536 Ga0070697_100043101 Ga0070697_1000431014 265
24 3300005615 Ga0070702_100162023 Ga0070702_1001620231 265
25 3300005844 Ga0068862_100028276 Ga0068862_1000282763 265
26 3300005985 Ga0081539_10004364 Ga0081539_100043648 265
27 3300006846 Ga0075430_100087096 Ga0075430_1000870964 265
28 3300007076 Ga0075435_100213877 Ga0075435_1002138772 265
29 3300009094 Ga0111539_10323621 Ga0111539_103236212 265
30 3300014326 Ga0157380_10080050 Ga0157380_100800502 265
31 3300014745 Ga0157377_10089447 Ga0157377_100894472 265
32 3300025926 Ga0207659_10051869 Ga0207659_100518693 265
33 3300025936 Ga0207670_10598490 Ga0207670_105984901 265
34 3300025942 Ga0207689_10088089 Ga0207689_100880893 265
35 3300026075 Ga0207708_10355902 Ga0207708_103559022 265
36 3300031731 Ga0307405_10569928 Ga0307405_105699281 265
37 3300034817 Ga0373948_0025674 Ga0373948_0025674_81_890 265
38 3300034819 Ga0373958_0029303 Ga0373958_0029303_64_873 265
39 3300034957 Ga0373938_0006799 Ga0373938_0006799_286_1095 265
40 3300035084 Ga0373928_0001979 Ga0373928_0001979_949_1758 265
41 3300035085 Ga0373929_0029612 Ga0373929_0029612_53_862 265
42 3300035088 Ga0373940_0090834 Ga0373940_0090834_51_860 265
43 3300035090 Ga0373949_0007755 Ga0373949_0007755_416_1228 265
44 3300035112 Ga0373932_0010079 Ga0373932_0010079_450_1259 265
45 3300035114 Ga0373939_0006610 Ga0373939_0006610_1021_1830 265
46 3300035121 Ga0373960_0011728 Ga0373960_0011728_517_1326 265
47 3300035207 Ga0373942_0031109 Ga0373942_0031109_587_1396 265
48 3300035242 Ga0373962_0108704 Ga0373962_0108704_49_858 265
49 3300035691 Ga0373931_0000134 Ga0373931_0000134_29908_30717 265
50 3300038741 Ga0400488_01398 Ga0400488_01398_22_861 265
51 3300038741 Ga0400488_61752 Ga0400488_61752_670_1509 265
52 3300039062 Ga0400483_188322 Ga0400483_188322_126_965 265
53 3300042001 Ga0439441_005807 Ga0439441_005807_107_919 265
54 3300045051 Ga0451576_0125818 Ga0451576_0125818_457_1266 265
55 3300049521 Ga0501298_006808 Ga0501298_006808_485_1297 265
56 3300049575 Ga0501039_0013197 Ga0501039_0013197_3354_4166 265
57 3300049576 Ga0501040_0010917 Ga0501040_0010917_5081_5893 265
58 3300049577 Ga0501041_0021683 Ga0501041_0021683_1230_2042 265
59 3300049582 Ga0501048_0042413 Ga0501048_0042413_1921_2733 265
60 3300049588 Ga0501072_0342115 Ga0501072_0342115_52_864 265
61 3300049741 Ga0501079_0537908 Ga0501079_0537908_40_852 265
62 3300050507 nmdc:mga05p37_402813_c1 nmdc:mga05p37_402813_c1_83_892 265
63 3300050511 nmdc:mga08y16_730976_c1 nmdc:mga08y16_730976_c1_61_873 265
64 3300050514 nmdc:mga08x19_55_c1 nmdc:mga08x19_55_c1_61029_61841 265
65 3300050515 nmdc:mga0a205_561358_c1 nmdc:mga0a205_561358_c1_150_959 265
66 3300061734 Ga0530510_0041090 Ga0530510_0041090_2296_3108 265
67 3300002070 JGI24750J21931_1007051 JGI24750J21931_10070512 266
68 3300003763 Ga0055529_1001538 Ga0055529_10015388 266
69 3300005329 Ga0070683_100097814 Ga0070683_1000978142 266
70 3300005330 Ga0070690_100000082 Ga0070690_10000008236 266
71 3300005334 Ga0068869_100000044 Ga0068869_10000004431 266
72 3300005336 Ga0070680_100034292 Ga0070680_1000342924 266
73 3300005337 Ga0070682_100007785 Ga0070682_1000077852 266
74 3300005338 Ga0068868_100000458 Ga0068868_10000045828 266
75 3300005340 Ga0070689_100007655 Ga0070689_10000765510 266
76 3300005341 Ga0070691_10000573 Ga0070691_100005736 266
77 3300005343 Ga0070687_100000034 Ga0070687_10000003424 266
78 3300005343 Ga0070687_100009500 Ga0070687_1000095003 266
79 3300005345 Ga0070692_10025480 Ga0070692_100254802 266
80 3300005406 Ga0070703_10004765 Ga0070703_100047656 266
81 3300005438 Ga0070701_10000346 Ga0070701_1000034614 266
82 3300005440 Ga0070705_100000030 Ga0070705_10000003063 266
83 3300005441 Ga0070700_100000552 Ga0070700_1000005526 266
84 3300005444 Ga0070694_100000706 Ga0070694_10000070617 266
85 3300005458 Ga0070681_10071328 Ga0070681_100713283 266
86 3300005459 Ga0068867_100000032 Ga0068867_10000003234 266
87 3300005518 Ga0070699_100111502 Ga0070699_1001115024 266
88 3300005530 Ga0070679_100003506 Ga0070679_10000350611 266
89 3300005535 Ga0070684_100075658 Ga0070684_1000756583 266
90 3300005539 Ga0068853_100012831 Ga0068853_1000128313 266
91 3300005543 Ga0070672_100459528 Ga0070672_1004595282 266
92 3300005544 Ga0070686_100001608 Ga0070686_1000016084 266
93 3300005544 Ga0070686_100005201 Ga0070686_1000052013 266
94 3300005545 Ga0070695_100000514 Ga0070695_1000005145 266
95 3300005545 Ga0070695_100039124 Ga0070695_1000391244 266
96 3300005546 Ga0070696_100000089 Ga0070696_10000008914 266
97 3300005547 Ga0070693_100000100 Ga0070693_10000010010 266
98 3300005549 Ga0070704_100001681 Ga0070704_1000016816 266
99 3300005563 Ga0068855_100000695 Ga0068855_10000069535 266
100 3300005578 Ga0068854_100055460 Ga0068854_1000554602 266
101 3300005614 Ga0068856_100062178 Ga0068856_1000621786 266
102 3300005615 Ga0070702_100000001 Ga0070702_10000000156 266
103 3300005616 Ga0068852_100123819 Ga0068852_1001238192 266
104 3300005617 Ga0068859_100000149 Ga0068859_10000014961 266
105 3300005617 Ga0068859_100588132 Ga0068859_1005881322 266
106 3300005718 Ga0068866_10000277 Ga0068866_100002776 266
107 3300005719 Ga0068861_100000057 Ga0068861_10000005731 266
108 3300005841 Ga0068863_100260396 Ga0068863_1002603962 266
109 3300005842 Ga0068858_100000289 Ga0068858_10000028935 266
110 3300005843 Ga0068860_100001090 Ga0068860_10000109033 266
111 3300005844 Ga0068862_100000409 Ga0068862_1000004092 266
112 3300006237 Ga0097621_100001810 Ga0097621_1000018107 266
113 3300006237 Ga0097621_100012717 Ga0097621_1000127175 266
114 3300006358 Ga0068871_100002111 Ga0068871_10000211114 266
115 3300006358 Ga0068871_100003523 Ga0068871_10000352313 266
116 3300006844 Ga0075428_100000083 Ga0075428_10000008335 266
117 3300006871 Ga0075434_100182534 Ga0075434_1001825342 266
118 3300006880 Ga0075429_100000480 Ga0075429_10000048031 266
119 3300006881 Ga0068865_100000059 Ga0068865_10000005954 266
120 3300006931 Ga0097620_100000149 Ga0097620_10000014914 266
121 3300006931 Ga0097620_100588132 Ga0097620_1005881322 266
122 3300007265 Ga0099794_10022580 Ga0099794_100225802 266
123 3300007265 Ga0099794_10094931 Ga0099794_100949312 266
124 3300009094 Ga0111539_10115230 Ga0111539_101152304 266
125 3300009094 Ga0111539_10779714 Ga0111539_107797141 266
126 3300009098 Ga0105245_10000075 Ga0105245_1000007535 266
127 3300009147 Ga0114129_10000210 Ga0114129_1000021017 266
128 3300009148 Ga0105243_10000622 Ga0105243_100006226 266
129 3300009176 Ga0105242_10000407 Ga0105242_100004076 266
130 3300009177 Ga0105248_10176223 Ga0105248_101762234 266
131 3300009545 Ga0105237_10602050 Ga0105237_106020502 266
132 3300009545 Ga0105237_10614202 Ga0105237_106142021 266
133 3300009551 Ga0105238_10800333 Ga0105238_108003331 266
134 3300009553 Ga0105249_10003357 Ga0105249_100033574 266
135 3300010375 Ga0105239_10084639 Ga0105239_100846394 266
136 3300011119 Ga0105246_10241171 Ga0105246_102411711 266
137 3300013297 Ga0157378_10000074 Ga0157378_1000007460 266
138 3300013306 Ga0163162_10221884 Ga0163162_102218841 266
139 3300014326 Ga0157380_10038870 Ga0157380_100388702 266
140 3300014968 Ga0157379_10060827 Ga0157379_100608272 266
141 3300014969 Ga0157376_10026605 Ga0157376_100266054 266
142 3300014969 Ga0157376_10035724 Ga0157376_100357242 266
143 3300025242 Ga0209258_103740 Ga0209258_1037402 266
144 3300025272 Ga0209455_1001023 Ga0209455_10010237 266
145 3300025885 Ga0207653_10034424 Ga0207653_100344241 266
146 3300025899 Ga0207642_10001278 Ga0207642_100012789 266
147 3300025901 Ga0207688_10064130 Ga0207688_100641302 266
148 3300025904 Ga0207647_10032757 Ga0207647_100327574 266
149 3300025908 Ga0207643_10003687 Ga0207643_100036872 266
150 3300025912 Ga0207707_10088722 Ga0207707_100887222 266
151 3300025917 Ga0207660_10021706 Ga0207660_100217062 266
152 3300025918 Ga0207662_10000166 Ga0207662_1000016614 266
153 3300025918 Ga0207662_10014684 Ga0207662_100146843 266
154 3300025921 Ga0207652_10017190 Ga0207652_100171904 266
155 3300025927 Ga0207687_10015669 Ga0207687_100156693 266
156 3300025934 Ga0207686_10000243 Ga0207686_1000024344 266
157 3300025935 Ga0207709_10000973 Ga0207709_1000097314 266
158 3300025936 Ga0207670_10015654 Ga0207670_100156542 266
159 3300025938 Ga0207704_10000178 Ga0207704_1000017814 266
160 3300025940 Ga0207691_10438578 Ga0207691_104385781 266
161 3300025941 Ga0207711_10125360 Ga0207711_101253604 266
162 3300025942 Ga0207689_10000007 Ga0207689_10000007105 266
163 3300025944 Ga0207661_10021729 Ga0207661_100217293 266
164 3300025949 Ga0207667_10013413 Ga0207667_100134139 266
165 3300025961 Ga0207712_10013182 Ga0207712_100131826 266
166 3300025981 Ga0207640_10005581 Ga0207640_100055817 266
167 3300026023 Ga0207677_10001848 Ga0207677_1000184811 266
168 3300026035 Ga0207703_10045101 Ga0207703_100451014 266
169 3300026041 Ga0207639_10312364 Ga0207639_103123642 266
170 3300026075 Ga0207708_10000086 Ga0207708_1000008639 266
171 3300026089 Ga0207648_10000079 Ga0207648_1000007934 266
172 3300026118 Ga0207675_100000093 Ga0207675_10000009336 266
173 3300026142 Ga0207698_10138865 Ga0207698_101388652 266
174 3300027907 Ga0207428_10000321 Ga0207428_1000032137 266
175 3300028380 Ga0268265_10001027 Ga0268265_100010278 266
176 3300028381 Ga0268264_10001253 Ga0268264_1000125322 266
177 3300031665 Ga0316575_10008199 Ga0316575_100081996 266
178 3300032005 Ga0307411_10242315 Ga0307411_102423152 266
179 3300034816 Ga0373930_0032229 Ga0373930_0032229_81_893 266
180 3300034819 Ga0373958_0009443 Ga0373958_0009443_756_1568 266
181 3300035083 Ga0373926_0007307 Ga0373926_0007307_2749_3564 266
182 3300035114 Ga0373939_0057892 Ga0373939_0057892_305_1117 266
183 3300035115 Ga0373941_0041439 Ga0373941_0041439_375_1187 266
184 3300035170 Ga0373943_0007447 Ga0373943_0007447_540_1355 266
185 3300035171 Ga0373946_0003571 Ga0373946_0003571_2236_3051 266
186 3300035398 Ga0316574_0012451 Ga0316574_0012451_2971_3786 266
187 3300035691 Ga0373931_0008755 Ga0373931_0008755_1037_1849 266
188 3300035692 Ga0373935_0004026 Ga0373935_0004026_4925_5740 266
189 3300035692 Ga0373935_0185238 Ga0373935_0185238_153_965 266
190 3300035695 Ga0373927_0009261 Ga0373927_0009261_3100_3915 266
191 3300038726 Ga0400490_24481 Ga0400490_24481_4307_5125 266
192 3300042876 Ga0451577_0452916 Ga0451577_0452916_280_1092 266
193 3300045051 Ga0451576_0001306 Ga0451576_0001306_25011_25823 266
194 3300045051 Ga0451576_0011196 Ga0451576_0011196_5923_6735 266
195 3300046455 Ga0495603_0005065 Ga0495603_0005065_4426_5241 266
196 3300046472 Ga0495580_0001418 Ga0495580_0001418_3172_3987 266
197 3300046473 Ga0495582_0046311 Ga0495582_0046311_539_1354 266
198 3300046475 Ga0495639_0003830 Ga0495639_0003830_818_1633 266
199 3300046526 Ga0495666_0016625 Ga0495666_0016625_603_1418 266
200 3300046531 Ga0495665_0219421 Ga0495665_0219421_127_942 266
201 3300046535 Ga0495586_0004075 Ga0495586_0004075_3753_4568 266
202 3300046674 Ga0495588_0046550 Ga0495588_0046550_633_1448 266
203 3300046683 Ga0495658_0009927 Ga0495658_0009927_3302_4117 266
204 3300048924 Ga0496121_0028177 Ga0496121_0028177_2984_3799 266
205 3300048927 Ga0496124_0000088 Ga0496124_0000088_143892_144707 266
206 3300049591 Ga0501075_0281701 Ga0501075_0281701_289_1104 266
207 3300049822 Ga0501035_0450577 Ga0501035_0450577_146_961 266
208 3300050507 nmdc:mga05p37_132_c1 nmdc:mga05p37_132_c1_22532_23344 266
209 3300050508 nmdc:mga09592_418_c1 nmdc:mga09592_418_c1_18741_19553 266
210 3300050510 nmdc:mga06r32_611121_c1 nmdc:mga06r32_611121_c1_231_1046 266
211 3300050511 nmdc:mga08y16_307573_c1 nmdc:mga08y16_307573_c1_10_822 266
212 3300050511 nmdc:mga08y16_373598_c1 nmdc:mga08y16_373598_c1_618_1430 266
213 iso_pu_bacteria 2547132512 2548847102 266
214 iso_pu_bacteria 2857576091 2857577853 266
215 3300005353 Ga0070669_100099653 Ga0070669_1000996532 267
216 3300005617 Ga0068859_100149686 Ga0068859_1001496863 267
217 3300005618 Ga0068864_100232421 Ga0068864_1002324213 267
218 3300005843 Ga0068860_100447918 Ga0068860_1004479182 267
219 3300006931 Ga0097620_100149681 Ga0097620_1001496813 267
220 3300013306 Ga0163162_10253975 Ga0163162_102539752 267
221 3300025961 Ga0207712_10054677 Ga0207712_100546772 267
222 3300026075 Ga0207708_10463427 Ga0207708_104634272 267
223 3300026095 Ga0207676_10204427 Ga0207676_102044272 267
224 3300026118 Ga0207675_100166159 Ga0207675_1001661592 267
225 3300028381 Ga0268264_10422048 Ga0268264_104220482 267
226 3300035086 Ga0373934_0033256 Ga0373934_0033256_300_1118 267
227 3300035117 Ga0373953_0026472 Ga0373953_0026472_60_878 267
228 3300035118 Ga0373954_0000002 Ga0373954_0000002_86104_86922 267
229 3300035724 Ga0373933_0012205 Ga0373933_0012205_3342_4160 267
230 3300036401 Ga0373937_0000646 Ga0373937_0000646_23637_24455 267
231 3300038741 Ga0400488_49896 Ga0400488_49896_2494_3318 267
232 3300038742 Ga0400486_05222 Ga0400486_05222_11177_12001 267
233 3300039062 Ga0400483_134774 Ga0400483_134774_2224_3048 267
234 3300039062 Ga0400483_287441 Ga0400483_287441_1244_2068 267
235 3300039110 Ga0400487_02813 Ga0400487_02813_2280_3104 267
236 3300042003 Ga0439443_000903 Ga0439443_000903_647_1465 267
237 3300042436 Ga0439435_0001413 Ga0439435_0001413_1713_2531 267
238 3300042437 Ga0439444_0000450 Ga0439444_0000450_661_1479 267
239 3300042461 Ga0439460_0000389 Ga0439460_0000389_7977_8795 267
240 3300047322 Ga0495680_0112473 Ga0495680_0112473_490_1302 267
241 3300049576 Ga0501040_0055784 Ga0501040_0055784_1804_2622 267
242 3300028573 Ga0265334_10000216 Ga0265334_1000021611 268
243 3300031728 Ga0316578_10089610 Ga0316578_100896102 268
244 3300046683 Ga0495658_0191690 Ga0495658_0191690_263_1078 268
245 iso_pu_bacteria 2599185292 2599904657 268
246 iso_pu_bacteria 2643221569 2643861208 268
247 iso_pu_bacteria 2643221594 2643983326 268
248 iso_pu_bacteria 2643221621 2644124560 268
249 iso_pu_bacteria 2808606395 2809032756 268
250 iso_pu_bacteria 2857537821 2857540568 268
251 iso_pu_bacteria 2858950400 2858951362 268
252 iso_pu_bacteria 2941479691 2941485928 268
253 3300005842 Ga0068858_100712041 Ga0068858_1007120411 269
254 3300005844 Ga0068862_100239497 Ga0068862_1002394972 269
255 3300009177 Ga0105248_10473760 Ga0105248_104737602 269
256 3300013102 Ga0157371_10036624 Ga0157371_100366241 269
257 3300025292 Ga0209676_1002357 Ga0209676_100235710 269
258 3300025298 Ga0209050_1005110 Ga0209050_10051101 269
259 3300025303 Ga0209051_1019092 Ga0209051_10190921 269
260 3300025923 Ga0207681_10415591 Ga0207681_104155912 269
261 3300028563 Ga0265319_1008703 Ga0265319_10087034 269
262 3300028573 Ga0265334_10001247 Ga0265334_100012476 269
263 3300028800 Ga0265338_10072217 Ga0265338_100722172 269
264 3300031235 Ga0265330_10005661 Ga0265330_100056614 269
265 3300031238 Ga0265332_10002814 Ga0265332_100028146 269
266 3300031239 Ga0265328_10008403 Ga0265328_100084034 269
267 3300031240 Ga0265320_10020396 Ga0265320_100203965 269
268 3300031241 Ga0265325_10005394 Ga0265325_100053947 269
269 3300031242 Ga0265329_10026312 Ga0265329_100263123 269
270 3300031247 Ga0265340_10044851 Ga0265340_100448513 269
271 3300031249 Ga0265339_10014987 Ga0265339_100149874 269
272 3300031250 Ga0265331_10003147 Ga0265331_100031475 269
273 3300031344 Ga0265316_10057269 Ga0265316_100572694 269
274 3300031595 Ga0265313_10000653 Ga0265313_1000065326 269
275 3300031711 Ga0265314_10013166 Ga0265314_100131664 269
276 3300031728 Ga0316578_10006348 Ga0316578_100063487 269
277 3300031911 Ga0307412_10019973 Ga0307412_100199735 269
278 3300035398 Ga0316574_0006602 Ga0316574_0006602_3278_4147 269
279 3300038725 Ga0400484_40677 Ga0400484_40677_9560_10399 269
280 3300044712 Ga0453684_0010323 Ga0453684_0010323_2019_2849 269
281 3300048904 Ga0496101_0241706 Ga0496101_0241706_102_935 269
282 3300048919 Ga0496116_0062957 Ga0496116_0062957_1074_1907 269
283 3300048920 Ga0496117_0054133 Ga0496117_0054133_1888_2721 269
284 3300048921 Ga0496118_0055775 Ga0496118_0055775_97_930 269
285 3300048921 Ga0496118_0084706 Ga0496118_0084706_1315_2148 269
286 3300048922 Ga0496119_0078705 Ga0496119_0078705_976_1809 269
287 3300048922 Ga0496119_0118119 Ga0496119_0118119_149_982 269
288 3300048923 Ga0496120_0004722 Ga0496120_0004722_10182_11015 269
289 3300048924 Ga0496121_0002222 Ga0496121_0002222_21530_22363 269
290 3300048924 Ga0496121_0114102 Ga0496121_0114102_123_956 269
291 3300048925 Ga0496122_0001897 Ga0496122_0001897_751_1584 269
292 3300048926 Ga0496123_0016201 Ga0496123_0016201_5026_5859 269
293 3300048928 Ga0496125_0000096 Ga0496125_0000096_7223_8056 269
294 3300049574 Ga0501038_0188827 Ga0501038_0188827_279_1109 269
295 3300049581 Ga0501047_0010044 Ga0501047_0010044_1092_1949 269
296 3300049822 Ga0501035_0015367 Ga0501035_0015367_4289_5119 269
297 3300049822 Ga0501035_0029110 Ga0501035_0029110_3327_4184 269
298 3300049823 Ga0501044_0000231 Ga0501044_0000231_55090_55920 269
299 3300049823 Ga0501044_0009991 Ga0501044_0009991_1865_2722 269
300 iso_pu_bacteria 2855730933 2855735102 269
301 iso_pu_bacteria 2855767633 2855770886 269
302 iso_pu_bacteria 2881412998 2881418275 269
303 iso_pu_bacteria 2887375801 2887375846 269
304 3300001976 JGI24752J21851_1011447 JGI24752J21851_10114472 270
305 3300003187 JGI25151J46595_10000606 JGI25151J46595_1000060613 270
306 3300005327 Ga0070658_10654406 Ga0070658_106544061 270
307 3300005330 Ga0070690_100047924 Ga0070690_1000479242 270
308 3300005330 Ga0070690_100154835 Ga0070690_1001548352 270
309 3300005331 Ga0070670_100001931 Ga0070670_10000193114 270
310 3300005331 Ga0070670_100007759 Ga0070670_1000077599 270
311 3300005333 Ga0070677_10186538 Ga0070677_101865382 270
312 3300005334 Ga0068869_100077260 Ga0068869_1000772602 270
313 3300005335 Ga0070666_10036676 Ga0070666_100366762 270
314 3300005335 Ga0070666_10037618 Ga0070666_100376183 270
315 3300005336 Ga0070680_100244994 Ga0070680_1002449942 270
316 3300005336 Ga0070680_100328881 Ga0070680_1003288812 270
317 3300005338 Ga0068868_100001015 Ga0068868_10000101518 270
318 3300005338 Ga0068868_100070416 Ga0068868_1000704161 270
319 3300005340 Ga0070689_100232583 Ga0070689_1002325831 270
320 3300005343 Ga0070687_100003898 Ga0070687_1000038983 270
321 3300005343 Ga0070687_100073346 Ga0070687_1000733462 270
322 3300005344 Ga0070661_100000366 Ga0070661_10000036626 270
323 3300005345 Ga0070692_10334654 Ga0070692_103346541 270
324 3300005347 Ga0070668_100050037 Ga0070668_1000500373 270
325 3300005347 Ga0070668_100091489 Ga0070668_1000914894 270
326 3300005353 Ga0070669_100088306 Ga0070669_1000883062 270
327 3300005353 Ga0070669_100333472 Ga0070669_1003334722 270
328 3300005354 Ga0070675_100000296 Ga0070675_10000029618 270
329 3300005354 Ga0070675_100042937 Ga0070675_1000429375 270
330 3300005354 Ga0070675_100100791 Ga0070675_1001007912 270
331 3300005354 Ga0070675_100101804 Ga0070675_1001018042 270
332 3300005354 Ga0070675_100134168 Ga0070675_1001341682 270
333 3300005355 Ga0070671_100001203 Ga0070671_1000012032 270
334 3300005355 Ga0070671_100080861 Ga0070671_1000808612 270
335 3300005356 Ga0070674_100030818 Ga0070674_1000308182 270
336 3300005364 Ga0070673_100000095 Ga0070673_10000009521 270
337 3300005364 Ga0070673_100016520 Ga0070673_1000165205 270
338 3300005364 Ga0070673_100037994 Ga0070673_1000379942 270
339 3300005367 Ga0070667_100275420 Ga0070667_1002754202 270
340 3300005439 Ga0070711_100096291 Ga0070711_1000962913 270
341 3300005445 Ga0070708_100096758 Ga0070708_1000967582 270
342 3300005456 Ga0070678_100000184 Ga0070678_10000018425 270
343 3300005456 Ga0070678_100027655 Ga0070678_1000276551 270
344 3300005456 Ga0070678_100100168 Ga0070678_1001001684 270
345 3300005457 Ga0070662_100129552 Ga0070662_1001295522 270
346 3300005457 Ga0070662_100472968 Ga0070662_1004729681 270
347 3300005458 Ga0070681_10054445 Ga0070681_100544452 270
348 3300005459 Ga0068867_100002439 Ga0068867_1000024396 270
349 3300005459 Ga0068867_100177219 Ga0068867_1001772191 270
350 3300005459 Ga0068867_100236075 Ga0068867_1002360752 270
351 3300005466 Ga0070685_10008470 Ga0070685_100084702 270
352 3300005467 Ga0070706_100083857 Ga0070706_1000838573 270
353 3300005467 Ga0070706_100124223 Ga0070706_1001242231 270
354 3300005468 Ga0070707_100063295 Ga0070707_1000632952 270
355 3300005518 Ga0070699_100044821 Ga0070699_1000448212 270
356 3300005530 Ga0070679_100268692 Ga0070679_1002686922 270
357 3300005530 Ga0070679_100365161 Ga0070679_1003651612 270
358 3300005536 Ga0070697_100084037 Ga0070697_1000840372 270
359 3300005543 Ga0070672_100000230 Ga0070672_10000023017 270
360 3300005545 Ga0070695_100059250 Ga0070695_1000592503 270
361 3300005548 Ga0070665_100056461 Ga0070665_1000564614 270
362 3300005548 Ga0070665_100068180 Ga0070665_1000681802 270
363 3300005548 Ga0070665_100527633 Ga0070665_1005276332 270
364 3300005549 Ga0070704_100005808 Ga0070704_1000058083 270
365 3300005549 Ga0070704_100014934 Ga0070704_1000149344 270
366 3300005564 Ga0070664_100000172 Ga0070664_10000017223 270
367 3300005577 Ga0068857_100274255 Ga0068857_1002742552 270
368 3300005578 Ga0068854_100002365 Ga0068854_1000023656 270
369 3300005614 Ga0068856_100014214 Ga0068856_1000142148 270
370 3300005615 Ga0070702_100007611 Ga0070702_1000076114 270
371 3300005616 Ga0068852_100001180 Ga0068852_10000118016 270
372 3300005617 Ga0068859_100010619 Ga0068859_1000106195 270
373 3300005617 Ga0068859_100085816 Ga0068859_1000858162 270
374 3300005618 Ga0068864_100001436 Ga0068864_1000014363 270
375 3300005618 Ga0068864_100007335 Ga0068864_1000073354 270
376 3300005618 Ga0068864_100087693 Ga0068864_1000876932 270
377 3300005718 Ga0068866_10037083 Ga0068866_100370832 270
378 3300005719 Ga0068861_100211999 Ga0068861_1002119992 270
379 3300005719 Ga0068861_100317325 Ga0068861_1003173251 270
380 3300005834 Ga0068851_10000892 Ga0068851_100008927 270
381 3300005840 Ga0068870_10015052 Ga0068870_100150525 270
382 3300005840 Ga0068870_10041112 Ga0068870_100411122 270
383 3300005841 Ga0068863_100020746 Ga0068863_1000207465 270
384 3300005841 Ga0068863_100040403 Ga0068863_1000404036 270
385 3300005841 Ga0068863_100057945 Ga0068863_1000579452 270
386 3300005842 Ga0068858_100008373 Ga0068858_1000083735 270
387 3300005842 Ga0068858_100008871 Ga0068858_1000088717 270
388 3300005843 Ga0068860_100036010 Ga0068860_1000360105 270
389 3300005843 Ga0068860_100324827 Ga0068860_1003248272 270
390 3300005844 Ga0068862_100232417 Ga0068862_1002324172 270
391 3300006051 Ga0075364_10004227 Ga0075364_100042278 270
392 3300006051 Ga0075364_10006499 Ga0075364_100064994 270
393 3300006051 Ga0075364_10048089 Ga0075364_100480893 270
394 3300006051 Ga0075364_10202908 Ga0075364_102029082 270
395 3300006051 Ga0075364_10313467 Ga0075364_103134672 270
396 3300006178 Ga0075367_10186424 Ga0075367_101864242 270
397 3300006186 Ga0075369_10000244 Ga0075369_1000024415 270
398 3300006195 Ga0075366_10002077 Ga0075366_100020773 270
399 3300006237 Ga0097621_100000958 Ga0097621_1000009584 270
400 3300006237 Ga0097621_100006784 Ga0097621_1000067847 270
401 3300006237 Ga0097621_100071759 Ga0097621_1000717593 270
402 3300006237 Ga0097621_100121962 Ga0097621_1001219623 270
403 3300006358 Ga0068871_100000297 Ga0068871_10000029720 270
404 3300006358 Ga0068871_100005274 Ga0068871_1000052745 270
405 3300006358 Ga0068871_100047471 Ga0068871_1000474713 270
406 3300006844 Ga0075428_100002437 Ga0075428_1000024373 270
407 3300006844 Ga0075428_100174036 Ga0075428_1001740361 270
408 3300006852 Ga0075433_10094711 Ga0075433_100947112 270
409 3300006871 Ga0075434_100046636 Ga0075434_1000466363 270
410 3300006880 Ga0075429_100014547 Ga0075429_1000145478 270
411 3300006880 Ga0075429_100194254 Ga0075429_1001942542 270
412 3300006881 Ga0068865_100029476 Ga0068865_1000294762 270
413 3300006881 Ga0068865_100168293 Ga0068865_1001682932 270
414 3300006931 Ga0097620_100010619 Ga0097620_1000106195 270
415 3300006931 Ga0097620_100085814 Ga0097620_1000858143 270
416 3300009093 Ga0105240_10072714 Ga0105240_100727144 270
417 3300009093 Ga0105240_10101898 Ga0105240_101018984 270
418 3300009094 Ga0111539_10008973 Ga0111539_100089733 270
419 3300009094 Ga0111539_10726972 Ga0111539_107269722 270
420 3300009098 Ga0105245_10105546 Ga0105245_101055462 270
421 3300009101 Ga0105247_10042082 Ga0105247_100420822 270
422 3300009148 Ga0105243_10026709 Ga0105243_100267093 270
423 3300009148 Ga0105243_10152337 Ga0105243_101523371 270
424 3300009176 Ga0105242_10036748 Ga0105242_100367484 270
425 3300009176 Ga0105242_10132658 Ga0105242_101326582 270
426 3300009177 Ga0105248_10006699 Ga0105248_100066997 270
427 3300009177 Ga0105248_10008148 Ga0105248_1000814812 270
428 3300009177 Ga0105248_10066361 Ga0105248_100663614 270
429 3300009551 Ga0105238_10416490 Ga0105238_104164901 270
430 3300009553 Ga0105249_10268169 Ga0105249_102681692 270
431 3300009553 Ga0105249_10390352 Ga0105249_103903522 270
432 3300010375 Ga0105239_10107469 Ga0105239_101074694 270
433 3300011119 Ga0105246_10032885 Ga0105246_100328854 270
434 3300013296 Ga0157374_10000531 Ga0157374_1000053121 270
435 3300013296 Ga0157374_10003810 Ga0157374_100038108 270
436 3300013296 Ga0157374_10025690 Ga0157374_100256904 270
437 3300013297 Ga0157378_10003226 Ga0157378_1000322613 270
438 3300013297 Ga0157378_10205661 Ga0157378_102056612 270
439 3300013306 Ga0163162_10004676 Ga0163162_1000467613 270
440 3300013306 Ga0163162_10134972 Ga0163162_101349722 270
441 3300013306 Ga0163162_10170734 Ga0163162_101707344 270
442 3300013306 Ga0163162_11133869 Ga0163162_111338691 270
443 3300013308 Ga0157375_10000588 Ga0157375_1000058830 270
444 3300013308 Ga0157375_10011760 Ga0157375_1001176010 270
445 3300013308 Ga0157375_10033046 Ga0157375_100330465 270
446 3300014325 Ga0163163_10011506 Ga0163163_100115066 270
447 3300014325 Ga0163163_10239305 Ga0163163_102393052 270
448 3300014325 Ga0163163_10422388 Ga0163163_104223882 270
449 3300014326 Ga0157380_10088922 Ga0157380_100889223 270
450 3300014326 Ga0157380_10090070 Ga0157380_100900702 270
451 3300014326 Ga0157380_10511036 Ga0157380_105110361 270
452 3300014968 Ga0157379_10007628 Ga0157379_100076286 270
453 3300014968 Ga0157379_10066249 Ga0157379_100662493 270
454 3300014969 Ga0157376_10008732 Ga0157376_100087327 270
455 3300014969 Ga0157376_10028599 Ga0157376_100285993 270
456 3300014969 Ga0157376_10050765 Ga0157376_100507653 270
457 3300017792 Ga0163161_10408255 Ga0163161_104082552 270
458 3300025294 Ga0209025_1000071 Ga0209025_1000071141 270
459 3300025321 Ga0207656_10000672 Ga0207656_1000067211 270
460 3300025893 Ga0207682_10006178 Ga0207682_100061783 270
461 3300025899 Ga0207642_10029270 Ga0207642_100292703 270
462 3300025899 Ga0207642_10075211 Ga0207642_100752112 270
463 3300025901 Ga0207688_10009150 Ga0207688_100091506 270
464 3300025901 Ga0207688_10272587 Ga0207688_102725871 270
465 3300025907 Ga0207645_10006565 Ga0207645_100065656 270
466 3300025907 Ga0207645_10124019 Ga0207645_101240192 270
467 3300025908 Ga0207643_10013580 Ga0207643_100135802 270
468 3300025909 Ga0207705_10196637 Ga0207705_101966372 270
469 3300025910 Ga0207684_10277844 Ga0207684_102778442 270
470 3300025917 Ga0207660_10295093 Ga0207660_102950931 270
471 3300025918 Ga0207662_10007962 Ga0207662_100079622 270
472 3300025918 Ga0207662_10029653 Ga0207662_100296532 270
473 3300025920 Ga0207649_10002695 Ga0207649_100026958 270
474 3300025921 Ga0207652_10687349 Ga0207652_106873491 270
475 3300025922 Ga0207646_10538434 Ga0207646_105384341 270
476 3300025923 Ga0207681_10038509 Ga0207681_100385093 270
477 3300025925 Ga0207650_10000698 Ga0207650_1000069810 270
478 3300025925 Ga0207650_10001764 Ga0207650_100017646 270
479 3300025926 Ga0207659_10001270 Ga0207659_1000127014 270
480 3300025926 Ga0207659_10008733 Ga0207659_100087335 270
481 3300025926 Ga0207659_10021915 Ga0207659_100219155 270
482 3300025931 Ga0207644_10005694 Ga0207644_100056947 270
483 3300025931 Ga0207644_10012832 Ga0207644_100128323 270
484 3300025933 Ga0207706_10105610 Ga0207706_101056103 270
485 3300025933 Ga0207706_10407579 Ga0207706_104075791 270
486 3300025935 Ga0207709_10033312 Ga0207709_100333122 270
487 3300025935 Ga0207709_10199448 Ga0207709_101994482 270
488 3300025938 Ga0207704_10076520 Ga0207704_100765202 270
489 3300025940 Ga0207691_10000530 Ga0207691_1000053027 270
490 3300025940 Ga0207691_10092970 Ga0207691_100929702 270
491 3300025941 Ga0207711_10190983 Ga0207711_101909832 270
492 3300025942 Ga0207689_10107065 Ga0207689_101070652 270
493 3300025944 Ga0207661_10000573 Ga0207661_1000057311 270
494 3300025945 Ga0207679_10001715 Ga0207679_100017155 270
495 3300025949 Ga0207667_10465963 Ga0207667_104659632 270
496 3300025960 Ga0207651_10000663 Ga0207651_100006639 270
497 3300025960 Ga0207651_10005256 Ga0207651_100052565 270
498 3300025960 Ga0207651_10140337 Ga0207651_101403372 270
499 3300025972 Ga0207668_10057789 Ga0207668_100577892 270
500 3300025981 Ga0207640_10008002 Ga0207640_100080022 270
501 3300025986 Ga0207658_10045176 Ga0207658_100451761 270
502 3300026023 Ga0207677_10000490 Ga0207677_1000049011 270
503 3300026023 Ga0207677_10022086 Ga0207677_100220862 270
504 3300026023 Ga0207677_10050506 Ga0207677_100505061 270
505 3300026023 Ga0207677_10491754 Ga0207677_104917541 270
506 3300026035 Ga0207703_10008995 Ga0207703_100089956 270
507 3300026035 Ga0207703_10038665 Ga0207703_100386653 270
508 3300026075 Ga0207708_10012002 Ga0207708_100120021 270
509 3300026078 Ga0207702_10588047 Ga0207702_105880471 270
510 3300026088 Ga0207641_10008259 Ga0207641_100082598 270
511 3300026088 Ga0207641_10043817 Ga0207641_100438173 270
512 3300026088 Ga0207641_10127849 Ga0207641_101278492 270
513 3300026089 Ga0207648_10012160 Ga0207648_100121603 270
514 3300026089 Ga0207648_10031374 Ga0207648_100313743 270
515 3300026089 Ga0207648_10048748 Ga0207648_100487484 270
516 3300026095 Ga0207676_10010028 Ga0207676_100100286 270
517 3300026095 Ga0207676_10018547 Ga0207676_100185473 270
518 3300026095 Ga0207676_10053184 Ga0207676_100531842 270
519 3300026116 Ga0207674_10021761 Ga0207674_100217616 270
520 3300026118 Ga0207675_100020819 Ga0207675_1000208194 270
521 3300026121 Ga0207683_10001233 Ga0207683_1000123321 270
522 3300026121 Ga0207683_10014248 Ga0207683_100142486 270
523 3300026121 Ga0207683_10449664 Ga0207683_104496642 270
524 3300026142 Ga0207698_10012522 Ga0207698_100125226 270
525 3300026142 Ga0207698_10245733 Ga0207698_102457332 270
526 3300027364 Ga0209967_1003844 Ga0209967_10038442 270
527 3300027462 Ga0210000_1000334 Ga0210000_10003348 270
528 3300027471 Ga0209995_1000887 Ga0209995_10008871 270
529 3300027543 Ga0209999_1002514 Ga0209999_10025142 270
530 3300027552 Ga0209982_1006211 Ga0209982_10062112 270
531 3300027665 Ga0209983_1012545 Ga0209983_10125452 270
532 3300027682 Ga0209971_1006270 Ga0209971_10062703 270
533 3300027876 Ga0209974_10004797 Ga0209974_100047972 270
534 3300027907 Ga0207428_10016169 Ga0207428_100161698 270
535 3300028379 Ga0268266_10072600 Ga0268266_100726004 270
536 3300028379 Ga0268266_10151448 Ga0268266_101514482 270
537 3300028381 Ga0268264_10051230 Ga0268264_100512304 270
538 3300028381 Ga0268264_10498651 Ga0268264_104986512 270
539 3300028577 Ga0265318_10001810 Ga0265318_100018104 270
540 3300028577 Ga0265318_10063277 Ga0265318_100632772 270
541 3300031235 Ga0265330_10011234 Ga0265330_100112344 270
542 3300031238 Ga0265332_10000286 Ga0265332_1000028620 270
543 3300031238 Ga0265332_10003080 Ga0265332_100030808 270
544 3300031239 Ga0265328_10002318 Ga0265328_100023188 270
545 3300031240 Ga0265320_10012333 Ga0265320_100123337 270
546 3300031242 Ga0265329_10010166 Ga0265329_100101663 270
547 3300031250 Ga0265331_10000989 Ga0265331_1000098913 270
548 3300031344 Ga0265316_10056027 Ga0265316_100560272 270
549 3300031711 Ga0265314_10014501 Ga0265314_100145013 270
550 3300031712 Ga0265342_10013789 Ga0265342_100137897 270
551 3300035695 Ga0373927_0442782 Ga0373927_0442782_19_846 270
552 3300036401 Ga0373937_0044086 Ga0373937_0044086_2970_3821 270
553 3300037418 Ga0395900_0164690 Ga0395900_0164690_194_1012 270
554 3300037471 Ga0395905_0015084 Ga0395905_0015084_1519_2337 270
555 3300038443 Ga0395901_0036213 Ga0395901_0036213_422_1240 270
556 3300038725 Ga0400484_36649 Ga0400484_36649_20798_21643 270
557 3300038726 Ga0400490_19580 Ga0400490_19580_15334_16173 270
558 3300038726 Ga0400490_31277 Ga0400490_31277_2471_3316 270
559 3300038726 Ga0400490_46324 Ga0400490_46324_6219_7064 270
560 3300038735 Ga0400485_21786 Ga0400485_21786_2307_3152 270
561 3300038741 Ga0400488_55744 Ga0400488_55744_1385_2230 270
562 3300038742 Ga0400486_18420 Ga0400486_18420_323_1168 270
563 3300038742 Ga0400486_22694 Ga0400486_22694_6174_7019 270
564 3300038742 Ga0400486_32535 Ga0400486_32535_635_1480 270
565 3300039062 Ga0400483_015147 Ga0400483_015147_4699_5544 270
566 3300039062 Ga0400483_111606 Ga0400483_111606_2708_3547 270
567 3300039062 Ga0400483_285866 Ga0400483_285866_1615_2460 270
568 3300039093 Ga0400489_48784 Ga0400489_48784_19341_20186 270
569 3300039110 Ga0400487_35338 Ga0400487_35338_640_1485 270
570 3300039110 Ga0400487_51851 Ga0400487_51851_116_961 270
571 3300042876 Ga0451577_0000264 Ga0451577_0000264_26866_27702 270
572 3300042876 Ga0451577_0039896 Ga0451577_0039896_1867_2703 270
573 3300042876 Ga0451577_0159958 Ga0451577_0159958_1007_1828 270
574 3300044673 Ga0453683_0000047 Ga0453683_0000047_160144_160965 270
575 3300044684 Ga0466966_0027860 Ga0466966_0027860_1416_2234 270
576 3300044712 Ga0453684_0000302 Ga0453684_0000302_46799_47620 270
577 3300044712 Ga0453684_0006132 Ga0453684_0006132_3922_4758 270
578 3300044712 Ga0453684_0020628 Ga0453684_0020628_3504_4349 270
579 3300045051 Ga0451576_0000096 Ga0451576_0000096_79912_80748 270
580 3300045051 Ga0451576_0000116 Ga0451576_0000116_160144_160965 270
581 3300046472 Ga0495580_0290394 Ga0495580_0290394_278_1105 270
582 3300046501 Ga0495607_0000050 Ga0495607_0000050_51388_52209 270
583 3300046684 Ga0495669_0031846 Ga0495669_0031846_1292_2104 270
584 3300048907 Ga0496104_0097099 Ga0496104_0097099_1308_2135 270
585 3300048908 Ga0496105_0191914 Ga0496105_0191914_16_843 270
586 3300048911 Ga0496108_0001128 Ga0496108_0001128_17319_18146 270
587 3300048911 Ga0496108_0333104 Ga0496108_0333104_283_1095 270
588 3300048912 Ga0496109_0010127 Ga0496109_0010127_1357_2184 270
589 3300048913 Ga0496110_0001483 Ga0496110_0001483_1156_1983 270
590 3300048915 Ga0496112_0082105 Ga0496112_0082105_20_847 270
591 3300048917 Ga0496114_0086267 Ga0496114_0086267_928_1740 270
592 3300049569 Ga0501032_0001373 Ga0501032_0001373_1026_1853 270
593 3300049570 Ga0501033_0012697 Ga0501033_0012697_2040_2867 270
594 3300049571 Ga0501034_0000641 Ga0501034_0000641_39567_40379 270
595 3300049571 Ga0501034_0020598 Ga0501034_0020598_2248_3075 270
596 3300049571 Ga0501034_0119887 Ga0501034_0119887_120_941 270
597 3300049572 Ga0501036_0049516 Ga0501036_0049516_503_1330 270
598 3300049573 Ga0501037_0000474 Ga0501037_0000474_13753_14580 270
599 3300049574 Ga0501038_0008209 Ga0501038_0008209_7268_8095 270
600 3300049575 Ga0501039_0025347 Ga0501039_0025347_888_1715 270
601 3300049576 Ga0501040_0003365 Ga0501040_0003365_9317_10144 270
602 3300049578 Ga0501042_0012886 Ga0501042_0012886_4113_4940 270
603 3300049579 Ga0501043_0014893 Ga0501043_0014893_4192_5019 270
604 3300049579 Ga0501043_0102854 Ga0501043_0102854_728_1555 270
605 3300049580 Ga0501046_0012703 Ga0501046_0012703_4151_4978 270
606 3300049582 Ga0501048_0063677 Ga0501048_0063677_1224_2051 270
607 3300049583 Ga0501067_0187117 Ga0501067_0187117_102_914 270
608 3300049584 Ga0501068_0000140 Ga0501068_0000140_4794_5606 270
609 3300049584 Ga0501068_0002905 Ga0501068_0002905_7143_7970 270
610 3300049588 Ga0501072_0005894 Ga0501072_0005894_2740_3552 270
611 3300049589 Ga0501073_0014507 Ga0501073_0014507_4695_5507 270
612 3300049742 Ga0501080_0149995 Ga0501080_0149995_996_1808 270
613 3300049742 Ga0501080_0291692 Ga0501080_0291692_33_845 270
614 3300049823 Ga0501044_0023765 Ga0501044_0023765_1359_2186 270
615 3300049824 Ga0501045_0003419 Ga0501045_0003419_1246_2073 270
616 3300050491 nmdc:mga00v17_22766_c1 nmdc:mga00v17_22766_c1_2060_2881 270
617 3300050491 nmdc:mga00v17_298749_c1 nmdc:mga00v17_298749_c1_173_1006 270
618 3300050491 nmdc:mga00v17_304151_c1 nmdc:mga00v17_304151_c1_92_928 270
619 3300050491 nmdc:mga00v17_5593_c1 nmdc:mga00v17_5593_c1_1528_2361 270
620 3300050491 nmdc:mga00v17_8189_c1 nmdc:mga00v17_8189_c1_3238_4071 270
621 3300050493 nmdc:mga0k408_2784_c1 nmdc:mga0k408_2784_c1_5436_6272 270
622 3300050493 nmdc:mga0k408_3933_c1 nmdc:mga0k408_3933_c1_6035_6856 270
623 3300050494 nmdc:mga06z11_281558_c1 nmdc:mga06z11_281558_c1_34_855 270
624 3300050508 nmdc:mga09592_187364_c1 nmdc:mga09592_187364_c1_364_1191 270
625 3300050509 nmdc:mga0qj67_175257_c1 nmdc:mga0qj67_175257_c1_388_1215 270
626 3300050511 nmdc:mga08y16_10406_c1 nmdc:mga08y16_10406_c1_1403_2230 270
627 3300050512 nmdc:mga0n895_46935_c1 nmdc:mga0n895_46935_c1_1130_1957 270
628 3300050515 nmdc:mga0a205_34161_c1 nmdc:mga0a205_34161_c1_1343_2170 270
629 3300050516 nmdc:mga0sz30_18417_c1 nmdc:mga0sz30_18417_c1_1354_2175 270
630 3300061719 Ga0466962_0069043 Ga0466962_0069043_265_1083 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

1

176

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dfj-assembly1.cif.gz_B crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a 0.9692 2 262
2dfj-assembly1.cif.gz_B crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a 0.9444 2 262
2qjc-assembly1.cif.gz_A crystal structure of a putative diadenosine tetraphosphatase 0.8576 2 262
2qjc-assembly1.cif.gz_A crystal structure of a putative diadenosine tetraphosphatase 0.7885 2 262
4j6o-assembly2.cif.gz_B crystal structure of the phosphatase domain of c. thermocellum (bacterial) pnkp 0.6765 2 266
ID Description Score Start End Superfamily
2dfjA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9725 2 264 3.60.21.10
2dfjA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9547 2 264 3.60.21.10
af_Q4E243_1_156_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8914 5 67 3.60.21.10
af_A0A0R0FVP8_67_225_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8826 3 67 3.60.21.10
af_U4PM66_856_953_2.60.40.60 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.8331 249 263 2.60.40.60
ID Description Score Start End GO Terms
AF-A0A536WUC0-F1-model_v4 Symmetrical bis(5'-nucleosyl)-tetraphosphatase (EC 3.6.1.41) 0.9951 1 185 GO:0008803
AF-A0A1M3GY89-F1-model_v4 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) (EC 3.6.1.41) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) (Diadenosine tetraphosphatase) 0.993 1 226 GO:0008803
AF-A0A0K9NXR9-F1-model_v4 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) (EC 3.6.1.41) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) (Diadenosine tetraphosphatase) 0.9919 1 257 GO:0008803
GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A7V3CFW4-F1-model_v4 Diadenosine tetraphosphatase 0.9911 1 97 GO:0005737
GO:0008803
GO:0016791
GO:0110154
AF-A0A1G3Y8J9-F1-model_v4 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical (EC 3.6.1.41) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) (Diadenosine tetraphosphatase) 0.9906 1 262 GO:0008803

Feature Viewer

pLDDT pTM Quality
94.54 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map