F470707

General Info

Members Datasets Scaffolds Average Seq Length
629 322 597 195

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10051907|Ga0070658_100519073
Length 213
Sequence MPKPSLRWNGAAIASGGSGLDKDEVLGVFRECGAILEGHFILSSGLRSPVFLQKARVFMYPDKAEKLCRALAEKIRAAEFGDVSKVVSPAVGGIIPGYETARHLGLPAIYTERVEGRFELRRGFELAPGERVIVVEDIVSTGLSIRECIECLRRIGAHVVAAACLIDRSAGAAEIGVPLVALTEYKVPAYPADQLPPELAALPAVKPGSRGLQ

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
4 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
5 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
6 2643221640 Caulobacter sp. Root342 Isolate Unclassified
7 2643221642 Caulobacter sp. Root343 Isolate Unclassified
8 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
9 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
10 2643221733 Bosea sp. Root381 Isolate Unclassified
11 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
12 2773857925 Microvirga vignae BR3299 Isolate Unclassified
13 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
14 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
15 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
16 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
17 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
18 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
19 2849560528 Caulobacter zeae 410 Isolate Unclassified
20 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
21 2851153111 Caulobacter radicis 736 Isolate Unclassified
22 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
23 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
24 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
25 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
26 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
27 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
28 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
29 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
30 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
31 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
32 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
113 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
114 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
117 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
159 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
168 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
169 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
208 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
209 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
223 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
228 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
229 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
230 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
235 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
245 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
295 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
296 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
297 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
298 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
299 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
300 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
301 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
302 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
303 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
304 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
305 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
306 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
307 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
308 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
309 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
310 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
311 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
312 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
313 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
314 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
315 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
316 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
317 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
318 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
319 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
320 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
321 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
322 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.91
Metatranscriptomes 0
Isolates 5.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.51
Nodule 1.27
Rhizoplane 2.86
Rhizosphere 72.5
Stem 0
Stem Tuber 0
Unclassified 9.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10020329 3300001990 Bacteria 2120
2 rootL2_10057694 3300003322 Bacteria 3358
3 rootH1_10011442 3300003323 Bacteria 3053
4 rootH1_10015864 3300003323 Bacteria 5646
5 rootH1_10137886 3300003323 Bacteria 1117
6 Ga0055536_1001488 3300003781 Bacteria 14090
7 Ga0055536_1023344 3300003781 Bacteria 1820
8 Ga0055530_10004254 3300003791 Bacteria 7496
9 Ga0055530_10022701 3300003791 Bacteria 1820
10 Ga0055540_1056897 3300003792 Bacteria 791
11 Ga0055531_10002053 3300003794 Bacteria 13896
12 Ga0055531_10079723 3300003794 Bacteria 725
13 Ga0070658_10003193 3300005327 Bacteria 13525
14 Ga0070658_10051907 3300005327 Bacteria 3324
15 Ga0070683_101299152 3300005329 Bacteria 699
16 Ga0070670_100143104 3300005331 Bacteria 2068
17 Ga0070666_10376886 3300005335 Bacteria 1018
18 Ga0068868_100085490 3300005338 Bacteria 2535
19 Ga0070660_100020211 3300005339 Bacteria 4890
20 Ga0070660_100181721 3300005339 Bacteria 1702
21 Ga0070661_100010278 3300005344 Bacteria 6503
22 Ga0070661_100139693 3300005344 Bacteria 1825
23 Ga0070661_100265942 3300005344 Bacteria 1327
24 Ga0070668_100001523 3300005347 Bacteria 16727
25 Ga0070668_100001873 3300005347 Bacteria 15364
26 Ga0070668_100009206 3300005347 Bacteria 7323
27 Ga0070668_100021251 3300005347 Bacteria 4906
28 Ga0070668_100053007 3300005347 Bacteria 3128
29 Ga0070668_100195401 3300005347 Bacteria 1659
30 Ga0070669_100002957 3300005353 Bacteria 12250
31 Ga0070669_100152662 3300005353 Bacteria 1789
32 Ga0070671_100006167 3300005355 Bacteria 9549
33 Ga0070674_100033765 3300005356 Bacteria 3409
34 Ga0070673_100040840 3300005364 Bacteria 3562
35 Ga0070659_100011871 3300005366 Bacteria 6448
36 Ga0070659_100116854 3300005366 Bacteria 2157
37 Ga0070659_100588120 3300005366 Bacteria 955
38 Ga0070667_100017619 3300005367 Bacteria 5917
39 Ga0070714_100488578 3300005435 Bacteria 1173
40 Ga0070710_10211727 3300005437 Bacteria 1229
41 Ga0070700_100237614 3300005441 Bacteria 1300
42 Ga0070663_100165145 3300005455 Bacteria 1707
43 Ga0070663_100220686 3300005455 Bacteria 1488
44 Ga0070663_100874114 3300005455 Bacteria 775
45 Ga0070681_10656191 3300005458 Bacteria 964
46 Ga0068867_100095022 3300005459 Bacteria 2268
47 Ga0070707_100014042 3300005468 Bacteria 7504
48 Ga0070698_100644222 3300005471 Bacteria 1001
49 Ga0068853_100016117 3300005539 Bacteria 6146
50 Ga0068853_100395341 3300005539 Bacteria 1293
51 Ga0068853_100525366 3300005539 Bacteria 1119
52 Ga0070665_100002649 3300005548 Bacteria 19471
53 Ga0070665_100040636 3300005548 Bacteria 4674
54 Ga0070665_100140371 3300005548 Bacteria 2419
55 Ga0070665_100182479 3300005548 Bacteria 2099
56 Ga0070665_100206966 3300005548 Bacteria 1963
57 Ga0070665_100236858 3300005548 Bacteria 1826
58 Ga0070665_100281837 3300005548 Bacteria 1664
59 Ga0068855_100051527 3300005563 Bacteria 4849
60 Ga0068855_100069067 3300005563 Bacteria 4112
61 Ga0068855_100404789 3300005563 Bacteria 1495
62 Ga0068855_100894990 3300005563 Bacteria 938
63 Ga0070664_100270774 3300005564 Bacteria 1530
64 Ga0068857_100094674 3300005577 Bacteria 2675
65 Ga0068857_100574568 3300005577 Bacteria 1063
66 Ga0068854_100050912 3300005578 Bacteria 2965
67 Ga0068854_100207173 3300005578 Bacteria 1545
68 Ga0068854_101068259 3300005578 Bacteria 718
69 Ga0068856_100006548 3300005614 Bacteria 11418
70 Ga0068856_100177061 3300005614 Bacteria 2145
71 Ga0068856_100434444 3300005614 Bacteria 1333
72 Ga0068856_100495673 3300005614 Bacteria 1242
73 Ga0068856_100782232 3300005614 Bacteria 974
74 Ga0068852_100007967 3300005616 Bacteria 7768
75 Ga0068852_100011884 3300005616 Bacteria 6583
76 Ga0068852_100022732 3300005616 Bacteria 5034
77 Ga0068852_101667760 3300005616 Bacteria 660
78 Ga0068859_100000320 3300005617 Bacteria 48067
79 Ga0068859_100018700 3300005617 Bacteria 6962
80 Ga0068859_100074227 3300005617 Bacteria 3440
81 Ga0068859_100296597 3300005617 Bacteria 1710
82 Ga0068859_100538641 3300005617 Bacteria 1262
83 Ga0068864_100918894 3300005618 Bacteria 865
84 Ga0068866_10441740 3300005718 Bacteria 849
85 Ga0068861_100207938 3300005719 Bacteria 1647
86 Ga0068851_10011040 3300005834 Bacteria 4227
87 Ga0068851_10107300 3300005834 Bacteria 1488
88 Ga0068863_100019466 3300005841 Bacteria 6494
89 Ga0068863_100078754 3300005841 Bacteria 3121
90 Ga0068858_100002660 3300005842 Bacteria 17976
91 Ga0068860_100000145 3300005843 Bacteria 115830
92 Ga0068860_100846578 3300005843 Bacteria 929
93 Ga0068862_100014354 3300005844 Bacteria 6571
94 Ga0068862_100033211 3300005844 Bacteria 4360
95 Ga0068862_100038066 3300005844 Bacteria 4078
96 Ga0068862_100040435 3300005844 Bacteria 3963
97 Ga0068862_100045431 3300005844 Bacteria 3748
98 Ga0068862_100103711 3300005844 Bacteria 2491
99 Ga0068862_100657661 3300005844 Bacteria 1011
100 Ga0081455_10077799 3300005937 Bacteria 2727
101 Ga0075365_10410685 3300006038 Bacteria 956
102 Ga0075368_10016396 3300006042 Bacteria 2762
103 Ga0075363_100003257 3300006048 Bacteria 6870
104 Ga0075364_10001440 3300006051 Bacteria 12901
105 Ga0075364_10501048 3300006051 Unclassified 830
106 Ga0075364_10593347 3300006051 Bacteria 757
107 Ga0070712_100487971 3300006175 Bacteria 1031
108 Ga0075367_10001920 3300006178 Bacteria 9229
109 Ga0075369_10003644 3300006186 Bacteria 5624
110 Ga0075369_10097777 3300006186 Bacteria 1315
111 Ga0075366_10006638 3300006195 Bacteria 6350
112 Ga0075366_10015328 3300006195 Bacteria 4390
113 Ga0075366_10204669 3300006195 Bacteria 1201
114 Ga0075370_10083369 3300006353 Bacteria 1839
115 Ga0075370_10089343 3300006353 Bacteria 1776
116 Ga0068865_100290751 3300006881 Bacteria 1304
117 Ga0097620_100000320 3300006931 Bacteria 48067
118 Ga0097620_100018700 3300006931 Bacteria 6962
119 Ga0097620_100074227 3300006931 Bacteria 3440
120 Ga0097620_100538676 3300006931 Bacteria 1262
121 Ga0079104_1025229 3300006946 Bacteria 1555
122 Ga0105240_10086678 3300009093 Bacteria 3835
123 Ga0105240_10129675 3300009093 Bacteria 3026
124 Ga0105240_10289906 3300009093 Bacteria 1877
125 Ga0105240_10354993 3300009093 Bacteria 1662
126 Ga0105240_10595426 3300009093 Bacteria 1218
127 Ga0105240_10745436 3300009093 Bacteria 1065
128 Ga0105245_10905693 3300009098 Bacteria 924
129 Ga0105241_10301354 3300009174 Bacteria 1376
130 Ga0105241_10555445 3300009174 Bacteria 1031
131 Ga0105241_10888484 3300009174 Bacteria 827
132 Ga0105248_10000963 3300009177 Bacteria 32061
133 Ga0105248_10010557 3300009177 Bacteria 10175
134 Ga0105248_10021645 3300009177 Bacteria 7121
135 Ga0105248_10519193 3300009177 Bacteria 1343
136 Ga0105237_10000542 3300009545 Bacteria 53188
137 Ga0105237_10095538 3300009545 Bacteria 2962
138 Ga0105237_10108306 3300009545 Bacteria 2770
139 Ga0105237_10466380 3300009545 Bacteria 1269
140 Ga0105237_10535374 3300009545 Bacteria 1178
141 Ga0105237_10571612 3300009545 Bacteria 1137
142 Ga0105238_10024988 3300009551 Bacteria 6089
143 Ga0105238_10082229 3300009551 Bacteria 3210
144 Ga0105238_10092278 3300009551 Bacteria 3016
145 Ga0105238_10175478 3300009551 Bacteria 2120
146 Ga0105238_10284325 3300009551 Bacteria 1636
147 Ga0105238_10548610 3300009551 Bacteria 1160
148 Ga0105249_10115368 3300009553 Bacteria 2545
149 Ga0105249_10252016 3300009553 Bacteria 1751
150 Ga0105249_10301449 3300009553 Bacteria 1607
151 Ga0105239_10006821 3300010375 Bacteria 13173
152 Ga0105239_10146761 3300010375 Bacteria 2632
153 Ga0105239_10394994 3300010375 Bacteria 1565
154 Ga0105239_10579639 3300010375 Bacteria 1279
155 Ga0157373_10016485 3300013100 Bacteria 5388
156 Ga0157373_10029125 3300013100 Bacteria 3980
157 Ga0157373_10138714 3300013100 Bacteria 1710
158 Ga0157371_10010578 3300013102 Bacteria 7169
159 Ga0157371_10015467 3300013102 Bacteria 5723
160 Ga0157371_10178687 3300013102 Bacteria 1518
161 Ga0157370_10012975 3300013104 Bacteria 8611
162 Ga0157370_10054397 3300013104 Bacteria 3815
163 Ga0157370_10195787 3300013104 Bacteria 1876
164 Ga0157370_10355413 3300013104 Bacteria 1350
165 Ga0157370_10590712 3300013104 Bacteria 1017
166 Ga0157369_10017421 3300013105 Bacteria 8072
167 Ga0157369_10018266 3300013105 Bacteria 7865
168 Ga0157369_10123583 3300013105 Bacteria 2745
169 Ga0157374_10017264 3300013296 Bacteria 6352
170 Ga0157378_10545961 3300013297 Bacteria 1164
171 Ga0163162_10061259 3300013306 Bacteria 3800
172 Ga0163162_10599138 3300013306 Bacteria 1228
173 Ga0157372_10105890 3300013307 Bacteria 3217
174 Ga0157372_10253764 3300013307 Bacteria 2042
175 Ga0157372_10734204 3300013307 Bacteria 1148
176 Ga0163163_10065083 3300014325 Bacteria 3618
177 Ga0163163_10202242 3300014325 Bacteria 2035
178 Ga0157380_10058149 3300014326 Bacteria 3082
179 Ga0157379_10140423 3300014968 Bacteria 2178
180 Ga0157376_10711098 3300014969 Bacteria 1011
181 Ga0182007_10079674 3300015262 Bacteria 1074
182 Ga0183365_10002 3300015684 Bacteria 545891
183 Ga0213873_10043493 3300021358 Bacteria 1165
184 Ga0213872_10008208 3300021361 Bacteria 5061
185 Ga0213872_10018300 3300021361 Bacteria 3231
186 Ga0213872_10031777 3300021361 Bacteria 2420
187 Ga0213872_10184137 3300021361 Bacteria 901
188 Ga0213876_10045939 3300021384 Bacteria 2309
189 Ga0213871_10055471 3300021441 Bacteria 1094
190 Ga0207427_102826 3300025231 Bacteria 4213
191 Ga0209026_1001304 3300025250 Bacteria 11268
192 Ga0209233_1000811 3300025261 Bacteria 13925
193 Ga0209676_1000136 3300025292 Bacteria 181860
194 Ga0209676_1000200 3300025292 Bacteria 133793
195 Ga0209564_1050695 3300025295 Bacteria 1014
196 Ga0209050_1000057 3300025298 Bacteria 326289
197 Ga0209050_1000568 3300025298 Bacteria 59952
198 Ga0209256_1016500 3300025299 Bacteria 2513
199 Ga0209051_1003331 3300025303 Bacteria 10618
200 Ga0209051_1046399 3300025303 Bacteria 1494
201 Ga0209257_1000142 3300025304 Bacteria 200756
202 Ga0209257_1005736 3300025304 Bacteria 8498
203 Ga0209257_1018243 3300025304 Bacteria 2712
204 Ga0207656_10029238 3300025321 Bacteria 2268
205 Ga0207656_10068069 3300025321 Bacteria 1577
206 Ga0207692_10270105 3300025898 Bacteria 1025
207 Ga0207647_10136776 3300025904 Bacteria 1437
208 Ga0207645_10039330 3300025907 Bacteria 3030
209 Ga0207705_10020685 3300025909 Bacteria 4699
210 Ga0207705_10078710 3300025909 Bacteria 2400
211 Ga0207695_10052766 3300025913 Bacteria 4257
212 Ga0207695_10221172 3300025913 Bacteria 1801
213 Ga0207695_10361059 3300025913 Bacteria 1339
214 Ga0207671_10007454 3300025914 Bacteria 9494
215 Ga0207671_10370418 3300025914 Bacteria 1137
216 Ga0207657_10010644 3300025919 Bacteria 9162
217 Ga0207657_10012881 3300025919 Bacteria 8223
218 Ga0207657_10021801 3300025919 Bacteria 6018
219 Ga0207657_10420758 3300025919 Bacteria 1050
220 Ga0207649_10002314 3300025920 Bacteria 10705
221 Ga0207649_10014695 3300025920 Bacteria 4389
222 Ga0207681_10009092 3300025923 Bacteria 6070
223 Ga0207681_10166450 3300025923 Bacteria 1667
224 Ga0207694_10225407 3300025924 Bacteria 1529
225 Ga0207694_10399021 3300025924 Bacteria 1143
226 Ga0207694_10418646 3300025924 Bacteria 1116
227 Ga0207687_10629370 3300025927 Bacteria 906
228 Ga0207644_10000767 3300025931 Bacteria 20321
229 Ga0207690_10013115 3300025932 Bacteria 4972
230 Ga0207690_10035108 3300025932 Bacteria 3235
231 Ga0207690_10166299 3300025932 Bacteria 1648
232 Ga0207690_10209326 3300025932 Bacteria 1486
233 Ga0207706_10374470 3300025933 Bacteria 1236
234 Ga0207669_10020888 3300025937 Bacteria 3444
235 Ga0207704_10050272 3300025938 Bacteria 2514
236 Ga0207691_10048596 3300025940 Bacteria 3889
237 Ga0207711_10005066 3300025941 Bacteria 11174
238 Ga0207711_10063077 3300025941 Bacteria 3198
239 Ga0207711_10572266 3300025941 Bacteria 1054
240 Ga0207661_10187454 3300025944 Bacteria 1812
241 Ga0207667_10004813 3300025949 Bacteria 16512
242 Ga0207667_10059234 3300025949 Bacteria 4011
243 Ga0207667_10787037 3300025949 Bacteria 949
244 Ga0207668_10000007 3300025972 Bacteria 190613
245 Ga0207668_10002156 3300025972 Bacteria 11478
246 Ga0207668_10003322 3300025972 Bacteria 9419
247 Ga0207668_10072995 3300025972 Bacteria 2457
248 Ga0207668_10278344 3300025972 Bacteria 1371
249 Ga0207640_10091502 3300025981 Bacteria 2107
250 Ga0207658_10005471 3300025986 Bacteria 8707
251 Ga0207658_10103475 3300025986 Bacteria 2235
252 Ga0207703_10002382 3300026035 Bacteria 16346
253 Ga0207639_10002696 3300026041 Bacteria 11916
254 Ga0207639_10184484 3300026041 Bacteria 1777
255 Ga0207678_10145892 3300026067 Bacteria 2020
256 Ga0207678_10489411 3300026067 Bacteria 1071
257 Ga0207678_10935349 3300026067 Bacteria 767
258 Ga0207702_10015251 3300026078 Bacteria 6372
259 Ga0207702_10176074 3300026078 Bacteria 1966
260 Ga0207702_10378125 3300026078 Bacteria 1361
261 Ga0207702_10383623 3300026078 Bacteria 1352
262 Ga0207702_10591348 3300026078 Bacteria 1088
263 Ga0207641_10012619 3300026088 Bacteria 6929
264 Ga0207641_10025693 3300026088 Bacteria 4855
265 Ga0207674_10066546 3300026116 Bacteria 3629
266 Ga0207674_10080288 3300026116 Bacteria 3265
267 Ga0207674_10994027 3300026116 Bacteria 808
268 Ga0207675_100272175 3300026118 Bacteria 1644
269 Ga0207698_10043987 3300026142 Bacteria 3351
270 Ga0207698_10046647 3300026142 Bacteria 3274
271 Ga0207698_10263771 3300026142 Bacteria 1584
272 Ga0207698_11098846 3300026142 Bacteria 808
273 Ga0209281_1031761 3300027111 Bacteria 939
274 Ga0209983_1011736 3300027665 Bacteria 1793
275 Ga0268266_10000873 3300028379 Bacteria 39154
276 Ga0268266_10001586 3300028379 Bacteria 26564
277 Ga0268266_10102704 3300028379 Bacteria 2522
278 Ga0268266_10121980 3300028379 Bacteria 2320
279 Ga0268266_10226678 3300028379 Bacteria 1720
280 Ga0268266_10846245 3300028379 Bacteria 884
281 Ga0268265_10002648 3300028380 Bacteria 13288
282 Ga0268265_10017263 3300028380 Bacteria 4977
283 Ga0268265_10060619 3300028380 Bacteria 2900
284 Ga0268265_10083228 3300028380 Bacteria 2533
285 Ga0268265_10663133 3300028380 Bacteria 1004
286 Ga0268264_10000046 3300028381 Bacteria 364597
287 Ga0268264_10036495 3300028381 Bacteria 4050
288 Ga0265318_10005459 3300028577 Bacteria 5968
289 Ga0307517_10116469 3300028786 Bacteria 2000
290 Ga0307515_10016872 3300028794 Bacteria 13347
291 Ga0307515_10160775 3300028794 Bacteria 2292
292 Ga0265338_10014660 3300028800 Bacteria 8692
293 Ga0265338_10145997 3300028800 Bacteria 1845
294 Ga0265330_10011535 3300031235 Bacteria 4142
295 Ga0265330_10081518 3300031235 Bacteria 1394
296 Ga0265332_10047612 3300031238 Bacteria 1845
297 Ga0265320_10016395 3300031240 Bacteria 4154
298 Ga0265325_10005917 3300031241 Bacteria 7495
299 Ga0265329_10083730 3300031242 Bacteria 1010
300 Ga0265340_10111321 3300031247 Bacteria 1266
301 Ga0265339_10005634 3300031249 Bacteria 8308
302 Ga0265339_10014616 3300031249 Bacteria 4726
303 Ga0265339_10047391 3300031249 Bacteria 2360
304 Ga0265327_10107706 3300031251 Bacteria 1336
305 Ga0265316_10144482 3300031344 Bacteria 1785
306 Ga0307513_10008912 3300031456 Bacteria 12755
307 Ga0307408_100073359 3300031548 Bacteria 2536
308 Ga0265313_10000896 3300031595 Bacteria 29908
309 Ga0307508_10233124 3300031616 Bacteria 1439
310 Ga0265314_10014116 3300031711 Bacteria 6413
311 Ga0265314_10244808 3300031711 Bacteria 1032
312 Ga0265342_10032533 3300031712 Bacteria 3216
313 Ga0265342_10282471 3300031712 Bacteria 878
314 Ga0307405_10152490 3300031731 Bacteria 1627
315 Ga0307405_10665239 3300031731 Bacteria 858
316 Ga0307413_10017908 3300031824 Bacteria 3702
317 Ga0307410_10341749 3300031852 Bacteria 1193
318 Ga0307406_10122962 3300031901 Bacteria 1808
319 Ga0307407_10016857 3300031903 Bacteria 3648
320 Ga0307412_10017451 3300031911 Bacteria 4296
321 Ga0307412_10272764 3300031911 Bacteria 1324
322 Ga0307412_11094470 3300031911 Bacteria 709
323 Ga0307409_100440591 3300031995 Bacteria 1255
324 Ga0307409_100731450 3300031995 Bacteria 992
325 Ga0307416_100067027 3300032002 Bacteria 2958
326 Ga0307416_101102601 3300032002 Bacteria 898
327 Ga0307416_101431056 3300032002 Bacteria 797
328 Ga0307414_10046511 3300032004 Bacteria 2979
329 Ga0307414_10274126 3300032004 Bacteria 1414
330 Ga0307414_10279859 3300032004 Bacteria 1401
331 Ga0307414_10316762 3300032004 Bacteria 1326
332 Ga0307414_10385895 3300032004 Bacteria 1212
333 Ga0307414_10985168 3300032004 Bacteria 775
334 Ga0307411_10394761 3300032005 Bacteria 1142
335 Ga0373926_0066292 3300035083 Bacteria 1322
336 Ga0373943_0203554 3300035170 Bacteria 1096
337 Ga0373931_0042967 3300035691 Bacteria 2378
338 Ga0373935_0020591 3300035692 Bacteria 4031
339 Ga0373927_0002992 3300035695 Bacteria 12257
340 Ga0373927_0360734 3300035695 Bacteria 958
341 Ga0316582_0189792 3300036647 Bacteria 1400
342 Ga0373925_0000380 3300037068 Bacteria 46083
343 Ga0373925_1117448 3300037068 Bacteria 648
344 Ga0395899_0017794 3300037312 Bacteria 5411
345 Ga0395899_0074897 3300037312 Bacteria 2472
346 Ga0395898_0072863 3300037466 Bacteria 3317
347 Ga0395898_0114692 3300037466 Bacteria 2581
348 Ga0395905_0000172 3300037471 Bacteria 105228
349 Ga0395905_0094930 3300037471 Bacteria 2798
350 Ga0395905_0146949 3300037471 Bacteria 2218
351 Ga0395901_0779429 3300038443 Bacteria 947
352 Ga0395901_0915613 3300038443 Bacteria 858
353 Ga0436365_0358324 3300039437 Bacteria 2778
354 Ga0436365_0515067 3300039437 Bacteria 8098
355 Ga0436365_0637511 3300039437 Bacteria 4349
356 Ga0436360_0083811 3300039438 Bacteria 1008
357 Ga0436360_0233591 3300039438 Bacteria 891
358 Ga0436360_0720021 3300039438 Bacteria 631
359 Ga0436360_0782729 3300039438 Bacteria 1908
360 Ga0436360_1216675 3300039438 Bacteria 2949
361 Ga0436361_0013304 3300039447 Bacteria 6402
362 Ga0436361_0045550 3300039447 Bacteria 6059
363 Ga0436361_0139917 3300039447 Bacteria 13997
364 Ga0436361_0454116 3300039447 Bacteria 1838
365 Ga0436361_0489723 3300039447 Bacteria 2207
366 Ga0436361_0576866 3300039447 Bacteria 1795
367 Ga0436361_0748724 3300039447 Bacteria 3193
368 Ga0436361_0949155 3300039447 Bacteria 2290
369 Ga0436361_1126612 3300039447 Bacteria 947
370 Ga0436363_0011233 3300039450 Bacteria 651
371 Ga0436363_0174154 3300039450 Bacteria 2710
372 Ga0436363_0592324 3300039450 Bacteria 4116
373 Ga0436363_1195746 3300039450 Bacteria 4163
374 Ga0436362_0021283 3300039453 Bacteria 754
375 Ga0436362_0392868 3300039453 Bacteria 1031
376 Ga0436362_0642399 3300039453 Bacteria 818
377 Ga0436362_0791764 3300039453 Bacteria 1590
378 Ga0451791_0549678 3300041451 Bacteria 887
379 Ga0450901_002541 3300042533 Bacteria 1955
380 Ga0466969_0000541 3300044656 Bacteria 20701
381 Ga0466972_0076887 3300044658 Bacteria 1590
382 Ga0466972_0140383 3300044658 Bacteria 1137
383 Ga0466965_0116477 3300044683 Bacteria 1377
384 Ga0466965_0445087 3300044683 Bacteria 721
385 Ga0466966_0000331 3300044684 Bacteria 30572
386 Ga0466961_0000865 3300044693 Bacteria 18902
387 Ga0466961_0218261 3300044693 Bacteria 1176
388 Ga0466963_0168974 3300044694 Bacteria 1524
389 Ga0466971_0004265 3300044719 Bacteria 6164
390 Ga0466970_0014290 3300044765 Bacteria 4073
391 Ga0466970_0035023 3300044765 Bacteria 2659
392 Ga0466957_0002645 3300044842 Bacteria 9673
393 Ga0466960_0088161 3300044901 Bacteria 1577
394 Ga0466960_0177763 3300044901 Bacteria 1152
395 Ga0466960_0506342 3300044901 Bacteria 708
396 Ga0466959_0000060 3300045049 Bacteria 76590
397 Ga0466959_0029931 3300045049 Bacteria 4032
398 Ga0466959_0071299 3300045049 Bacteria 2516
399 Ga0466959_0282328 3300045049 Bacteria 1139
400 Ga0466958_0000608 3300045836 Bacteria 15284
401 Ga0495627_000679 3300046453 Bacteria 26196
402 Ga0495590_0003147 3300046457 Bacteria 6750
403 Ga0495638_0000410 3300046460 Bacteria 52445
404 Ga0495585_0213770 3300046492 Bacteria 976
405 Ga0495594_0586154 3300046499 Bacteria 632
406 Ga0495606_0042539 3300046507 Bacteria 3037
407 Ga0495610_0001127 3300046512 Bacteria 24387
408 Ga0495610_0005231 3300046512 Bacteria 9284
409 Ga0495631_0007644 3300046518 Bacteria 5490
410 Ga0495643_0099269 3300046522 Bacteria 1494
411 Ga0495648_0224425 3300046524 Bacteria 924
412 Ga0495663_0011286 3300046525 Bacteria 2487
413 Ga0495642_0002098 3300046528 Bacteria 8249
414 Ga0495597_0036777 3300046542 Bacteria 2202
415 Ga0495633_0004109 3300046558 Bacteria 9390
416 Ga0495668_0062412 3300046616 Bacteria 2053
417 Ga0495668_0083381 3300046616 Bacteria 1753
418 Ga0495668_0120819 3300046616 Bacteria 1433
419 Ga0495625_0005967 3300046660 Bacteria 10949
420 Ga0495625_0007454 3300046660 Bacteria 9515
421 Ga0495625_0216272 3300046660 Bacteria 1257
422 Ga0495669_0000003 3300046684 Bacteria 267741
423 Ga0495669_0000739 3300046684 Bacteria 14058
424 Ga0495670_0272300 3300046691 Bacteria 905
425 Ga0495671_0066946 3300046692 Bacteria 1767
426 Ga0495649_0209311 3300046694 Bacteria 1011
427 Ga0495589_0004653 3300046794 Bacteria 7293
428 Ga0495672_0001824 3300047320 Bacteria 20383
429 Ga0495677_0011855 3300047445 Bacteria 3184
430 Ga0495673_0000094 3300047469 Bacteria 183868
431 Ga0495673_0000461 3300047469 Bacteria 44189
432 Ga0495686_0000825 3300047472 Bacteria 39868
433 Ga0495686_0067410 3300047472 Bacteria 2209
434 Ga0495686_0067737 3300047472 Bacteria 2203
435 Ga0495686_0116583 3300047472 Bacteria 1596
436 Ga0495686_0329276 3300047472 Bacteria 835
437 Ga0496101_1369300 3300048904 Bacteria 552
438 Ga0496102_0712202 3300048905 Bacteria 927
439 Ga0496102_0798465 3300048905 Bacteria 866
440 Ga0496104_0284401 3300048907 Bacteria 1567
441 Ga0496104_0287015 3300048907 Bacteria 1558
442 Ga0496105_0346126 3300048908 Bacteria 1188
443 Ga0496106_0330370 3300048909 Bacteria 1224
444 Ga0496106_0843698 3300048909 Bacteria 725
445 Ga0496106_0958353 3300048909 Bacteria 674
446 Ga0496107_0027818 3300048910 Bacteria 4017
447 Ga0496108_0433611 3300048911 Bacteria 1148
448 Ga0496110_0063357 3300048913 Bacteria 3267
449 Ga0496111_0268974 3300048914 Bacteria 1264
450 Ga0496111_0591316 3300048914 Bacteria 813
451 Ga0496114_0348232 3300048917 Bacteria 1310
452 Ga0496114_0446240 3300048917 Bacteria 1146
453 Ga0496115_0229607 3300048918 Bacteria 1531
454 Ga0496116_0021009 3300048919 Bacteria 4937
455 Ga0496116_0067713 3300048919 Bacteria 2279
456 Ga0496117_0231422 3300048920 Bacteria 1021
457 Ga0496118_0023267 3300048921 Bacteria 5387
458 Ga0496119_0107241 3300048922 Bacteria 1558
459 Ga0496120_0304819 3300048923 Bacteria 728
460 Ga0496121_0000009 3300048924 Bacteria 836971
461 Ga0496121_0092159 3300048924 Bacteria 2363
462 Ga0496121_0160863 3300048924 Bacteria 1642
463 Ga0496122_0002320 3300048925 Bacteria 27466
464 Ga0496122_0003460 3300048925 Bacteria 20763
465 Ga0496122_0197945 3300048925 Bacteria 1178
466 Ga0496123_0000975 3300048926 Bacteria 44171
467 Ga0496123_0001110 3300048926 Bacteria 40337
468 Ga0496123_0083086 3300048926 Bacteria 1938
469 Ga0496123_0218205 3300048926 Bacteria 964
470 Ga0496124_0054334 3300048927 Bacteria 3390
471 Ga0496124_0249429 3300048927 Bacteria 1314
472 Ga0496125_0000598 3300048928 Bacteria 61438
473 Ga0496125_0000891 3300048928 Bacteria 47340
474 Ga0496125_0034792 3300048928 Bacteria 4433
475 Ga0496125_0304649 3300048928 Bacteria 974
476 Ga0496126_0006062 3300048929 Bacteria 13569
477 Ga0496126_0228958 3300048929 Bacteria 1558
478 Ga0496126_0616444 3300048929 Bacteria 853
479 Ga0495678_000723 3300049459 Bacteria 29969
480 Ga0501031_0074348 3300049568 Bacteria 2213
481 Ga0501031_0079455 3300049568 Bacteria 2137
482 Ga0501032_0026310 3300049569 Bacteria 4003
483 Ga0501033_0012650 3300049570 Bacteria 6437
484 Ga0501033_0012859 3300049570 Bacteria 6383
485 Ga0501033_0016676 3300049570 Bacteria 5556
486 Ga0501033_0079224 3300049570 Bacteria 2411
487 Ga0501033_0112837 3300049570 Bacteria 1977
488 Ga0501033_0225025 3300049570 Bacteria 1334
489 Ga0501033_0369099 3300049570 Bacteria 1004
490 Ga0501034_0010487 3300049571 Bacteria 9648
491 Ga0501034_0034201 3300049571 Bacteria 5153
492 Ga0501034_0049207 3300049571 Bacteria 4254
493 Ga0501034_0084652 3300049571 Bacteria 3172
494 Ga0501034_0089098 3300049571 Bacteria 3083
495 Ga0501034_0118303 3300049571 Bacteria 2637
496 Ga0501034_0125604 3300049571 Bacteria 2551
497 Ga0501034_0196940 3300049571 Bacteria 1974
498 Ga0501034_0349752 3300049571 Bacteria 1406
499 Ga0501034_0385151 3300049571 Bacteria 1327
500 Ga0501034_0533885 3300049571 Bacteria 1084
501 Ga0501034_0585394 3300049571 Bacteria 1022
502 Ga0501034_0657200 3300049571 Bacteria 949
503 Ga0501034_0729405 3300049571 Bacteria 888
504 Ga0501034_1067162 3300049571 Bacteria 690
505 Ga0501036_0036952 3300049572 Bacteria 4131
506 Ga0501036_0290459 3300049572 Bacteria 1368
507 Ga0501037_0090176 3300049573 Bacteria 2218
508 Ga0501037_0123951 3300049573 Bacteria 1856
509 Ga0501037_0175377 3300049573 Bacteria 1522
510 Ga0501038_0013230 3300049574 Bacteria 7526
511 Ga0501038_0687432 3300049574 Bacteria 768
512 Ga0501039_0027081 3300049575 Bacteria 4408
513 Ga0501039_0211476 3300049575 Bacteria 1525
514 Ga0501043_0047761 3300049579 Bacteria 3365
515 Ga0501043_0075517 3300049579 Bacteria 2647
516 Ga0501043_0105912 3300049579 Bacteria 2209
517 Ga0501043_0255302 3300049579 Bacteria 1349
518 Ga0501046_0598556 3300049580 Bacteria 783
519 Ga0501047_0000935 3300049581 Bacteria 29624
520 Ga0501047_0253705 3300049581 Bacteria 1607
521 Ga0501047_0474568 3300049581 Bacteria 1079
522 Ga0501047_0762909 3300049581 Bacteria 783
523 Ga0501047_0983726 3300049581 Bacteria 657
524 Ga0501069_0205270 3300049585 Bacteria 1143
525 Ga0501070_0012588 3300049586 Bacteria 7137
526 Ga0501070_0028405 3300049586 Bacteria 4691
527 Ga0501070_0050209 3300049586 Bacteria 3463
528 Ga0501070_0096180 3300049586 Bacteria 2450
529 Ga0501071_0189654 3300049587 Bacteria 1542
530 Ga0501073_0141826 3300049589 Bacteria 1665
531 Ga0501073_0234761 3300049589 Bacteria 1267
532 Ga0501074_0217983 3300049590 Bacteria 1359
533 Ga0501198_025959 3300049649 Bacteria 955
534 Ga0501035_0009054 3300049822 Bacteria 9258
535 Ga0501035_0030078 3300049822 Bacteria 4951
536 Ga0501035_0058181 3300049822 Bacteria 3445
537 Ga0501035_0064283 3300049822 Bacteria 3261
538 Ga0501044_0011625 3300049823 Bacteria 9539
539 Ga0501044_0100455 3300049823 Bacteria 2911
540 Ga0501044_0221273 3300049823 Bacteria 1843
541 Ga0501044_0528495 3300049823 Bacteria 1079
542 Ga0501044_0661662 3300049823 Bacteria 933
543 Ga0501044_0664518 3300049823 Bacteria 930
544 Ga0501044_0875916 3300049823 Bacteria 774
545 nmdc:mga03683_271049_c1 3300050489 Bacteria 792
546 nmdc:mga03n38_15829_c1 3300050490 Bacteria 2920
547 nmdc:mga00v17_2096_c1 3300050491 Bacteria 10260
548 nmdc:mga00v17_401458_c1 3300050491 Bacteria 891
549 nmdc:mga0k408_125401_c1 3300050493 Bacteria 1523
550 nmdc:mga0k408_233128_c1 3300050493 Bacteria 1099
551 nmdc:mga0k408_86697_c1 3300050493 Bacteria 1838
552 nmdc:mga06z11_331002_c1 3300050494 Bacteria 910
553 nmdc:mga07m45_157559_c1 3300050496 Bacteria 1318
554 nmdc:mga07m45_19749_c1 3300050496 Bacteria 3653
555 nmdc:mga0sz30_25730_c1 3300050516 Bacteria 2408
556 Ga0500635_0001105 3300053080 Bacteria 6444
557 Ga0500635_0080510 3300053080 Bacteria 1170
558 Ga0500578_0001050 3300053086 Bacteria 30142
559 Ga0500643_001504 3300053087 Bacteria 13345
560 Ga0500643_021399 3300053087 Bacteria 2097
561 Ga0500643_028836 3300053087 Bacteria 1713
562 Ga0500644_0000261 3300053088 Bacteria 29859
563 Ga0500583_0186981 3300053092 Bacteria 1031
564 Ga0500566_0335249 3300053094 Bacteria 699
565 Ga0500556_0002082 3300053104 Bacteria 6890
566 Ga0500557_027697 3300053105 Bacteria 1687
567 Ga0500562_001386 3300053108 Bacteria 5977
568 Ga0500562_003362 3300053108 Bacteria 4004
569 Ga0500593_000068 3300053117 Bacteria 38366
570 Ga0500594_0000084 3300053118 Bacteria 28710
571 Ga0500595_070070 3300053119 Bacteria 1042
572 Ga0500608_000101 3300053122 Bacteria 34992
573 Ga0500608_000703 3300053122 Bacteria 12269
574 Ga0500658_0003186 3300053134 Bacteria 6251
575 Ga0500658_0008454 3300053134 Bacteria 3802
576 Ga0500559_0000035 3300053136 Bacteria 110851
577 Ga0500559_0009422 3300053136 Bacteria 4227
578 Ga0500559_0414913 3300053136 Bacteria 625
579 Ga0500564_000062 3300053138 Bacteria 29161
580 Ga0500568_0000001 3300053139 Bacteria 988705
581 Ga0500577_0025503 3300053142 Bacteria 2002
582 Ga0500588_0046654 3300053146 Bacteria 1333
583 Ga0500604_0000891 3300053151 Bacteria 8250
584 Ga0500604_0021892 3300053151 Bacteria 1811
585 Ga0500616_0007858 3300053153 Bacteria 6713
586 Ga0500616_0027528 3300053153 Bacteria 3138
587 Ga0500616_0181039 3300053153 Bacteria 949
588 Ga0500622_0005784 3300053156 Bacteria 7333
589 Ga0500622_0007032 3300053156 Bacteria 6438
590 Ga0500622_0025845 3300053156 Bacteria 3100
591 Ga0500634_0000019 3300053161 Bacteria 109764
592 Ga0500636_0003943 3300053177 Bacteria 8369
593 Ga0500645_000433 3300053730 Bacteria 28666
594 Ga0500645_003917 3300053730 Bacteria 5874
595 Ga0500645_028662 3300053730 Bacteria 1684
596 Ga0466962_0014456 3300061719 Bacteria 3805
597 Ga0466962_0142779 3300061719 Bacteria 1160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0720021 Ga0436360_0720021_96_617 163
2 3300048904 Ga0496101_1369300 Ga0496101_1369300_10_534 171
3 3300053134 Ga0500658_0008454 Ga0500658_0008454_1737_2321 173
4 3300048926 Ga0496123_0218205 Ga0496123_0218205_342_926 181
5 3300049572 Ga0501036_0290459 Ga0501036_0290459_786_1352 182
6 3300049573 Ga0501037_0090176 Ga0501037_0090176_744_1301 182
7 3300031903 Ga0307407_10016857 Ga0307407_100168572 186
8 3300031911 Ga0307412_10017451 Ga0307412_100174511 186
9 3300047472 Ga0495686_0067410 Ga0495686_0067410_456_1040 186
10 3300053153 Ga0500616_0181039 Ga0500616_0181039_42_626 186
11 3300049570 Ga0501033_0016676 Ga0501033_0016676_854_1438 188
12 3300049571 Ga0501034_0089098 Ga0501034_0089098_1413_1997 188
13 3300049579 Ga0501043_0047761 Ga0501043_0047761_994_1578 188
14 3300049581 Ga0501047_0253705 Ga0501047_0253705_974_1558 188
15 3300049586 Ga0501070_0050209 Ga0501070_0050209_2647_3231 188
16 3300049822 Ga0501035_0030078 Ga0501035_0030078_3221_3805 188
17 3300049823 Ga0501044_0100455 Ga0501044_0100455_911_1495 188
18 iso_pu_bacteria 2508501050 2508732626 189
19 iso_pu_bacteria 2508501114 2509078244 189
20 iso_pu_bacteria 2585428106 2587919688 189
21 iso_pu_bacteria 2643221598 2644000383 189
22 iso_pu_bacteria 2643221614 2644084853 189
23 iso_pu_bacteria 2643221640 2644226378 189
24 iso_pu_bacteria 2643221642 2644235866 189
25 iso_pu_bacteria 2643221661 2644342405 189
26 iso_pu_bacteria 2643221666 2644365705 189
27 iso_pu_bacteria 2643221733 2644728334 189
28 iso_pu_bacteria 2739367756 2739791436 189
29 iso_pu_bacteria 2773857925 2774873958 189
30 iso_pu_bacteria 2775506901 2776259493 189
31 iso_pu_bacteria 2791355048 2792459612 189
32 iso_pu_bacteria 2835312727 2835315017 189
33 iso_pu_bacteria 2841911363 2841916231 189
34 iso_pu_bacteria 2841917233 2841921100 189
35 iso_pu_bacteria 2843744320 2843747267 189
36 iso_pu_bacteria 2849560528 2849560806 189
37 iso_pu_bacteria 2849573788 2849574324 189
38 iso_pu_bacteria 2851153111 2851158050 189
39 iso_pu_bacteria 2857504554 2857506693 189
40 iso_pu_bacteria 2882456835 2882459148 189
41 iso_pu_bacteria 2884298095 2884299745 189
42 iso_pu_bacteria 2894232714 2894234455 189
43 iso_pu_bacteria 2898329390 2898333436 189
44 iso_pu_bacteria 2919450847 2919455433 189
45 iso_pu_bacteria 2928531327 2928534479 189
46 iso_pu_bacteria 2928972540 2928974905 189
47 iso_pu_bacteria 2941485952 2941487342 189
48 iso_pu_bacteria 2977240413 2977242051 189
49 3300006881 Ga0068865_100290751 Ga0068865_1002907512 192
50 3300049581 Ga0501047_0000935 Ga0501047_0000935_3079_3660 192
51 3300003322 rootL2_10057694 rootL2_100576945 193
52 3300003323 rootH1_10011442 rootH1_100114422 193
53 3300003323 rootH1_10015864 rootH1_100158642 193
54 3300003323 rootH1_10137886 rootH1_101378862 193
55 3300003781 Ga0055536_1001488 Ga0055536_10014882 193
56 3300003781 Ga0055536_1023344 Ga0055536_10233442 193
57 3300003791 Ga0055530_10004254 Ga0055530_100042547 193
58 3300003791 Ga0055530_10022701 Ga0055530_100227012 193
59 3300003792 Ga0055540_1056897 Ga0055540_10568971 193
60 3300003794 Ga0055531_10002053 Ga0055531_100020532 193
61 3300003794 Ga0055531_10079723 Ga0055531_100797231 193
62 3300005331 Ga0070670_100143104 Ga0070670_1001431042 193
63 3300005335 Ga0070666_10376886 Ga0070666_103768862 193
64 3300005339 Ga0070660_100181721 Ga0070660_1001817212 193
65 3300005347 Ga0070668_100001523 Ga0070668_1000015237 193
66 3300005347 Ga0070668_100001873 Ga0070668_1000018738 193
67 3300005347 Ga0070668_100009206 Ga0070668_1000092063 193
68 3300005347 Ga0070668_100021251 Ga0070668_1000212514 193
69 3300005347 Ga0070668_100053007 Ga0070668_1000530072 193
70 3300005347 Ga0070668_100195401 Ga0070668_1001954012 193
71 3300005353 Ga0070669_100002957 Ga0070669_1000029578 193
72 3300005353 Ga0070669_100152662 Ga0070669_1001526622 193
73 3300005355 Ga0070671_100006167 Ga0070671_1000061679 193
74 3300005366 Ga0070659_100116854 Ga0070659_1001168544 193
75 3300005367 Ga0070667_100017619 Ga0070667_1000176193 193
76 3300005435 Ga0070714_100488578 Ga0070714_1004885781 193
77 3300005437 Ga0070710_10211727 Ga0070710_102117272 193
78 3300005441 Ga0070700_100237614 Ga0070700_1002376142 193
79 3300005455 Ga0070663_100874114 Ga0070663_1008741141 193
80 3300005468 Ga0070707_100014042 Ga0070707_1000140426 193
81 3300005471 Ga0070698_100644222 Ga0070698_1006442222 193
82 3300005548 Ga0070665_100002649 Ga0070665_10000264914 193
83 3300005548 Ga0070665_100140371 Ga0070665_1001403712 193
84 3300005548 Ga0070665_100236858 Ga0070665_1002368583 193
85 3300005548 Ga0070665_100281837 Ga0070665_1002818372 193
86 3300005578 Ga0068854_101068259 Ga0068854_1010682591 193
87 3300005614 Ga0068856_100495673 Ga0068856_1004956732 193
88 3300005614 Ga0068856_100782232 Ga0068856_1007822322 193
89 3300005617 Ga0068859_100000320 Ga0068859_10000032025 193
90 3300005617 Ga0068859_100018700 Ga0068859_1000187004 193
91 3300005617 Ga0068859_100074227 Ga0068859_1000742275 193
92 3300005617 Ga0068859_100296597 Ga0068859_1002965972 193
93 3300005617 Ga0068859_100538641 Ga0068859_1005386412 193
94 3300005618 Ga0068864_100918894 Ga0068864_1009188942 193
95 3300005719 Ga0068861_100207938 Ga0068861_1002079382 193
96 3300005841 Ga0068863_100019466 Ga0068863_1000194667 193
97 3300005841 Ga0068863_100078754 Ga0068863_1000787542 193
98 3300005842 Ga0068858_100002660 Ga0068858_10000266010 193
99 3300005843 Ga0068860_100000145 Ga0068860_10000014523 193
100 3300005843 Ga0068860_100846578 Ga0068860_1008465782 193
101 3300005844 Ga0068862_100014354 Ga0068862_1000143542 193
102 3300005844 Ga0068862_100033211 Ga0068862_1000332113 193
103 3300005844 Ga0068862_100038066 Ga0068862_1000380663 193
104 3300005844 Ga0068862_100040435 Ga0068862_1000404352 193
105 3300005844 Ga0068862_100045431 Ga0068862_1000454315 193
106 3300005844 Ga0068862_100103711 Ga0068862_1001037112 193
107 3300005844 Ga0068862_100657661 Ga0068862_1006576611 193
108 3300005937 Ga0081455_10077799 Ga0081455_100777993 193
109 3300006042 Ga0075368_10016396 Ga0075368_100163964 193
110 3300006051 Ga0075364_10001440 Ga0075364_1000144013 193
111 3300006051 Ga0075364_10593347 Ga0075364_105933472 193
112 3300006175 Ga0070712_100487971 Ga0070712_1004879712 193
113 3300006178 Ga0075367_10001920 Ga0075367_100019206 193
114 3300006186 Ga0075369_10003644 Ga0075369_100036445 193
115 3300006186 Ga0075369_10097777 Ga0075369_100977772 193
116 3300006195 Ga0075366_10006638 Ga0075366_100066385 193
117 3300006195 Ga0075366_10204669 Ga0075366_102046692 193
118 3300006353 Ga0075370_10083369 Ga0075370_100833693 193
119 3300006931 Ga0097620_100000320 Ga0097620_10000032025 193
120 3300006931 Ga0097620_100018700 Ga0097620_1000187004 193
121 3300006931 Ga0097620_100074227 Ga0097620_1000742275 193
122 3300006931 Ga0097620_100538676 Ga0097620_1005386762 193
123 3300006946 Ga0079104_1025229 Ga0079104_10252291 193
124 3300009093 Ga0105240_10086678 Ga0105240_100866786 193
125 3300009093 Ga0105240_10129675 Ga0105240_101296755 193
126 3300009093 Ga0105240_10289906 Ga0105240_102899062 193
127 3300009093 Ga0105240_10595426 Ga0105240_105954262 193
128 3300009177 Ga0105248_10000963 Ga0105248_1000096329 193
129 3300009177 Ga0105248_10010557 Ga0105248_100105579 193
130 3300009177 Ga0105248_10021645 Ga0105248_100216454 193
131 3300009177 Ga0105248_10519193 Ga0105248_105191931 193
132 3300009545 Ga0105237_10095538 Ga0105237_100955382 193
133 3300009545 Ga0105237_10466380 Ga0105237_104663802 193
134 3300009545 Ga0105237_10535374 Ga0105237_105353742 193
135 3300009545 Ga0105237_10571612 Ga0105237_105716122 193
136 3300009551 Ga0105238_10284325 Ga0105238_102843252 193
137 3300009551 Ga0105238_10548610 Ga0105238_105486102 193
138 3300009553 Ga0105249_10115368 Ga0105249_101153682 193
139 3300009553 Ga0105249_10252016 Ga0105249_102520162 193
140 3300009553 Ga0105249_10301449 Ga0105249_103014492 193
141 3300010375 Ga0105239_10146761 Ga0105239_101467612 193
142 3300013100 Ga0157373_10016485 Ga0157373_100164852 193
143 3300013100 Ga0157373_10138714 Ga0157373_101387143 193
144 3300013102 Ga0157371_10015467 Ga0157371_100154677 193
145 3300013104 Ga0157370_10012975 Ga0157370_100129753 193
146 3300013104 Ga0157370_10355413 Ga0157370_103554132 193
147 3300013105 Ga0157369_10018266 Ga0157369_100182667 193
148 3300013306 Ga0163162_10061259 Ga0163162_100612593 193
149 3300013306 Ga0163162_10599138 Ga0163162_105991382 193
150 3300014325 Ga0163163_10065083 Ga0163163_100650835 193
151 3300014325 Ga0163163_10202242 Ga0163163_102022421 193
152 3300014326 Ga0157380_10058149 Ga0157380_100581493 193
153 3300014968 Ga0157379_10140423 Ga0157379_101404232 193
154 3300015262 Ga0182007_10079674 Ga0182007_100796742 193
155 3300015684 Ga0183365_10002 Ga0183365_10002167 193
156 3300021358 Ga0213873_10043493 Ga0213873_100434932 193
157 3300021361 Ga0213872_10008208 Ga0213872_100082085 193
158 3300021361 Ga0213872_10018300 Ga0213872_100183003 193
159 3300021361 Ga0213872_10031777 Ga0213872_100317772 193
160 3300021361 Ga0213872_10184137 Ga0213872_101841371 193
161 3300021384 Ga0213876_10045939 Ga0213876_100459394 193
162 3300021441 Ga0213871_10055471 Ga0213871_100554712 193
163 3300025250 Ga0209026_1001304 Ga0209026_10013043 193
164 3300025292 Ga0209676_1000136 Ga0209676_10001362 193
165 3300025292 Ga0209676_1000200 Ga0209676_100020060 193
166 3300025295 Ga0209564_1050695 Ga0209564_10506952 193
167 3300025298 Ga0209050_1000057 Ga0209050_1000057177 193
168 3300025298 Ga0209050_1000568 Ga0209050_10005682 193
169 3300025299 Ga0209256_1016500 Ga0209256_10165004 193
170 3300025303 Ga0209051_1003331 Ga0209051_10033315 193
171 3300025304 Ga0209257_1000142 Ga0209257_10001422 193
172 3300025304 Ga0209257_1005736 Ga0209257_10057368 193
173 3300025304 Ga0209257_1018243 Ga0209257_10182431 193
174 3300025898 Ga0207692_10270105 Ga0207692_102701052 193
175 3300025913 Ga0207695_10052766 Ga0207695_100527662 193
176 3300025913 Ga0207695_10221172 Ga0207695_102211722 193
177 3300025913 Ga0207695_10361059 Ga0207695_103610591 193
178 3300025914 Ga0207671_10370418 Ga0207671_103704182 193
179 3300025919 Ga0207657_10420758 Ga0207657_104207582 193
180 3300025923 Ga0207681_10009092 Ga0207681_100090929 193
181 3300025923 Ga0207681_10166450 Ga0207681_101664502 193
182 3300025924 Ga0207694_10225407 Ga0207694_102254072 193
183 3300025927 Ga0207687_10629370 Ga0207687_106293701 193
184 3300025931 Ga0207644_10000767 Ga0207644_1000076713 193
185 3300025932 Ga0207690_10035108 Ga0207690_100351082 193
186 3300025933 Ga0207706_10374470 Ga0207706_103744702 193
187 3300025941 Ga0207711_10005066 Ga0207711_100050665 193
188 3300025941 Ga0207711_10063077 Ga0207711_100630774 193
189 3300025941 Ga0207711_10572266 Ga0207711_105722662 193
190 3300025949 Ga0207667_10787037 Ga0207667_107870372 193
191 3300025972 Ga0207668_10000007 Ga0207668_10000007123 193
192 3300025972 Ga0207668_10002156 Ga0207668_100021566 193
193 3300025972 Ga0207668_10003322 Ga0207668_1000332210 193
194 3300025972 Ga0207668_10072995 Ga0207668_100729951 193
195 3300025972 Ga0207668_10278344 Ga0207668_102783442 193
196 3300025986 Ga0207658_10005471 Ga0207658_1000547110 193
197 3300025986 Ga0207658_10103475 Ga0207658_101034753 193
198 3300026035 Ga0207703_10002382 Ga0207703_1000238213 193
199 3300026067 Ga0207678_10935349 Ga0207678_109353491 193
200 3300026078 Ga0207702_10378125 Ga0207702_103781252 193
201 3300026078 Ga0207702_10383623 Ga0207702_103836232 193
202 3300026088 Ga0207641_10012619 Ga0207641_100126198 193
203 3300026088 Ga0207641_10025693 Ga0207641_100256936 193
204 3300026116 Ga0207674_10994027 Ga0207674_109940271 193
205 3300026118 Ga0207675_100272175 Ga0207675_1002721752 193
206 3300026142 Ga0207698_10263771 Ga0207698_102637712 193
207 3300026142 Ga0207698_11098846 Ga0207698_110988461 193
208 3300027111 Ga0209281_1031761 Ga0209281_10317612 193
209 3300028379 Ga0268266_10001586 Ga0268266_100015867 193
210 3300028379 Ga0268266_10121980 Ga0268266_101219802 193
211 3300028379 Ga0268266_10226678 Ga0268266_102266781 193
212 3300028379 Ga0268266_10846245 Ga0268266_108462452 193
213 3300028380 Ga0268265_10002648 Ga0268265_100026487 193
214 3300028380 Ga0268265_10017263 Ga0268265_100172632 193
215 3300028380 Ga0268265_10060619 Ga0268265_100606192 193
216 3300028380 Ga0268265_10083228 Ga0268265_100832282 193
217 3300028380 Ga0268265_10663133 Ga0268265_106631332 193
218 3300028381 Ga0268264_10000046 Ga0268264_1000004671 193
219 3300028381 Ga0268264_10036495 Ga0268264_100364954 193
220 3300028786 Ga0307517_10116469 Ga0307517_101164692 193
221 3300028794 Ga0307515_10016872 Ga0307515_100168723 193
222 3300028794 Ga0307515_10160775 Ga0307515_101607753 193
223 3300028800 Ga0265338_10145997 Ga0265338_101459972 193
224 3300031235 Ga0265330_10011535 Ga0265330_100115352 193
225 3300031235 Ga0265330_10081518 Ga0265330_100815182 193
226 3300031249 Ga0265339_10014616 Ga0265339_100146165 193
227 3300031249 Ga0265339_10047391 Ga0265339_100473913 193
228 3300031456 Ga0307513_10008912 Ga0307513_100089129 193
229 3300031548 Ga0307408_100073359 Ga0307408_1000733591 193
230 3300031616 Ga0307508_10233124 Ga0307508_102331242 193
231 3300031711 Ga0265314_10244808 Ga0265314_102448082 193
232 3300031731 Ga0307405_10665239 Ga0307405_106652391 193
233 3300031824 Ga0307413_10017908 Ga0307413_100179085 193
234 3300031852 Ga0307410_10341749 Ga0307410_103417492 193
235 3300031901 Ga0307406_10122962 Ga0307406_101229622 193
236 3300031911 Ga0307412_10272764 Ga0307412_102727642 193
237 3300031911 Ga0307412_11094470 Ga0307412_110944701 193
238 3300031995 Ga0307409_100440591 Ga0307409_1004405911 193
239 3300032002 Ga0307416_100067027 Ga0307416_1000670273 193
240 3300032002 Ga0307416_101102601 Ga0307416_1011026012 193
241 3300032004 Ga0307414_10046511 Ga0307414_100465112 193
242 3300032004 Ga0307414_10274126 Ga0307414_102741262 193
243 3300032004 Ga0307414_10279859 Ga0307414_102798592 193
244 3300032004 Ga0307414_10316762 Ga0307414_103167622 193
245 3300032004 Ga0307414_10385895 Ga0307414_103858952 193
246 3300032004 Ga0307414_10985168 Ga0307414_109851682 193
247 3300035083 Ga0373926_0066292 Ga0373926_0066292_255_839 193
248 3300035170 Ga0373943_0203554 Ga0373943_0203554_189_773 193
249 3300035692 Ga0373935_0020591 Ga0373935_0020591_1041_1625 193
250 3300035695 Ga0373927_0002992 Ga0373927_0002992_4412_4996 193
251 3300035695 Ga0373927_0360734 Ga0373927_0360734_48_632 193
252 3300036647 Ga0316582_0189792 Ga0316582_0189792_502_1083 193
253 3300037068 Ga0373925_0000380 Ga0373925_0000380_16523_17107 193
254 3300037068 Ga0373925_1117448 Ga0373925_1117448_40_624 193
255 3300037471 Ga0395905_0000172 Ga0395905_0000172_51037_51624 193
256 3300037471 Ga0395905_0094930 Ga0395905_0094930_1151_1741 193
257 3300037471 Ga0395905_0146949 Ga0395905_0146949_323_910 193
258 3300038443 Ga0395901_0779429 Ga0395901_0779429_203_787 193
259 3300039437 Ga0436365_0358324 Ga0436365_0358324_70_678 193
260 3300039437 Ga0436365_0515067 Ga0436365_0515067_1620_2225 193
261 3300039437 Ga0436365_0637511 Ga0436365_0637511_1630_2214 193
262 3300039438 Ga0436360_0083811 Ga0436360_0083811_179_796 193
263 3300039438 Ga0436360_0233591 Ga0436360_0233591_241_846 193
264 3300039438 Ga0436360_0782729 Ga0436360_0782729_1015_1608 193
265 3300039438 Ga0436360_1216675 Ga0436360_1216675_1037_1639 193
266 3300039447 Ga0436361_0013304 Ga0436361_0013304_2114_2698 193
267 3300039447 Ga0436361_0045550 Ga0436361_0045550_4592_5194 193
268 3300039447 Ga0436361_0139917 Ga0436361_0139917_7432_8016 193
269 3300039447 Ga0436361_0454116 Ga0436361_0454116_769_1359 193
270 3300039447 Ga0436361_0489723 Ga0436361_0489723_934_1545 193
271 3300039447 Ga0436361_0576866 Ga0436361_0576866_157_750 193
272 3300039447 Ga0436361_0748724 Ga0436361_0748724_2217_2801 193
273 3300039447 Ga0436361_0949155 Ga0436361_0949155_434_1051 193
274 3300039447 Ga0436361_1126612 Ga0436361_1126612_100_693 193
275 3300039450 Ga0436363_0011233 Ga0436363_0011233_12_620 193
276 3300039450 Ga0436363_0174154 Ga0436363_0174154_1701_2282 193
277 3300039450 Ga0436363_0592324 Ga0436363_0592324_1504_2121 193
278 3300039450 Ga0436363_1195746 Ga0436363_1195746_3252_3860 193
279 3300039453 Ga0436362_0021283 Ga0436362_0021283_16_609 193
280 3300039453 Ga0436362_0392868 Ga0436362_0392868_286_891 193
281 3300039453 Ga0436362_0642399 Ga0436362_0642399_113_715 193
282 3300039453 Ga0436362_0791764 Ga0436362_0791764_650_1243 193
283 3300042533 Ga0450901_002541 Ga0450901_002541_503_1087 193
284 3300044656 Ga0466969_0000541 Ga0466969_0000541_9352_9939 193
285 3300044658 Ga0466972_0076887 Ga0466972_0076887_27_614 193
286 3300044658 Ga0466972_0140383 Ga0466972_0140383_162_746 193
287 3300044683 Ga0466965_0116477 Ga0466965_0116477_403_990 193
288 3300044683 Ga0466965_0445087 Ga0466965_0445087_84_668 193
289 3300044684 Ga0466966_0000331 Ga0466966_0000331_10768_11355 193
290 3300044693 Ga0466961_0000865 Ga0466961_0000865_7691_8278 193
291 3300044693 Ga0466961_0218261 Ga0466961_0218261_272_859 193
292 3300044694 Ga0466963_0168974 Ga0466963_0168974_737_1324 193
293 3300044719 Ga0466971_0004265 Ga0466971_0004265_4979_5566 193
294 3300044765 Ga0466970_0014290 Ga0466970_0014290_779_1366 193
295 3300044765 Ga0466970_0035023 Ga0466970_0035023_135_722 193
296 3300044842 Ga0466957_0002645 Ga0466957_0002645_1381_1968 193
297 3300044901 Ga0466960_0088161 Ga0466960_0088161_717_1304 193
298 3300044901 Ga0466960_0177763 Ga0466960_0177763_56_646 193
299 3300044901 Ga0466960_0506342 Ga0466960_0506342_40_624 193
300 3300045049 Ga0466959_0000060 Ga0466959_0000060_10768_11355 193
301 3300045049 Ga0466959_0029931 Ga0466959_0029931_529_1137 193
302 3300045049 Ga0466959_0071299 Ga0466959_0071299_567_1154 193
303 3300045049 Ga0466959_0282328 Ga0466959_0282328_166_750 193
304 3300045836 Ga0466958_0000608 Ga0466958_0000608_7354_7941 193
305 3300046453 Ga0495627_000679 Ga0495627_000679_3335_3919 193
306 3300046457 Ga0495590_0003147 Ga0495590_0003147_4712_5299 193
307 3300046460 Ga0495638_0000410 Ga0495638_0000410_4944_5528 193
308 3300046492 Ga0495585_0213770 Ga0495585_0213770_31_615 193
309 3300046499 Ga0495594_0586154 Ga0495594_0586154_17_601 193
310 3300046507 Ga0495606_0042539 Ga0495606_0042539_1171_1755 193
311 3300046512 Ga0495610_0001127 Ga0495610_0001127_5406_5993 193
312 3300046512 Ga0495610_0005231 Ga0495610_0005231_6207_6791 193
313 3300046518 Ga0495631_0007644 Ga0495631_0007644_3609_4196 193
314 3300046522 Ga0495643_0099269 Ga0495643_0099269_460_1044 193
315 3300046524 Ga0495648_0224425 Ga0495648_0224425_246_830 193
316 3300046525 Ga0495663_0011286 Ga0495663_0011286_91_675 193
317 3300046528 Ga0495642_0002098 Ga0495642_0002098_3869_4453 193
318 3300046542 Ga0495597_0036777 Ga0495597_0036777_1570_2157 193
319 3300046558 Ga0495633_0004109 Ga0495633_0004109_4166_4750 193
320 3300046616 Ga0495668_0062412 Ga0495668_0062412_1271_1858 193
321 3300046616 Ga0495668_0083381 Ga0495668_0083381_37_621 193
322 3300046616 Ga0495668_0120819 Ga0495668_0120819_34_624 193
323 3300046660 Ga0495625_0005967 Ga0495625_0005967_1398_1982 193
324 3300046660 Ga0495625_0007454 Ga0495625_0007454_1816_2400 193
325 3300046660 Ga0495625_0216272 Ga0495625_0216272_319_903 193
326 3300046684 Ga0495669_0000003 Ga0495669_0000003_64660_65256 193
327 3300046684 Ga0495669_0000739 Ga0495669_0000739_4557_5153 193
328 3300046691 Ga0495670_0272300 Ga0495670_0272300_211_795 193
329 3300046692 Ga0495671_0066946 Ga0495671_0066946_804_1391 193
330 3300046794 Ga0495589_0004653 Ga0495589_0004653_4473_5057 193
331 3300047320 Ga0495672_0001824 Ga0495672_0001824_6891_7475 193
332 3300047445 Ga0495677_0011855 Ga0495677_0011855_711_1307 193
333 3300047469 Ga0495673_0000094 Ga0495673_0000094_13566_14150 193
334 3300047469 Ga0495673_0000461 Ga0495673_0000461_17260_17847 193
335 3300047472 Ga0495686_0000825 Ga0495686_0000825_15125_15712 193
336 3300047472 Ga0495686_0067737 Ga0495686_0067737_268_849 193
337 3300047472 Ga0495686_0116583 Ga0495686_0116583_569_1156 193
338 3300048905 Ga0496102_0712202 Ga0496102_0712202_270_854 193
339 3300048905 Ga0496102_0798465 Ga0496102_0798465_55_660 193
340 3300048907 Ga0496104_0284401 Ga0496104_0284401_98_703 193
341 3300048907 Ga0496104_0287015 Ga0496104_0287015_412_1017 193
342 3300048908 Ga0496105_0346126 Ga0496105_0346126_182_772 193
343 3300048909 Ga0496106_0330370 Ga0496106_0330370_151_735 193
344 3300048909 Ga0496106_0843698 Ga0496106_0843698_94_699 193
345 3300048910 Ga0496107_0027818 Ga0496107_0027818_2981_3586 193
346 3300048911 Ga0496108_0433611 Ga0496108_0433611_241_846 193
347 3300048913 Ga0496110_0063357 Ga0496110_0063357_827_1426 193
348 3300048914 Ga0496111_0268974 Ga0496111_0268974_638_1237 193
349 3300048914 Ga0496111_0591316 Ga0496111_0591316_36_620 193
350 3300048917 Ga0496114_0348232 Ga0496114_0348232_636_1220 193
351 3300048917 Ga0496114_0446240 Ga0496114_0446240_158_742 193
352 3300048918 Ga0496115_0229607 Ga0496115_0229607_483_1088 193
353 3300048919 Ga0496116_0021009 Ga0496116_0021009_3646_4230 193
354 3300048919 Ga0496116_0067713 Ga0496116_0067713_1334_1933 193
355 3300048920 Ga0496117_0231422 Ga0496117_0231422_93_677 193
356 3300048921 Ga0496118_0023267 Ga0496118_0023267_4107_4691 193
357 3300048922 Ga0496119_0107241 Ga0496119_0107241_412_996 193
358 3300048923 Ga0496120_0304819 Ga0496120_0304819_18_602 193
359 3300048924 Ga0496121_0000009 Ga0496121_0000009_629497_630081 193
360 3300048924 Ga0496121_0092159 Ga0496121_0092159_367_966 193
361 3300048925 Ga0496122_0002320 Ga0496122_0002320_834_1418 193
362 3300048925 Ga0496122_0003460 Ga0496122_0003460_17149_17742 193
363 3300048925 Ga0496122_0197945 Ga0496122_0197945_109_693 193
364 3300048926 Ga0496123_0000975 Ga0496123_0000975_20410_21003 193
365 3300048926 Ga0496123_0001110 Ga0496123_0001110_27559_28143 193
366 3300048926 Ga0496123_0083086 Ga0496123_0083086_994_1578 193
367 3300048927 Ga0496124_0054334 Ga0496124_0054334_1430_2014 193
368 3300048927 Ga0496124_0249429 Ga0496124_0249429_379_978 193
369 3300048928 Ga0496125_0000598 Ga0496125_0000598_27081_27665 193
370 3300048928 Ga0496125_0000891 Ga0496125_0000891_45386_45985 193
371 3300048928 Ga0496125_0304649 Ga0496125_0304649_197_781 193
372 3300048929 Ga0496126_0006062 Ga0496126_0006062_3008_3592 193
373 3300048929 Ga0496126_0228958 Ga0496126_0228958_490_1095 193
374 3300048929 Ga0496126_0616444 Ga0496126_0616444_45_629 193
375 3300049459 Ga0495678_000723 Ga0495678_000723_4714_5301 193
376 3300049568 Ga0501031_0074348 Ga0501031_0074348_423_1013 193
377 3300049570 Ga0501033_0012650 Ga0501033_0012650_825_1418 193
378 3300049570 Ga0501033_0112837 Ga0501033_0112837_198_785 193
379 3300049570 Ga0501033_0369099 Ga0501033_0369099_333_968 193
380 3300049571 Ga0501034_0010487 Ga0501034_0010487_577_1170 193
381 3300049571 Ga0501034_0125604 Ga0501034_0125604_1877_2464 193
382 3300049571 Ga0501034_0196940 Ga0501034_0196940_1342_1929 193
383 3300049571 Ga0501034_0533885 Ga0501034_0533885_17_601 193
384 3300049573 Ga0501037_0123951 Ga0501037_0123951_713_1309 193
385 3300049575 Ga0501039_0211476 Ga0501039_0211476_600_1190 193
386 3300049579 Ga0501043_0075517 Ga0501043_0075517_673_1260 193
387 3300049580 Ga0501046_0598556 Ga0501046_0598556_144_731 193
388 3300049581 Ga0501047_0762909 Ga0501047_0762909_146_733 193
389 3300049581 Ga0501047_0983726 Ga0501047_0983726_52_636 193
390 3300049822 Ga0501035_0064283 Ga0501035_0064283_2448_3059 193
391 3300049823 Ga0501044_0011625 Ga0501044_0011625_1594_2190 193
392 3300049823 Ga0501044_0528495 Ga0501044_0528495_259_924 193
393 3300049823 Ga0501044_0661662 Ga0501044_0661662_137_721 193
394 3300050490 nmdc:mga03n38_15829_c1 nmdc:mga03n38_15829_c1_404_988 193
395 3300050491 nmdc:mga00v17_2096_c1 nmdc:mga00v17_2096_c1_1759_2343 193
396 3300050493 nmdc:mga0k408_125401_c1 nmdc:mga0k408_125401_c1_42_626 193
397 3300050493 nmdc:mga0k408_233128_c1 nmdc:mga0k408_233128_c1_129_713 193
398 3300050493 nmdc:mga0k408_86697_c1 nmdc:mga0k408_86697_c1_512_1096 193
399 3300050494 nmdc:mga06z11_331002_c1 nmdc:mga06z11_331002_c1_10_594 193
400 3300050496 nmdc:mga07m45_157559_c1 nmdc:mga07m45_157559_c1_308_892 193
401 3300050496 nmdc:mga07m45_19749_c1 nmdc:mga07m45_19749_c1_1991_2575 193
402 3300050516 nmdc:mga0sz30_25730_c1 nmdc:mga0sz30_25730_c1_1573_2157 193
403 3300053080 Ga0500635_0001105 Ga0500635_0001105_2287_2874 193
404 3300053080 Ga0500635_0080510 Ga0500635_0080510_471_1055 193
405 3300053086 Ga0500578_0001050 Ga0500578_0001050_4951_5538 193
406 3300053087 Ga0500643_001504 Ga0500643_001504_8884_9468 193
407 3300053087 Ga0500643_021399 Ga0500643_021399_1004_1588 193
408 3300053087 Ga0500643_028836 Ga0500643_028836_107_697 193
409 3300053088 Ga0500644_0000261 Ga0500644_0000261_4736_5323 193
410 3300053092 Ga0500583_0186981 Ga0500583_0186981_16_600 193
411 3300053094 Ga0500566_0335249 Ga0500566_0335249_13_597 193
412 3300053104 Ga0500556_0002082 Ga0500556_0002082_1678_2262 193
413 3300053105 Ga0500557_027697 Ga0500557_027697_535_1125 193
414 3300053108 Ga0500562_001386 Ga0500562_001386_2874_3461 193
415 3300053108 Ga0500562_003362 Ga0500562_003362_2401_2991 193
416 3300053117 Ga0500593_000068 Ga0500593_000068_26506_27090 193
417 3300053118 Ga0500594_0000084 Ga0500594_0000084_5352_5939 193
418 3300053119 Ga0500595_070070 Ga0500595_070070_191_775 193
419 3300053122 Ga0500608_000101 Ga0500608_000101_3359_3943 193
420 3300053122 Ga0500608_000703 Ga0500608_000703_1134_1721 193
421 3300053134 Ga0500658_0003186 Ga0500658_0003186_5438_6022 193
422 3300053136 Ga0500559_0000035 Ga0500559_0000035_85167_85751 193
423 3300053136 Ga0500559_0009422 Ga0500559_0009422_3462_4046 193
424 3300053138 Ga0500564_000062 Ga0500564_000062_4978_5565 193
425 3300053139 Ga0500568_0000001 Ga0500568_0000001_731825_732409 193
426 3300053142 Ga0500577_0025503 Ga0500577_0025503_851_1435 193
427 3300053146 Ga0500588_0046654 Ga0500588_0046654_20_604 193
428 3300053151 Ga0500604_0000891 Ga0500604_0000891_3617_4207 193
429 3300053151 Ga0500604_0021892 Ga0500604_0021892_965_1555 193
430 3300053153 Ga0500616_0027528 Ga0500616_0027528_1752_2336 193
431 3300053156 Ga0500622_0005784 Ga0500622_0005784_5263_5850 193
432 3300053156 Ga0500622_0007032 Ga0500622_0007032_14_604 193
433 3300053156 Ga0500622_0025845 Ga0500622_0025845_778_1362 193
434 3300053177 Ga0500636_0003943 Ga0500636_0003943_791_1375 193
435 3300053730 Ga0500645_000433 Ga0500645_000433_4905_5495 193
436 3300053730 Ga0500645_003917 Ga0500645_003917_317_901 193
437 3300053730 Ga0500645_028662 Ga0500645_028662_67_651 193
438 3300061719 Ga0466962_0014456 Ga0466962_0014456_1853_2440 193
439 3300061719 Ga0466962_0142779 Ga0466962_0142779_512_1099 193
440 iso_pu_bacteria 8001845381 8001849592 193
441 3300001990 JGI24737J22298_10020329 JGI24737J22298_100203293 194
442 3300005327 Ga0070658_10003193 Ga0070658_100031939 194
443 3300005327 Ga0070658_10051907 Ga0070658_100519073 194
444 3300005329 Ga0070683_101299152 Ga0070683_1012991521 194
445 3300005338 Ga0068868_100085490 Ga0068868_1000854902 194
446 3300005339 Ga0070660_100020211 Ga0070660_1000202112 194
447 3300005344 Ga0070661_100010278 Ga0070661_1000102786 194
448 3300005344 Ga0070661_100139693 Ga0070661_1001396933 194
449 3300005344 Ga0070661_100265942 Ga0070661_1002659422 194
450 3300005356 Ga0070674_100033765 Ga0070674_1000337654 194
451 3300005364 Ga0070673_100040840 Ga0070673_1000408402 194
452 3300005366 Ga0070659_100011871 Ga0070659_1000118715 194
453 3300005366 Ga0070659_100588120 Ga0070659_1005881202 194
454 3300005455 Ga0070663_100165145 Ga0070663_1001651452 194
455 3300005455 Ga0070663_100220686 Ga0070663_1002206861 194
456 3300005458 Ga0070681_10656191 Ga0070681_106561911 194
457 3300005459 Ga0068867_100095022 Ga0068867_1000950222 194
458 3300005539 Ga0068853_100016117 Ga0068853_1000161174 194
459 3300005539 Ga0068853_100395341 Ga0068853_1003953411 194
460 3300005539 Ga0068853_100525366 Ga0068853_1005253662 194
461 3300005548 Ga0070665_100040636 Ga0070665_1000406364 194
462 3300005548 Ga0070665_100182479 Ga0070665_1001824792 194
463 3300005548 Ga0070665_100206966 Ga0070665_1002069662 194
464 3300005563 Ga0068855_100051527 Ga0068855_1000515272 194
465 3300005563 Ga0068855_100069067 Ga0068855_1000690673 194
466 3300005563 Ga0068855_100404789 Ga0068855_1004047892 194
467 3300005563 Ga0068855_100894990 Ga0068855_1008949902 194
468 3300005564 Ga0070664_100270774 Ga0070664_1002707742 194
469 3300005577 Ga0068857_100094674 Ga0068857_1000946744 194
470 3300005577 Ga0068857_100574568 Ga0068857_1005745682 194
471 3300005578 Ga0068854_100050912 Ga0068854_1000509122 194
472 3300005578 Ga0068854_100207173 Ga0068854_1002071732 194
473 3300005614 Ga0068856_100006548 Ga0068856_10000654811 194
474 3300005614 Ga0068856_100177061 Ga0068856_1001770612 194
475 3300005614 Ga0068856_100434444 Ga0068856_1004344442 194
476 3300005616 Ga0068852_100007967 Ga0068852_1000079675 194
477 3300005616 Ga0068852_100011884 Ga0068852_1000118842 194
478 3300005616 Ga0068852_100022732 Ga0068852_1000227324 194
479 3300005616 Ga0068852_101667760 Ga0068852_1016677601 194
480 3300005718 Ga0068866_10441740 Ga0068866_104417402 194
481 3300005834 Ga0068851_10011040 Ga0068851_100110403 194
482 3300005834 Ga0068851_10107300 Ga0068851_101073002 194
483 3300006038 Ga0075365_10410685 Ga0075365_104106852 194
484 3300006048 Ga0075363_100003257 Ga0075363_1000032574 194
485 3300006051 Ga0075364_10501048 Ga0075364_105010481 194
486 3300006195 Ga0075366_10015328 Ga0075366_100153281 194
487 3300006353 Ga0075370_10089343 Ga0075370_100893433 194
488 3300009093 Ga0105240_10354993 Ga0105240_103549932 194
489 3300009093 Ga0105240_10745436 Ga0105240_107454362 194
490 3300009098 Ga0105245_10905693 Ga0105245_109056932 194
491 3300009174 Ga0105241_10301354 Ga0105241_103013542 194
492 3300009174 Ga0105241_10555445 Ga0105241_105554452 194
493 3300009174 Ga0105241_10888484 Ga0105241_108884842 194
494 3300009545 Ga0105237_10000542 Ga0105237_100005422 194
495 3300009545 Ga0105237_10108306 Ga0105237_101083062 194
496 3300009551 Ga0105238_10024988 Ga0105238_100249887 194
497 3300009551 Ga0105238_10082229 Ga0105238_100822292 194
498 3300009551 Ga0105238_10092278 Ga0105238_100922784 194
499 3300009551 Ga0105238_10175478 Ga0105238_101754783 194
500 3300010375 Ga0105239_10006821 Ga0105239_100068215 194
501 3300010375 Ga0105239_10394994 Ga0105239_103949942 194
502 3300010375 Ga0105239_10579639 Ga0105239_105796392 194
503 3300013100 Ga0157373_10029125 Ga0157373_100291252 194
504 3300013102 Ga0157371_10010578 Ga0157371_100105787 194
505 3300013102 Ga0157371_10178687 Ga0157371_101786872 194
506 3300013104 Ga0157370_10054397 Ga0157370_100543976 194
507 3300013104 Ga0157370_10195787 Ga0157370_101957872 194
508 3300013104 Ga0157370_10590712 Ga0157370_105907122 194
509 3300013105 Ga0157369_10017421 Ga0157369_100174214 194
510 3300013105 Ga0157369_10123583 Ga0157369_101235834 194
511 3300013296 Ga0157374_10017264 Ga0157374_100172647 194
512 3300013297 Ga0157378_10545961 Ga0157378_105459612 194
513 3300013307 Ga0157372_10105890 Ga0157372_101058903 194
514 3300013307 Ga0157372_10253764 Ga0157372_102537641 194
515 3300013307 Ga0157372_10734204 Ga0157372_107342041 194
516 3300014969 Ga0157376_10711098 Ga0157376_107110982 194
517 3300025231 Ga0207427_102826 Ga0207427_1028264 194
518 3300025261 Ga0209233_1000811 Ga0209233_10008119 194
519 3300025303 Ga0209051_1046399 Ga0209051_10463992 194
520 3300025321 Ga0207656_10029238 Ga0207656_100292383 194
521 3300025321 Ga0207656_10068069 Ga0207656_100680692 194
522 3300025904 Ga0207647_10136776 Ga0207647_101367761 194
523 3300025907 Ga0207645_10039330 Ga0207645_100393304 194
524 3300025909 Ga0207705_10020685 Ga0207705_100206855 194
525 3300025909 Ga0207705_10078710 Ga0207705_100787104 194
526 3300025914 Ga0207671_10007454 Ga0207671_100074549 194
527 3300025919 Ga0207657_10010644 Ga0207657_100106448 194
528 3300025919 Ga0207657_10012881 Ga0207657_100128812 194
529 3300025919 Ga0207657_10021801 Ga0207657_100218013 194
530 3300025920 Ga0207649_10002314 Ga0207649_100023142 194
531 3300025920 Ga0207649_10014695 Ga0207649_100146956 194
532 3300025924 Ga0207694_10399021 Ga0207694_103990212 194
533 3300025924 Ga0207694_10418646 Ga0207694_104186462 194
534 3300025932 Ga0207690_10013115 Ga0207690_100131155 194
535 3300025932 Ga0207690_10166299 Ga0207690_101662992 194
536 3300025932 Ga0207690_10209326 Ga0207690_102093263 194
537 3300025937 Ga0207669_10020888 Ga0207669_100208883 194
538 3300025938 Ga0207704_10050272 Ga0207704_100502722 194
539 3300025940 Ga0207691_10048596 Ga0207691_100485962 194
540 3300025944 Ga0207661_10187454 Ga0207661_101874542 194
541 3300025949 Ga0207667_10004813 Ga0207667_1000481316 194
542 3300025949 Ga0207667_10059234 Ga0207667_100592343 194
543 3300025981 Ga0207640_10091502 Ga0207640_100915022 194
544 3300026041 Ga0207639_10002696 Ga0207639_1000269610 194
545 3300026041 Ga0207639_10184484 Ga0207639_101844843 194
546 3300026067 Ga0207678_10145892 Ga0207678_101458922 194
547 3300026067 Ga0207678_10489411 Ga0207678_104894111 194
548 3300026078 Ga0207702_10015251 Ga0207702_100152515 194
549 3300026078 Ga0207702_10176074 Ga0207702_101760743 194
550 3300026078 Ga0207702_10591348 Ga0207702_105913482 194
551 3300026116 Ga0207674_10066546 Ga0207674_100665462 194
552 3300026116 Ga0207674_10080288 Ga0207674_100802885 194
553 3300026142 Ga0207698_10043987 Ga0207698_100439872 194
554 3300026142 Ga0207698_10046647 Ga0207698_100466472 194
555 3300027665 Ga0209983_1011736 Ga0209983_10117362 194
556 3300028379 Ga0268266_10000873 Ga0268266_100008735 194
557 3300028379 Ga0268266_10102704 Ga0268266_101027042 194
558 3300028577 Ga0265318_10005459 Ga0265318_100054596 194
559 3300028800 Ga0265338_10014660 Ga0265338_100146608 194
560 3300031238 Ga0265332_10047612 Ga0265332_100476122 194
561 3300031240 Ga0265320_10016395 Ga0265320_100163952 194
562 3300031241 Ga0265325_10005917 Ga0265325_100059172 194
563 3300031242 Ga0265329_10083730 Ga0265329_100837302 194
564 3300031247 Ga0265340_10111321 Ga0265340_101113212 194
565 3300031249 Ga0265339_10005634 Ga0265339_100056345 194
566 3300031251 Ga0265327_10107706 Ga0265327_101077062 194
567 3300031344 Ga0265316_10144482 Ga0265316_101444823 194
568 3300031595 Ga0265313_10000896 Ga0265313_1000089625 194
569 3300031711 Ga0265314_10014116 Ga0265314_100141166 194
570 3300031712 Ga0265342_10032533 Ga0265342_100325335 194
571 3300031712 Ga0265342_10282471 Ga0265342_102824711 194
572 3300031731 Ga0307405_10152490 Ga0307405_101524902 194
573 3300031995 Ga0307409_100731450 Ga0307409_1007314501 194
574 3300032002 Ga0307416_101431056 Ga0307416_1014310562 194
575 3300032005 Ga0307411_10394761 Ga0307411_103947612 194
576 3300035691 Ga0373931_0042967 Ga0373931_0042967_579_1163 194
577 3300037312 Ga0395899_0017794 Ga0395899_0017794_3693_4277 194
578 3300037312 Ga0395899_0074897 Ga0395899_0074897_1532_2116 194
579 3300037466 Ga0395898_0072863 Ga0395898_0072863_1710_2294 194
580 3300037466 Ga0395898_0114692 Ga0395898_0114692_1979_2563 194
581 3300038443 Ga0395901_0915613 Ga0395901_0915613_193_777 194
582 3300041451 Ga0451791_0549678 Ga0451791_0549678_171_755 194
583 3300046694 Ga0495649_0209311 Ga0495649_0209311_96_680 194
584 3300047472 Ga0495686_0329276 Ga0495686_0329276_10_594 194
585 3300048909 Ga0496106_0958353 Ga0496106_0958353_66_650 194
586 3300048924 Ga0496121_0160863 Ga0496121_0160863_249_833 194
587 3300048928 Ga0496125_0034792 Ga0496125_0034792_269_862 194
588 3300049568 Ga0501031_0079455 Ga0501031_0079455_1115_1699 194
589 3300049569 Ga0501032_0026310 Ga0501032_0026310_3109_3693 194
590 3300049570 Ga0501033_0012859 Ga0501033_0012859_1752_2336 194
591 3300049570 Ga0501033_0079224 Ga0501033_0079224_38_622 194
592 3300049570 Ga0501033_0225025 Ga0501033_0225025_383_967 194
593 3300049571 Ga0501034_0034201 Ga0501034_0034201_2389_2973 194
594 3300049571 Ga0501034_0049207 Ga0501034_0049207_2080_2664 194
595 3300049571 Ga0501034_0084652 Ga0501034_0084652_2094_2678 194
596 3300049571 Ga0501034_0118303 Ga0501034_0118303_1062_1646 194
597 3300049571 Ga0501034_0349752 Ga0501034_0349752_168_752 194
598 3300049571 Ga0501034_0385151 Ga0501034_0385151_150_734 194
599 3300049571 Ga0501034_0585394 Ga0501034_0585394_51_635 194
600 3300049571 Ga0501034_0657200 Ga0501034_0657200_81_665 194
601 3300049571 Ga0501034_0729405 Ga0501034_0729405_204_788 194
602 3300049571 Ga0501034_1067162 Ga0501034_1067162_14_631 194
603 3300049572 Ga0501036_0036952 Ga0501036_0036952_439_1023 194
604 3300049573 Ga0501037_0175377 Ga0501037_0175377_43_627 194
605 3300049574 Ga0501038_0013230 Ga0501038_0013230_1097_1681 194
606 3300049574 Ga0501038_0687432 Ga0501038_0687432_20_604 194
607 3300049575 Ga0501039_0027081 Ga0501039_0027081_2855_3439 194
608 3300049579 Ga0501043_0105912 Ga0501043_0105912_894_1478 194
609 3300049579 Ga0501043_0255302 Ga0501043_0255302_685_1269 194
610 3300049581 Ga0501047_0474568 Ga0501047_0474568_266_850 194
611 3300049585 Ga0501069_0205270 Ga0501069_0205270_352_936 194
612 3300049586 Ga0501070_0012588 Ga0501070_0012588_5969_6553 194
613 3300049586 Ga0501070_0028405 Ga0501070_0028405_2568_3152 194
614 3300049586 Ga0501070_0096180 Ga0501070_0096180_835_1419 194
615 3300049587 Ga0501071_0189654 Ga0501071_0189654_921_1505 194
616 3300049589 Ga0501073_0141826 Ga0501073_0141826_28_612 194
617 3300049589 Ga0501073_0234761 Ga0501073_0234761_226_810 194
618 3300049590 Ga0501074_0217983 Ga0501074_0217983_310_894 194
619 3300049649 Ga0501198_025959 Ga0501198_025959_141_725 194
620 3300049822 Ga0501035_0009054 Ga0501035_0009054_6694_7278 194
621 3300049822 Ga0501035_0058181 Ga0501035_0058181_2105_2689 194
622 3300049823 Ga0501044_0221273 Ga0501044_0221273_896_1480 194
623 3300049823 Ga0501044_0664518 Ga0501044_0664518_41_625 194
624 3300049823 Ga0501044_0875916 Ga0501044_0875916_122_706 194
625 3300050489 nmdc:mga03683_271049_c1 nmdc:mga03683_271049_c1_121_711 194
626 3300050491 nmdc:mga00v17_401458_c1 nmdc:mga00v17_401458_c1_280_870 194
627 3300053136 Ga0500559_0414913 Ga0500559_0414913_20_604 194
628 3300053153 Ga0500616_0007858 Ga0500616_0007858_4284_4901 194
629 3300053161 Ga0500634_0000019 Ga0500634_0000019_38244_38843 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

60

184

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4paw-assembly1.cif.gz_A structure of hypothetical protein hp1257. 0.9162 5 188
4ohc-assembly1.cif.gz_D crystal structure of orotate phosphoribosyltransferase (oprtase) from burkholderia cenocepacia 0.8727 3 165
2wns-assembly1.cif.gz_A human orotate phosphoribosyltransferase (oprtase) domain of uridine 5' -monophosphate synthase (umps) in complex with its substrate orotidine 5'-monophosphate (omp) 0.8697 5 165
4rv4-assembly1.cif.gz_B 2.65 angstrom resolution crystal structure of an orotate phosphoribosyltransferase from bacillus anthracis str. 'ames ancestor' in complex with 5-phospho-alpha-d-ribosyl diphosphate (prpp) 0.8688 3 166
4paw-assembly1.cif.gz_A structure of hypothetical protein hp1257. 0.8669 5 188
ID Description Score Start End Superfamily
4pawB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8772 5 188 3.40.50.2020
4rv4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8688 3 166 3.40.50.2020
af_Q59040_42_210_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8683 32 165 3.40.50.2020
4ohcC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8658 3 165 3.40.50.2020
af_Q4DBC5_255_457_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8558 5 165 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A519KXT8-F1-model_v4 Orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9868 1 189 GO:0004588
GO:0019856
GO:0044205
AF-A0A519KXT8-F1-model_v4 Orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9817 1 189 GO:0004588
GO:0019856
GO:0044205
AF-X5MF68-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9789 1 194 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A524GK96-F1-model_v4 Orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9784 10 145 GO:0004588
GO:0019856
GO:0044205
AF-A0A3M1PVY3-F1-model_v4 Orotate phosphoribosyltransferase (EC 2.4.2.10) 0.978 1 122 GO:0004588
GO:0019856
GO:0044205

Feature Viewer

pLDDT pTM Quality
93.95 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map