F470618

General Info

Members Datasets Scaffolds Average Seq Length
628 358 1256 259

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10106023|Ga0070658_101060232
Length 287
Sequence MSTYQAATLGPAAAGPPGVRRTPHSLGRAVSDSMTMLRRQLKHMLRYPSMTVLLVGTPVVLLLLFVYVFGGTLGAGLPVSVAGSGRAAYLEYVTPGILLLTMAATAQGTAISVAMDMTEGIIARFRTMPIARASVLTGHVLGSVIQAALAVVFVLAVELALGFRPDASAVEWLAVAGFAVLVAFALAWLCVALGLASKSVETASNTPMFLLLLPFLGSGFVPTDSMPAGLRWFAEHQPFTPMTETLRGLLSGTPIGTDGIVAVAWCVVIALGSYLWARRQLARRPVR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
76 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
135 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
136 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
137 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
142 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
143 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
144 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
162 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
163 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
164 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
195 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
198 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
199 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
200 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
201 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
202 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
203 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
204 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
205 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
206 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
207 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
227 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
294 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
295 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
296 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
297 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
308 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
315 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
318 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
324 2558860280 Kutzneria sp. 744 Isolate Unclassified
325 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
326 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
327 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
328 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
329 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
330 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
331 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
332 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
333 2855683550 Micromonospora sp. RP3T Isolate Unclassified
334 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
335 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
336 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
337 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
338 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
339 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
340 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
341 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
342 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
343 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
344 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
345 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
346 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
347 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
348 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
349 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
350 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
351 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
352 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
353 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
354 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
355 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
356 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
357 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
358 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.27
Metatranscriptomes 0.16
Isolates 5.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0.48
Rhizoplane 5.25
Rhizosphere 87.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10106023 3300005327 Bacteria 2325
2 JGI25406J46586_10021198 3300003203 Bacteria 2612
3 JGI25407J50210_10035806 3300003373 Bacteria 1278
4 JGI25407J50210_10036979 3300003373 Bacteria 1256
5 JGI25404J52841_10030145 3300003659 Bacteria 1162
6 Ga0070658_10660808 3300005327 Bacteria 907
7 Ga0070676_10012633 3300005328 Bacteria 4616
8 Ga0068869_100049794 3300005334 Bacteria 3034
9 Ga0068869_100413948 3300005334 Bacteria 1111
10 Ga0070680_100180214 3300005336 Bacteria 1779
11 Ga0070682_100013892 3300005337 Bacteria 4643
12 Ga0070682_100312934 3300005337 Bacteria 1157
13 Ga0068868_100016840 3300005338 Bacteria 5437
14 Ga0070691_10094844 3300005341 Bacteria 1475
15 Ga0070661_100092040 3300005344 Bacteria 2246
16 Ga0070692_10037906 3300005345 Bacteria 2453
17 Ga0070668_100026406 3300005347 Bacteria 4407
18 Ga0070668_100134712 3300005347 Bacteria 1985
19 Ga0070675_100077956 3300005354 Bacteria 2759
20 Ga0070675_100122017 3300005354 Bacteria 2214
21 Ga0070675_100446393 3300005354 Bacteria 1160
22 Ga0070671_100027313 3300005355 Bacteria 4696
23 Ga0070671_100212701 3300005355 Bacteria 1640
24 Ga0070673_100003337 3300005364 Bacteria 9974
25 Ga0070659_100176778 3300005366 Bacteria 1750
26 Ga0070709_10033851 3300005434 Bacteria 3093
27 Ga0070713_100002460 3300005436 Bacteria 12092
28 Ga0070713_100041088 3300005436 Bacteria 3765
29 Ga0070701_10007430 3300005438 Bacteria 4682
30 Ga0070711_100018394 3300005439 Bacteria 4461
31 Ga0070705_100126724 3300005440 Bacteria 1659
32 Ga0070700_100057167 3300005441 Bacteria 2447
33 Ga0070663_100519817 3300005455 Bacteria 991
34 Ga0070678_100008212 3300005456 Bacteria 6240
35 Ga0070662_100282369 3300005457 Bacteria 1344
36 Ga0070681_10037080 3300005458 Bacteria 4893
37 Ga0070681_10457984 3300005458 Bacteria 1188
38 Ga0068867_100118564 3300005459 Bacteria 2042
39 Ga0070699_100000039 3300005518 Bacteria 130633
40 Ga0070679_100221643 3300005530 Bacteria 1852
41 Ga0070684_100154889 3300005535 Bacteria 2078
42 Ga0070684_100585758 3300005535 Bacteria 1037
43 Ga0068853_100159999 3300005539 Bacteria 2031
44 Ga0070693_100000714 3300005547 Bacteria 14647
45 Ga0070693_100301946 3300005547 Bacteria 1079
46 Ga0070704_100416483 3300005549 Bacteria 1150
47 Ga0068855_100074958 3300005563 Bacteria 3929
48 Ga0068857_100186972 3300005577 Bacteria 1886
49 Ga0068854_100016235 3300005578 Bacteria 4958
50 Ga0068856_100009770 3300005614 Bacteria 9323
51 Ga0068856_100076280 3300005614 Bacteria 3321
52 Ga0068856_100151854 3300005614 Bacteria 2325
53 Ga0068856_100188388 3300005614 Bacteria 2077
54 Ga0070702_100004651 3300005615 Bacteria 6292
55 Ga0070702_100139582 3300005615 Bacteria 1542
56 Ga0070702_100196729 3300005615 Bacteria 1331
57 Ga0068864_100033695 3300005618 Bacteria 4355
58 Ga0068861_100079130 3300005719 Bacteria 2569
59 Ga0068851_10006083 3300005834 Bacteria 5505
60 Ga0068870_10001011 3300005840 Bacteria 11122
61 Ga0068863_100365431 3300005841 Bacteria 1407
62 Ga0068858_100008785 3300005842 Bacteria 9691
63 Ga0068860_100033403 3300005843 Bacteria 4937
64 Ga0068860_100424927 3300005843 Bacteria 1318
65 Ga0081455_10002899 3300005937 Bacteria 20137
66 Ga0081455_10003480 3300005937 Bacteria 18085
67 Ga0081455_10003724 3300005937 Bacteria 17429
68 Ga0081455_10166609 3300005937 Bacteria 1683
69 Ga0081455_10168437 3300005937 Bacteria 1671
70 Ga0081538_10001928 3300005981 Bacteria 20795
71 Ga0081538_10002108 3300005981 Bacteria 19815
72 Ga0081538_10004304 3300005981 Bacteria 13162
73 Ga0081538_10004886 3300005981 Bacteria 12202
74 Ga0081538_10006180 3300005981 Bacteria 10619
75 Ga0081538_10007444 3300005981 Bacteria 9473
76 Ga0081538_10019447 3300005981 Bacteria 5047
77 Ga0081538_10026013 3300005981 Bacteria 4107
78 Ga0081538_10036261 3300005981 Bacteria 3221
79 Ga0081538_10048552 3300005981 Bacteria 2587
80 Ga0081538_10135769 3300005981 Bacteria 1146
81 Ga0081540_1000548 3300005983 Bacteria 36395
82 Ga0081540_1001586 3300005983 Bacteria 19433
83 Ga0081540_1018649 3300005983 Bacteria 4248
84 Ga0081539_10000541 3300005985 Bacteria 78036
85 Ga0081539_10000927 3300005985 Bacteria 55152
86 Ga0081539_10011415 3300005985 Bacteria 7021
87 Ga0081539_10055802 3300005985 Bacteria 2195
88 Ga0081539_10068180 3300005985 Bacteria 1921
89 Ga0081539_10144327 3300005985 Bacteria 1153
90 Ga0070717_10024987 3300006028 Bacteria 4745
91 Ga0075365_10272425 3300006038 Bacteria 1191
92 Ga0075364_10005740 3300006051 Bacteria 7236
93 Ga0075364_10201225 3300006051 Bacteria 1350
94 Ga0070712_100094380 3300006175 Bacteria 2198
95 Ga0070712_100291822 3300006175 Bacteria 1317
96 Ga0075427_10006582 3300006194 Bacteria 1688
97 Ga0068871_100049536 3300006358 Bacteria 3396
98 Ga0068871_100088574 3300006358 Bacteria 2575
99 Ga0075428_100019032 3300006844 Bacteria 7594
100 Ga0075428_100084916 3300006844 Bacteria 3453
101 Ga0075428_100094400 3300006844 Bacteria 3262
102 Ga0075428_100147561 3300006844 Bacteria 2556
103 Ga0075428_100353112 3300006844 Bacteria 1578
104 Ga0075430_100009565 3300006846 Bacteria 8190
105 Ga0075430_100101249 3300006846 Bacteria 2406
106 Ga0075430_100203821 3300006846 Bacteria 1642
107 Ga0075431_100002271 3300006847 Bacteria 18423
108 Ga0075431_100074152 3300006847 Bacteria 3511
109 Ga0075431_100090777 3300006847 Bacteria 3153
110 Ga0075431_100348546 3300006847 Bacteria 1489
111 Ga0075431_100685807 3300006847 Bacteria 1003
112 Ga0075433_10019999 3300006852 Bacteria 5592
113 Ga0075433_10020491 3300006852 Bacteria 5530
114 Ga0075433_10031254 3300006852 Bacteria 4551
115 Ga0075433_10100057 3300006852 Bacteria 2566
116 Ga0075433_10206596 3300006852 Bacteria 1746
117 Ga0075434_100010072 3300006871 Bacteria 8851
118 Ga0075434_100039604 3300006871 Bacteria 4670
119 Ga0075434_100053912 3300006871 Bacteria 3995
120 Ga0075429_100006097 3300006880 Bacteria 10422
121 Ga0075429_100034072 3300006880 Bacteria 4424
122 Ga0075429_100120711 3300006880 Bacteria 2291
123 Ga0075429_100361133 3300006880 Bacteria 1272
124 Ga0075436_100050949 3300006914 Bacteria 2857
125 Ga0075436_100080754 3300006914 Bacteria 2253
126 Ga0075435_100060264 3300007076 Bacteria 3077
127 Ga0105251_10075995 3300009011 Bacteria 1559
128 Ga0105240_10273349 3300009093 Bacteria 1944
129 Ga0111539_10007624 3300009094 Bacteria 13829
130 Ga0111539_10026622 3300009094 Bacteria 7069
131 Ga0111539_10078977 3300009094 Bacteria 3870
132 Ga0111539_10174457 3300009094 Bacteria 2511
133 Ga0111539_10907485 3300009094 Bacteria 1025
134 Ga0105245_10165973 3300009098 Bacteria 2099
135 Ga0105245_10340016 3300009098 Bacteria 1484
136 Ga0105245_10750593 3300009098 Bacteria 1012
137 Ga0105245_10825434 3300009098 Bacteria 966
138 Ga0114129_10001880 3300009147 Bacteria 28626
139 Ga0114129_10003605 3300009147 Bacteria 21773
140 Ga0114129_10102105 3300009147 Bacteria 3967
141 Ga0114129_10332491 3300009147 Bacteria 2017
142 Ga0114129_10360514 3300009147 Bacteria 1924
143 Ga0114129_11361393 3300009147 Bacteria 877
144 Ga0105243_10150638 3300009148 Bacteria 1995
145 Ga0105243_10202463 3300009148 Bacteria 1742
146 Ga0105243_10287671 3300009148 Bacteria 1483
147 Ga0105243_10346129 3300009148 Bacteria 1363
148 Ga0105243_10659285 3300009148 Bacteria 1015
149 Ga0105243_10838359 3300009148 Bacteria 909
150 Ga0105241_10081986 3300009174 Bacteria 2528
151 Ga0105248_10043064 3300009177 Bacteria 5063
152 Ga0105237_10073477 3300009545 Bacteria 3412
153 Ga0105238_10024635 3300009551 Bacteria 6133
154 Ga0105238_10048753 3300009551 Bacteria 4267
155 Ga0105032_108099 3300009979 Bacteria 868
156 Ga0105033_103060 3300009986 Bacteria 1398
157 Ga0105239_10026964 3300010375 Bacteria 6324
158 Ga0105246_10001950 3300011119 Bacteria 12430
159 Ga0105246_10009562 3300011119 Bacteria 5973
160 Ga0157371_10024505 3300013102 Bacteria 4405
161 Ga0157369_10200948 3300013105 Bacteria 2092
162 Ga0157374_10177622 3300013296 Bacteria 2078
163 Ga0157378_10244318 3300013297 Bacteria 1716
164 Ga0163162_10110461 3300013306 Bacteria 2846
165 Ga0163162_10631852 3300013306 Bacteria 1195
166 Ga0163162_10818816 3300013306 Bacteria 1048
167 Ga0157375_10482553 3300013308 Bacteria 1404
168 Ga0163163_10057377 3300014325 Bacteria 3850
169 Ga0163163_10355258 3300014325 Bacteria 1522
170 Ga0163163_10503862 3300014325 Bacteria 1272
171 Ga0163163_10983602 3300014325 Bacteria 907
172 Ga0157377_10008272 3300014745 Bacteria 5068
173 Ga0157379_10055917 3300014968 Bacteria 3526
174 Ga0157379_10236470 3300014968 Bacteria 1656
175 Ga0157376_10042972 3300014969 Bacteria 3707
176 Ga0157376_10803632 3300014969 Bacteria 953
177 Ga0163161_10350919 3300017792 Bacteria 1173
178 Ga0206356_10482782 3300020070 Bacteria 1152
179 Ga0207426_1001727 3300025302 Bacteria 16709
180 Ga0207692_10004747 3300025898 Bacteria 5400
181 Ga0207692_10012819 3300025898 Bacteria 3614
182 Ga0207685_10002214 3300025905 Bacteria 4397
183 Ga0207699_10007665 3300025906 Bacteria 5284
184 Ga0207699_10009858 3300025906 Bacteria 4773
185 Ga0207645_10018489 3300025907 Bacteria 4584
186 Ga0207643_10000202 3300025908 Bacteria 41336
187 Ga0207705_10013188 3300025909 Bacteria 5965
188 Ga0207654_10004018 3300025911 Bacteria 7402
189 Ga0207671_10109704 3300025914 Bacteria 2098
190 Ga0207693_10065501 3300025915 Bacteria 2845
191 Ga0207663_10026770 3300025916 Bacteria 3351
192 Ga0207663_10058907 3300025916 Bacteria 2427
193 Ga0207657_10026054 3300025919 Bacteria 5380
194 Ga0207649_10004307 3300025920 Bacteria 7736
195 Ga0207694_10038096 3300025924 Bacteria 3696
196 Ga0207694_10144892 3300025924 Bacteria 1912
197 Ga0207659_10017332 3300025926 Bacteria 4704
198 Ga0207687_10003752 3300025927 Bacteria 10210
199 Ga0207687_10521149 3300025927 Bacteria 994
200 Ga0207700_10003780 3300025928 Bacteria 8842
201 Ga0207700_10008044 3300025928 Bacteria 6501
202 Ga0207664_10038490 3300025929 Bacteria 3709
203 Ga0207690_10082315 3300025932 Bacteria 2251
204 Ga0207706_10270737 3300025933 Bacteria 1482
205 Ga0207686_10323369 3300025934 Bacteria 1153
206 Ga0207665_10030365 3300025939 Bacteria 3570
207 Ga0207711_10280143 3300025941 Bacteria 1535
208 Ga0207689_10002009 3300025942 Bacteria 19209
209 Ga0207689_10037501 3300025942 Bacteria 4020
210 Ga0207689_10231092 3300025942 Bacteria 1528
211 Ga0207689_10338342 3300025942 Bacteria 1250
212 Ga0207661_10390500 3300025944 Bacteria 1261
213 Ga0207679_10002897 3300025945 Bacteria 10644
214 Ga0207712_10178652 3300025961 Bacteria 1665
215 Ga0207668_10017345 3300025972 Bacteria 4510
216 Ga0207658_10033941 3300025986 Bacteria 3643
217 Ga0207677_10064372 3300026023 Bacteria 2553
218 Ga0207703_10748174 3300026035 Bacteria 931
219 Ga0207639_10068221 3300026041 Bacteria 2770
220 Ga0207678_10000917 3300026067 Bacteria 26978
221 Ga0207678_10705324 3300026067 Bacteria 888
222 Ga0207708_10019254 3300026075 Bacteria 5142
223 Ga0207702_10005468 3300026078 Bacteria 11111
224 Ga0207702_10028594 3300026078 Bacteria 4634
225 Ga0207702_10144784 3300026078 Bacteria 2155
226 Ga0207641_10006117 3300026088 Bacteria 10187
227 Ga0207641_10160162 3300026088 Bacteria 2046
228 Ga0207641_10235356 3300026088 Bacteria 1704
229 Ga0207676_10002453 3300026095 Bacteria 13224
230 Ga0207674_10195382 3300026116 Bacteria 1973
231 Ga0207675_100010982 3300026118 Bacteria 8485
232 Ga0207675_100016787 3300026118 Bacteria 6838
233 Ga0207683_10001184 3300026121 Bacteria 23625
234 Ga0207428_10012760 3300027907 Bacteria 7369
235 Ga0207428_10020036 3300027907 Bacteria 5692
236 Ga0207428_10487903 3300027907 Bacteria 896
237 Ga0268266_10047254 3300028379 Bacteria 3687
238 Ga0268264_10065373 3300028381 Bacteria 3064
239 Ga0268264_10289934 3300028381 Bacteria 1537
240 Ga0265337_1026872 3300028556 Bacteria 1739
241 Ga0265326_10000036 3300028558 Bacteria 89310
242 Ga0265334_10000070 3300028573 Bacteria 74174
243 Ga0265336_10008245 3300028666 Bacteria 3666
244 Ga0307515_10009505 3300028794 Bacteria 18789
245 Ga0265338_10000673 3300028800 Bacteria 59128
246 Ga0265324_10001022 3300029957 Bacteria 17211
247 Ga0307511_10000746 3300030521 Bacteria 34750
248 Ga0316177_1103646 3300030731 Bacteria 2967
249 Ga0316176_1185723 3300030732 Bacteria 5414
250 Ga0314311_1086776 3300030733 Bacteria 8349
251 Ga0265320_10013927 3300031240 Bacteria 4608
252 Ga0307513_10001290 3300031456 Bacteria 36243
253 Ga0307513_10012024 3300031456 Bacteria 10711
254 Ga0307513_10100395 3300031456 Bacteria 2920
255 Ga0307513_10199905 3300031456 Bacteria 1841
256 Ga0307509_10003396 3300031507 Bacteria 24254
257 Ga0307408_100016485 3300031548 Bacteria 4933
258 Ga0307408_100207243 3300031548 Bacteria 1591
259 Ga0307516_10020904 3300031730 Bacteria 6755
260 Ga0307405_10007881 3300031731 Bacteria 5364
261 Ga0307405_10011981 3300031731 Bacteria 4568
262 Ga0307405_10017274 3300031731 Bacteria 3955
263 Ga0307405_10050997 3300031731 Bacteria 2566
264 Ga0307405_10252551 3300031731 Bacteria 1313
265 Ga0307405_10658180 3300031731 Bacteria 862
266 Ga0307413_10024128 3300031824 Bacteria 3310
267 Ga0307413_10100382 3300031824 Bacteria 1911
268 Ga0307413_10254766 3300031824 Bacteria 1304
269 Ga0307410_10010650 3300031852 Bacteria 5221
270 Ga0307410_10149164 3300031852 Bacteria 1739
271 Ga0307410_10242888 3300031852 Bacteria 1396
272 Ga0307406_10055992 3300031901 Bacteria 2523
273 Ga0307406_10058109 3300031901 Bacteria 2484
274 Ga0307406_10101671 3300031901 Bacteria 1959
275 Ga0307406_10136941 3300031901 Bacteria 1727
276 Ga0307407_10001013 3300031903 Bacteria 9669
277 Ga0307407_10031649 3300031903 Bacteria 2868
278 Ga0307407_10098101 3300031903 Bacteria 1812
279 Ga0307407_10149243 3300031903 Bacteria 1517
280 Ga0307412_10326860 3300031911 Bacteria 1222
281 Ga0307412_10390666 3300031911 Bacteria 1129
282 Ga0307409_100001210 3300031995 Bacteria 12411
283 Ga0307409_100015452 3300031995 Bacteria 5012
284 Ga0307409_100028602 3300031995 Bacteria 3974
285 Ga0307409_100029902 3300031995 Bacteria 3906
286 Ga0307409_100077996 3300031995 Bacteria 2663
287 Ga0307409_100114325 3300031995 Bacteria 2270
288 Ga0307409_100491881 3300031995 Bacteria 1192
289 Ga0307409_100510531 3300031995 Bacteria 1172
290 Ga0307416_100000365 3300032002 Bacteria 23532
291 Ga0307416_100000435 3300032002 Bacteria 21340
292 Ga0307416_100001619 3300032002 Bacteria 12389
293 Ga0307416_100054836 3300032002 Bacteria 3206
294 Ga0307416_100538206 3300032002 Bacteria 1239
295 Ga0307416_100739319 3300032002 Bacteria 1076
296 Ga0307414_10088690 3300032004 Bacteria 2290
297 Ga0307414_10441284 3300032004 Bacteria 1139
298 Ga0307411_10015431 3300032005 Bacteria 4290
299 Ga0307411_10337040 3300032005 Bacteria 1224
300 Ga0307415_100000127 3300032126 Bacteria 32807
301 Ga0307415_100000414 3300032126 Bacteria 18232
302 Ga0307415_100001181 3300032126 Bacteria 12219
303 Ga0307415_100005505 3300032126 Bacteria 6729
304 Ga0307415_100051266 3300032126 Bacteria 2799
305 Ga0307415_100064764 3300032126 Bacteria 2544
306 Ga0307415_100100660 3300032126 Bacteria 2118
307 Ga0307415_100145265 3300032126 Bacteria 1817
308 Ga0307415_100182901 3300032126 Bacteria 1646
309 Ga0307415_100190642 3300032126 Bacteria 1617
310 Ga0307507_10047765 3300033179 Bacteria 4175
311 Ga0307507_10084530 3300033179 Bacteria 2765
312 Ga0373948_0014124 3300034817 Bacteria 1451
313 Ga0373950_0005656 3300034818 Bacteria 1875
314 Ga0373958_0023175 3300034819 Bacteria 1166
315 Ga0373926_0052050 3300035083 Bacteria 1479
316 Ga0373926_0107357 3300035083 Bacteria 1047
317 Ga0373928_0024016 3300035084 Bacteria 1304
318 Ga0373934_0017344 3300035086 Bacteria 2748
319 Ga0373934_0076278 3300035086 Bacteria 1344
320 Ga0373940_0030518 3300035088 Bacteria 1434
321 Ga0373940_0079452 3300035088 Bacteria 967
322 Ga0373944_0091089 3300035089 Bacteria 1019
323 Ga0373949_0006593 3300035090 Bacteria 2552
324 Ga0373951_0000092 3300035091 Bacteria 34816
325 Ga0373932_0027786 3300035112 Bacteria 1550
326 Ga0373941_0023176 3300035115 Bacteria 1770
327 Ga0373941_0042583 3300035115 Bacteria 1410
328 Ga0373953_0023358 3300035117 Bacteria 2340
329 Ga0373953_0126572 3300035117 Bacteria 1087
330 Ga0373954_0282328 3300035118 Bacteria 818
331 Ga0373956_0015814 3300035119 Bacteria 3164
332 Ga0373957_0030675 3300035120 Bacteria 1971
333 Ga0373943_0069167 3300035170 Bacteria 1784
334 Ga0373955_0034715 3300035172 Bacteria 2666
335 Ga0373955_0109437 3300035172 Bacteria 1596
336 Ga0373942_0061345 3300035207 Bacteria 1078
337 Ga0373961_0021322 3300035241 Bacteria 1722
338 Ga0373924_0015243 3300035410 Bacteria 2919
339 Ga0373924_0034799 3300035410 Bacteria 2041
340 Ga0373931_0009448 3300035691 Bacteria 4664
341 Ga0373931_0150511 3300035691 Bacteria 1356
342 Ga0373927_0213648 3300035695 Bacteria 1267
343 Ga0373933_0012664 3300035724 Bacteria 4661
344 Ga0373933_0106524 3300035724 Bacteria 1744
345 Ga0373947_0049621 3300035725 Bacteria 2521
346 Ga0373937_0003931 3300036401 Bacteria 12571
347 Ga0373937_0528629 3300036401 Bacteria 1120
348 Ga0373925_0033890 3300037068 Bacteria 3763
349 Ga0373925_0509394 3300037068 Bacteria 988
350 Ga0395899_0191472 3300037312 Bacteria 1431
351 Ga0395900_0021168 3300037418 Bacteria 6647
352 Ga0395900_0117008 3300037418 Bacteria 2735
353 Ga0395898_0082135 3300037466 Bacteria 3106
354 Ga0395905_0047015 3300037471 Bacteria 4046
355 Ga0395905_0259022 3300037471 Bacteria 1624
356 Ga0395901_0093279 3300038443 Bacteria 3152
357 Ga0395901_0152069 3300038443 Bacteria 2432
358 Ga0395901_0246638 3300038443 Bacteria 1861
359 Ga0242420_023539 3300038996 Bacteria 1112
360 Ga0439461_0006842 3300041410 Bacteria 1998
361 Ga0439448_0013076 3300042005 Bacteria 2491
362 Ga0439448_0030233 3300042005 Bacteria 1717
363 Ga0439450_003540 3300042008 Bacteria 2591
364 Ga0439450_006391 3300042008 Bacteria 2120
365 Ga0439455_0015876 3300042012 Bacteria 1735
366 Ga0439456_012402 3300042013 Bacteria 1767
367 Ga0439463_001949 3300042016 Bacteria 5367
368 Ga0450913_000193 3300042117 Bacteria 2087
369 Ga0450914_000441 3300042118 Bacteria 1927
370 Ga0439458_0010240 3300042157 Bacteria 2088
371 Ga0439444_0004727 3300042437 Bacteria 1992
372 Ga0439444_0024102 3300042437 Bacteria 1097
373 Ga0439459_0029136 3300042438 Bacteria 1112
374 Ga0439440_0013117 3300042993 Bacteria 1771
375 Ga0439440_0042960 3300042993 Bacteria 1107
376 Ga0466969_0018324 3300044656 Bacteria 3647
377 Ga0466965_0062939 3300044683 Bacteria 1856
378 Ga0466966_0000619 3300044684 Bacteria 22569
379 Ga0466961_0049282 3300044693 Bacteria 2692
380 Ga0466961_0113390 3300044693 Bacteria 1704
381 Ga0466971_0045925 3300044719 Bacteria 1962
382 Ga0466970_0008799 3300044765 Bacteria 5085
383 Ga0466970_0324696 3300044765 Bacteria 870
384 Ga0466957_0388582 3300044842 Bacteria 953
385 Ga0466960_0148025 3300044901 Bacteria 1252
386 Ga0466959_0035949 3300045049 Bacteria 3660
387 Ga0495592_0039615 3300046454 Bacteria 3539
388 Ga0495592_0167686 3300046454 Bacteria 1506
389 Ga0495629_0019694 3300046459 Bacteria 4817
390 Ga0495629_0055018 3300046459 Bacteria 2783
391 Ga0495641_0173709 3300046461 Bacteria 964
392 Ga0495651_0014257 3300046462 Bacteria 6144
393 Ga0495651_0061775 3300046462 Bacteria 2867
394 Ga0495653_0200691 3300046463 Bacteria 1354
395 Ga0495653_0292197 3300046463 Bacteria 1065
396 Ga0495580_0137130 3300046472 Bacteria 1696
397 Ga0495582_0000383 3300046473 Bacteria 24069
398 Ga0495639_0005200 3300046475 Bacteria 5591
399 Ga0495585_0132461 3300046492 Bacteria 1311
400 Ga0495594_0154119 3300046499 Bacteria 1305
401 Ga0495596_0041646 3300046500 Bacteria 1811
402 Ga0495583_0070974 3300046506 Bacteria 1531
403 Ga0495608_0024494 3300046511 Bacteria 4125
404 Ga0495608_0077270 3300046511 Bacteria 2167
405 Ga0495608_0178255 3300046511 Bacteria 1345
406 Ga0495618_0074788 3300046514 Bacteria 2157
407 Ga0495628_0020421 3300046516 Bacteria 5462
408 Ga0495628_0431724 3300046516 Bacteria 959
409 Ga0495630_0106015 3300046517 Bacteria 2128
410 Ga0495630_0157334 3300046517 Bacteria 1729
411 Ga0495663_0033425 3300046525 Bacteria 1536
412 Ga0495652_0013845 3300046529 Bacteria 7255
413 Ga0495652_0151471 3300046529 Bacteria 1811
414 Ga0495665_0015142 3300046531 Bacteria 4156
415 Ga0495665_0101691 3300046531 Bacteria 1508
416 Ga0495598_0065859 3300046537 Bacteria 1129
417 Ga0495645_0122280 3300046543 Bacteria 1831
418 Ga0495645_0136867 3300046543 Bacteria 1712
419 Ga0495667_0014558 3300046559 Bacteria 5313
420 Ga0495667_0072569 3300046559 Bacteria 2243
421 Ga0495656_0007538 3300046615 Bacteria 3849
422 Ga0495668_0225715 3300046616 Bacteria 1026
423 Ga0495634_0023107 3300046642 Bacteria 4374
424 Ga0495635_0019733 3300046663 Bacteria 4695
425 Ga0495635_0171705 3300046663 Bacteria 1474
426 Ga0495661_0103335 3300046665 Bacteria 1600
427 Ga0495588_0243331 3300046674 Bacteria 949
428 Ga0495657_0012829 3300046675 Bacteria 6211
429 Ga0495657_0044142 3300046675 Bacteria 3034
430 Ga0495623_0003633 3300046679 Bacteria 10192
431 Ga0495646_0010086 3300046680 Bacteria 6007
432 Ga0495647_0127323 3300046681 Bacteria 1076
433 Ga0495658_0007256 3300046683 Bacteria 5477
434 Ga0495658_0054917 3300046683 Bacteria 2267
435 Ga0495613_0003199 3300046689 Bacteria 12256
436 Ga0495613_0179513 3300046689 Bacteria 1499
437 Ga0495600_0010299 3300046809 Bacteria 5800
438 Ga0495600_0034449 3300046809 Bacteria 3287
439 Ga0495581_0042477 3300047315 Bacteria 2631
440 Ga0495604_0040992 3300047317 Bacteria 3633
441 Ga0495674_0230739 3300047319 Bacteria 1527
442 Ga0495672_0001242 3300047320 Bacteria 25601
443 Ga0495672_0011138 3300047320 Bacteria 6362
444 Ga0495680_0005305 3300047322 Bacteria 12167
445 Ga0495680_0149275 3300047322 Bacteria 1705
446 Ga0495675_0001142 3300047444 Bacteria 16138
447 Ga0495684_0033820 3300047471 Bacteria 3922
448 Ga0495684_0173744 3300047471 Bacteria 1600
449 Ga0495602_0029842 3300048088 Bacteria 5183
450 Ga0496100_0292864 3300048903 Bacteria 1216
451 Ga0496101_0240947 3300048904 Bacteria 1407
452 Ga0496102_0007153 3300048905 Bacteria 9526
453 Ga0496102_0236742 3300048905 Bacteria 1721
454 Ga0496103_0075869 3300048906 Bacteria 2109
455 Ga0496103_0088172 3300048906 Bacteria 1956
456 Ga0496103_0281391 3300048906 Bacteria 1070
457 Ga0496104_0012578 3300048907 Bacteria 7615
458 Ga0496104_0019909 3300048907 Bacteria 6145
459 Ga0496105_0008162 3300048908 Bacteria 8138
460 Ga0496105_0047109 3300048908 Bacteria 3557
461 Ga0496106_0054386 3300048909 Bacteria 3024
462 Ga0496106_0636821 3300048909 Bacteria 852
463 Ga0496107_0005969 3300048910 Bacteria 8345
464 Ga0496108_0008081 3300048911 Bacteria 8534
465 Ga0496108_0044092 3300048911 Bacteria 3724
466 Ga0496109_0335584 3300048912 Bacteria 1427
467 Ga0496109_0989394 3300048912 Bacteria 779
468 Ga0496110_0003175 3300048913 Bacteria 12506
469 Ga0496110_0933116 3300048913 Bacteria 774
470 Ga0496111_0024267 3300048914 Bacteria 4267
471 Ga0496111_0037905 3300048914 Bacteria 3451
472 Ga0496111_0427771 3300048914 Bacteria 978
473 Ga0496112_0069665 3300048915 Bacteria 3474
474 Ga0496112_0222637 3300048915 Bacteria 1842
475 Ga0496112_0361364 3300048915 Bacteria 1394
476 Ga0496113_0021620 3300048916 Bacteria 4540
477 Ga0496113_0117519 3300048916 Bacteria 2076
478 Ga0496113_0583094 3300048916 Bacteria 896
479 Ga0496114_0174344 3300048917 Bacteria 1876
480 Ga0496114_0813413 3300048917 Bacteria 813
481 Ga0496115_0046639 3300048918 Bacteria 3464
482 Ga0496115_0264552 3300048918 Bacteria 1414
483 Ga0496126_0070454 3300048929 Bacteria 3115
484 Ga0501031_0000484 3300049568 Bacteria 23199
485 Ga0501031_0007598 3300049568 Bacteria 7058
486 Ga0501033_0016924 3300049570 Bacteria 5511
487 Ga0501034_0582243 3300049571 Bacteria 1026
488 Ga0501036_0001155 3300049572 Bacteria 20077
489 Ga0501036_0258391 3300049572 Bacteria 1459
490 Ga0501036_0374202 3300049572 Bacteria 1189
491 Ga0501037_0039115 3300049573 Bacteria 3493
492 Ga0501038_0000887 3300049574 Bacteria 26527
493 Ga0501038_0001209 3300049574 Bacteria 23407
494 Ga0501038_0038659 3300049574 Bacteria 4177
495 Ga0501038_0167847 3300049574 Bacteria 1779
496 Ga0501039_0001963 3300049575 Bacteria 15260
497 Ga0501039_0028768 3300049575 Bacteria 4279
498 Ga0501040_0001667 3300049576 Bacteria 14201
499 Ga0501040_0009377 3300049576 Bacteria 6377
500 Ga0501040_0027283 3300049576 Bacteria 3844
501 Ga0501041_0000141 3300049577 Bacteria 31658
502 Ga0501041_0067626 3300049577 Bacteria 2190
503 Ga0501042_0000142 3300049578 Bacteria 31649
504 Ga0501042_0027594 3300049578 Bacteria 3993
505 Ga0501042_0059270 3300049578 Bacteria 2733
506 Ga0501043_0017644 3300049579 Bacteria 5597
507 Ga0501043_0022543 3300049579 Bacteria 4938
508 Ga0501043_0054767 3300049579 Bacteria 3133
509 Ga0501046_0002636 3300049580 Bacteria 16756
510 Ga0501046_0477611 3300049580 Bacteria 894
511 Ga0501047_0036914 3300049581 Bacteria 4723
512 Ga0501047_0168057 3300049581 Bacteria 2063
513 Ga0501048_0001940 3300049582 Bacteria 15697
514 Ga0501048_0042081 3300049582 Bacteria 3272
515 Ga0501069_0292048 3300049585 Bacteria 955
516 Ga0501071_0000896 3300049587 Bacteria 16099
517 Ga0501071_0002892 3300049587 Bacteria 10593
518 Ga0501071_0034872 3300049587 Bacteria 3582
519 Ga0501071_0594447 3300049587 Bacteria 851
520 Ga0501072_0000516 3300049588 Bacteria 27751
521 Ga0501072_0040562 3300049588 Bacteria 3655
522 Ga0501073_0281537 3300049589 Bacteria 1147
523 Ga0501074_0011375 3300049590 Bacteria 6469
524 Ga0501074_0236423 3300049590 Bacteria 1300
525 Ga0501074_0375714 3300049590 Bacteria 1008
526 Ga0501075_0000167 3300049591 Bacteria 34091
527 Ga0501075_0027342 3300049591 Bacteria 4204
528 Ga0501075_0256264 3300049591 Bacteria 1333
529 Ga0501076_0003308 3300049592 Bacteria 11296
530 Ga0501076_0121321 3300049592 Bacteria 2116
531 Ga0501076_0146918 3300049592 Bacteria 1917
532 Ga0501077_0000444 3300049593 Bacteria 25064
533 Ga0501079_0000632 3300049741 Bacteria 23406
534 Ga0501079_0053201 3300049741 Bacteria 3124
535 Ga0501080_0016069 3300049742 Bacteria 6908
536 Ga0501080_0083564 3300049742 Bacteria 2966
537 Ga0501081_0027742 3300049743 Bacteria 3817
538 Ga0501083_0106866 3300049744 Bacteria 1842
539 Ga0501083_0371430 3300049744 Bacteria 930
540 Ga0501035_0007426 3300049822 Bacteria 10236
541 Ga0501035_0303061 3300049822 Bacteria 1346
542 Ga0501044_0280748 3300049823 Bacteria 1599
543 Ga0501045_0002925 3300049824 Bacteria 11681
544 Ga0501045_0019731 3300049824 Bacteria 4809
545 Ga0501045_0081833 3300049824 Bacteria 2381
546 nmdc:mga00v17_157755_c1 3300050491 Bacteria 1459
547 nmdc:mga00v17_2333_c1 3300050491 Bacteria 9721
548 nmdc:mga05p37_10210_c1 3300050507 Bacteria 11150
549 nmdc:mga05p37_14213_c1 3300050507 Bacteria 9558
550 nmdc:mga05p37_17734_c1 3300050507 Bacteria 8591
551 nmdc:mga05p37_19083_c1 3300050507 Bacteria 8293
552 nmdc:mga05p37_314580_c1 3300050507 Bacteria 1855
553 nmdc:mga09592_161460_c1 3300050508 Bacteria 1936
554 nmdc:mga09592_334782_c1 3300050508 Bacteria 1310
555 nmdc:mga09592_356_c1 3300050508 Bacteria 33464
556 nmdc:mga09592_591723_c1 3300050508 Bacteria 951
557 nmdc:mga0qj67_145930_c1 3300050509 Bacteria 1918
558 nmdc:mga0qj67_223908_c1 3300050509 Bacteria 1527
559 nmdc:mga0qj67_2728_c1 3300050509 Bacteria 12660
560 nmdc:mga0qj67_9310_c1 3300050509 Bacteria 7305
561 nmdc:mga06r32_128758_c1 3300050510 Bacteria 2501
562 nmdc:mga06r32_218_c1 3300050510 Bacteria 46450
563 nmdc:mga06r32_419_c1 3300050510 Bacteria 35723
564 nmdc:mga06r32_462714_c1 3300050510 Bacteria 1247
565 nmdc:mga06r32_673214_c1 3300050510 Bacteria 1002
566 nmdc:mga06r32_74165_c1 3300050510 Bacteria 3298
567 nmdc:mga08y16_126626_c1 3300050511 Bacteria 2657
568 nmdc:mga08y16_13810_c1 3300050511 Bacteria 8500
569 nmdc:mga08y16_326085_c1 3300050511 Bacteria 1580
570 nmdc:mga0n895_12079_c1 3300050512 Bacteria 7729
571 nmdc:mga0n895_19258_c1 3300050512 Bacteria 6339
572 nmdc:mga0n895_207200_c1 3300050512 Bacteria 1991
573 nmdc:mga0rr50_8353_c1 3300050513 Bacteria 6443
574 nmdc:mga0a205_16780_c1 3300050515 Bacteria 6857
575 nmdc:mga0a205_19844_c1 3300050515 Bacteria 6342
576 nmdc:mga0a205_3997_c2 3300050515 Bacteria 10012
577 nmdc:mga0a205_58423_c2 3300050515 Bacteria 3183
578 nmdc:mga0a205_74637_c1 3300050515 Bacteria 3277
579 Ga0495601_0007893 3300053077 Bacteria 6269
580 Ga0495601_0062771 3300053077 Bacteria 2360
581 Ga0495612_0041629 3300053078 Bacteria 1874
582 Ga0495619_0094338 3300053085 Bacteria 2029
583 Ga0495619_0333645 3300053085 Bacteria 1050
584 Ga0500644_0032862 3300053088 Bacteria 1661
585 Ga0500559_0024027 3300053136 Bacteria 2590
586 Ga0501084_0000578 3300054114 Bacteria 28035
587 Ga0501084_0014648 3300054114 Bacteria 6500
588 Ga0501084_0260112 3300054114 Bacteria 1465
589 Ga0590071_014413 3300059421 Bacteria 1854
590 Ga0590074_020208 3300059423 Bacteria 1145
591 Ga0501082_0016637 3300060353 Bacteria 6330
592 Ga0501082_0691950 3300060353 Bacteria 892
593 Ga0530510_0000683 3300061734 Bacteria 21897
594 2559428034 2558860280 Bacteria 11429938
595 2566993715 2565956761 Bacteria 6601618
596 2744957305 2744054611 Bacteria 5611514
597 2753267833 2751185782 Bacteria 11227053
598 2772647067 2772190715 Bacteria 6959372
599 2809591136 2808606522 Bacteria 9488490
600 2816503604 2816332139 Bacteria 9138787
601 2855672037 2855670206 Bacteria 7120389
602 2855678158 2855676851 Bacteria 7063653
603 2855685992 2855683550 Bacteria 7134265
604 2857291669 2857288857 Bacteria 7189066
605 2858849662 2858848962 Bacteria 6963058
606 2858889418 2858888857 Bacteria 7060307
607 2858898129 2858895516 Bacteria 7378898
608 2866613280 2866612099 Bacteria 7543886
609 2867308770 2867302475 Bacteria 7087181
610 2867314888 2867312974 Bacteria 7058875
611 2868091288 2868088558 Bacteria 7609351
612 2869049599 2869048445 Bacteria 6875584
613 2869069854 2869068681 Bacteria 7205615
614 2880492495 2880489317 Bacteria 7096270
615 2880499798 2880495981 Bacteria 7340502
616 2887486133 2887478801 Bacteria 8972725
617 2891330454 2891326441 Bacteria 6439512
618 2915771733 2915768154 Bacteria 8424322
619 2917743685 2917736166 Bacteria 9690793
620 2929221700 2929219909 Bacteria 6984360
621 2929228370 2929226422 Bacteria 7248583
622 8001783417 8001781756 Bacteria 9586736
623 8003835888 8003830390 Bacteria 6541657
624 8003871000 8003870546 Bacteria 7396674
625 8047710825 8047710418 Bacteria 11023148
626 8054710430 8054704163 Bacteria 7247792
627 8054728663 8054727385 Bacteria 7558670
628 8056062690 8056060235 Bacteria 7259403
629 Ga0070658_10106023
630 JGI25406J46586_10021198
631 JGI25407J50210_10035806
632 JGI25407J50210_10036979
633 JGI25404J52841_10030145
634 Ga0070658_10660808
635 Ga0070676_10012633
636 Ga0068869_100049794
637 Ga0068869_100413948
638 Ga0070680_100180214
639 Ga0070682_100013892
640 Ga0070682_100312934
641 Ga0068868_100016840
642 Ga0070691_10094844
643 Ga0070661_100092040
644 Ga0070692_10037906
645 Ga0070668_100026406
646 Ga0070668_100134712
647 Ga0070675_100077956
648 Ga0070675_100122017
649 Ga0070675_100446393
650 Ga0070671_100027313
651 Ga0070671_100212701
652 Ga0070673_100003337
653 Ga0070659_100176778
654 Ga0070709_10033851
655 Ga0070713_100002460
656 Ga0070713_100041088
657 Ga0070701_10007430
658 Ga0070711_100018394
659 Ga0070705_100126724
660 Ga0070700_100057167
661 Ga0070663_100519817
662 Ga0070678_100008212
663 Ga0070662_100282369
664 Ga0070681_10037080
665 Ga0070681_10457984
666 Ga0068867_100118564
667 Ga0070699_100000039
668 Ga0070679_100221643
669 Ga0070684_100154889
670 Ga0070684_100585758
671 Ga0068853_100159999
672 Ga0070693_100000714
673 Ga0070693_100301946
674 Ga0070704_100416483
675 Ga0068855_100074958
676 Ga0068857_100186972
677 Ga0068854_100016235
678 Ga0068856_100009770
679 Ga0068856_100076280
680 Ga0068856_100151854
681 Ga0068856_100188388
682 Ga0070702_100004651
683 Ga0070702_100139582
684 Ga0070702_100196729
685 Ga0068864_100033695
686 Ga0068861_100079130
687 Ga0068851_10006083
688 Ga0068870_10001011
689 Ga0068863_100365431
690 Ga0068858_100008785
691 Ga0068860_100033403
692 Ga0068860_100424927
693 Ga0081455_10002899
694 Ga0081455_10003480
695 Ga0081455_10003724
696 Ga0081455_10166609
697 Ga0081455_10168437
698 Ga0081538_10001928
699 Ga0081538_10002108
700 Ga0081538_10004304
701 Ga0081538_10004886
702 Ga0081538_10006180
703 Ga0081538_10007444
704 Ga0081538_10019447
705 Ga0081538_10026013
706 Ga0081538_10036261
707 Ga0081538_10048552
708 Ga0081538_10135769
709 Ga0081540_1000548
710 Ga0081540_1001586
711 Ga0081540_1018649
712 Ga0081539_10000541
713 Ga0081539_10000927
714 Ga0081539_10011415
715 Ga0081539_10055802
716 Ga0081539_10068180
717 Ga0081539_10144327
718 Ga0070717_10024987
719 Ga0075365_10272425
720 Ga0075364_10005740
721 Ga0075364_10201225
722 Ga0070712_100094380
723 Ga0070712_100291822
724 Ga0075427_10006582
725 Ga0068871_100049536
726 Ga0068871_100088574
727 Ga0075428_100019032
728 Ga0075428_100084916
729 Ga0075428_100094400
730 Ga0075428_100147561
731 Ga0075428_100353112
732 Ga0075430_100009565
733 Ga0075430_100101249
734 Ga0075430_100203821
735 Ga0075431_100002271
736 Ga0075431_100074152
737 Ga0075431_100090777
738 Ga0075431_100348546
739 Ga0075431_100685807
740 Ga0075433_10019999
741 Ga0075433_10020491
742 Ga0075433_10031254
743 Ga0075433_10100057
744 Ga0075433_10206596
745 Ga0075434_100010072
746 Ga0075434_100039604
747 Ga0075434_100053912
748 Ga0075429_100006097
749 Ga0075429_100034072
750 Ga0075429_100120711
751 Ga0075429_100361133
752 Ga0075436_100050949
753 Ga0075436_100080754
754 Ga0075435_100060264
755 Ga0105251_10075995
756 Ga0105240_10273349
757 Ga0111539_10007624
758 Ga0111539_10026622
759 Ga0111539_10078977
760 Ga0111539_10174457
761 Ga0111539_10907485
762 Ga0105245_10165973
763 Ga0105245_10340016
764 Ga0105245_10750593
765 Ga0105245_10825434
766 Ga0114129_10001880
767 Ga0114129_10003605
768 Ga0114129_10102105
769 Ga0114129_10332491
770 Ga0114129_10360514
771 Ga0114129_11361393
772 Ga0105243_10150638
773 Ga0105243_10202463
774 Ga0105243_10287671
775 Ga0105243_10346129
776 Ga0105243_10659285
777 Ga0105243_10838359
778 Ga0105241_10081986
779 Ga0105248_10043064
780 Ga0105237_10073477
781 Ga0105238_10024635
782 Ga0105238_10048753
783 Ga0105032_108099
784 Ga0105033_103060
785 Ga0105239_10026964
786 Ga0105246_10001950
787 Ga0105246_10009562
788 Ga0157371_10024505
789 Ga0157369_10200948
790 Ga0157374_10177622
791 Ga0157378_10244318
792 Ga0163162_10110461
793 Ga0163162_10631852
794 Ga0163162_10818816
795 Ga0157375_10482553
796 Ga0163163_10057377
797 Ga0163163_10355258
798 Ga0163163_10503862
799 Ga0163163_10983602
800 Ga0157377_10008272
801 Ga0157379_10055917
802 Ga0157379_10236470
803 Ga0157376_10042972
804 Ga0157376_10803632
805 Ga0163161_10350919
806 Ga0206356_10482782
807 Ga0207426_1001727
808 Ga0207692_10004747
809 Ga0207692_10012819
810 Ga0207685_10002214
811 Ga0207699_10007665
812 Ga0207699_10009858
813 Ga0207645_10018489
814 Ga0207643_10000202
815 Ga0207705_10013188
816 Ga0207654_10004018
817 Ga0207671_10109704
818 Ga0207693_10065501
819 Ga0207663_10026770
820 Ga0207663_10058907
821 Ga0207657_10026054
822 Ga0207649_10004307
823 Ga0207694_10038096
824 Ga0207694_10144892
825 Ga0207659_10017332
826 Ga0207687_10003752
827 Ga0207687_10521149
828 Ga0207700_10003780
829 Ga0207700_10008044
830 Ga0207664_10038490
831 Ga0207690_10082315
832 Ga0207706_10270737
833 Ga0207686_10323369
834 Ga0207665_10030365
835 Ga0207711_10280143
836 Ga0207689_10002009
837 Ga0207689_10037501
838 Ga0207689_10231092
839 Ga0207689_10338342
840 Ga0207661_10390500
841 Ga0207679_10002897
842 Ga0207712_10178652
843 Ga0207668_10017345
844 Ga0207658_10033941
845 Ga0207677_10064372
846 Ga0207703_10748174
847 Ga0207639_10068221
848 Ga0207678_10000917
849 Ga0207678_10705324
850 Ga0207708_10019254
851 Ga0207702_10005468
852 Ga0207702_10028594
853 Ga0207702_10144784
854 Ga0207641_10006117
855 Ga0207641_10160162
856 Ga0207641_10235356
857 Ga0207676_10002453
858 Ga0207674_10195382
859 Ga0207675_100010982
860 Ga0207675_100016787
861 Ga0207683_10001184
862 Ga0207428_10012760
863 Ga0207428_10020036
864 Ga0207428_10487903
865 Ga0268266_10047254
866 Ga0268264_10065373
867 Ga0268264_10289934
868 Ga0265337_1026872
869 Ga0265326_10000036
870 Ga0265334_10000070
871 Ga0265336_10008245
872 Ga0307515_10009505
873 Ga0265338_10000673
874 Ga0265324_10001022
875 Ga0307511_10000746
876 Ga0316177_1103646
877 Ga0316176_1185723
878 Ga0314311_1086776
879 Ga0265320_10013927
880 Ga0307513_10001290
881 Ga0307513_10012024
882 Ga0307513_10100395
883 Ga0307513_10199905
884 Ga0307509_10003396
885 Ga0307408_100016485
886 Ga0307408_100207243
887 Ga0307516_10020904
888 Ga0307405_10007881
889 Ga0307405_10011981
890 Ga0307405_10017274
891 Ga0307405_10050997
892 Ga0307405_10252551
893 Ga0307405_10658180
894 Ga0307413_10024128
895 Ga0307413_10100382
896 Ga0307413_10254766
897 Ga0307410_10010650
898 Ga0307410_10149164
899 Ga0307410_10242888
900 Ga0307406_10055992
901 Ga0307406_10058109
902 Ga0307406_10101671
903 Ga0307406_10136941
904 Ga0307407_10001013
905 Ga0307407_10031649
906 Ga0307407_10098101
907 Ga0307407_10149243
908 Ga0307412_10326860
909 Ga0307412_10390666
910 Ga0307409_100001210
911 Ga0307409_100015452
912 Ga0307409_100028602
913 Ga0307409_100029902
914 Ga0307409_100077996
915 Ga0307409_100114325
916 Ga0307409_100491881
917 Ga0307409_100510531
918 Ga0307416_100000365
919 Ga0307416_100000435
920 Ga0307416_100001619
921 Ga0307416_100054836
922 Ga0307416_100538206
923 Ga0307416_100739319
924 Ga0307414_10088690
925 Ga0307414_10441284
926 Ga0307411_10015431
927 Ga0307411_10337040
928 Ga0307415_100000127
929 Ga0307415_100000414
930 Ga0307415_100001181
931 Ga0307415_100005505
932 Ga0307415_100051266
933 Ga0307415_100064764
934 Ga0307415_100100660
935 Ga0307415_100145265
936 Ga0307415_100182901
937 Ga0307415_100190642
938 Ga0307507_10047765
939 Ga0307507_10084530
940 Ga0373948_0014124
941 Ga0373950_0005656
942 Ga0373958_0023175
943 Ga0373926_0052050
944 Ga0373926_0107357
945 Ga0373928_0024016
946 Ga0373934_0017344
947 Ga0373934_0076278
948 Ga0373940_0030518
949 Ga0373940_0079452
950 Ga0373944_0091089
951 Ga0373949_0006593
952 Ga0373951_0000092
953 Ga0373932_0027786
954 Ga0373941_0023176
955 Ga0373941_0042583
956 Ga0373953_0023358
957 Ga0373953_0126572
958 Ga0373954_0282328
959 Ga0373956_0015814
960 Ga0373957_0030675
961 Ga0373943_0069167
962 Ga0373955_0034715
963 Ga0373955_0109437
964 Ga0373942_0061345
965 Ga0373961_0021322
966 Ga0373924_0015243
967 Ga0373924_0034799
968 Ga0373931_0009448
969 Ga0373931_0150511
970 Ga0373927_0213648
971 Ga0373933_0012664
972 Ga0373933_0106524
973 Ga0373947_0049621
974 Ga0373937_0003931
975 Ga0373937_0528629
976 Ga0373925_0033890
977 Ga0373925_0509394
978 Ga0395899_0191472
979 Ga0395900_0021168
980 Ga0395900_0117008
981 Ga0395898_0082135
982 Ga0395905_0047015
983 Ga0395905_0259022
984 Ga0395901_0093279
985 Ga0395901_0152069
986 Ga0395901_0246638
987 Ga0242420_023539
988 Ga0439461_0006842
989 Ga0439448_0013076
990 Ga0439448_0030233
991 Ga0439450_003540
992 Ga0439450_006391
993 Ga0439455_0015876
994 Ga0439456_012402
995 Ga0439463_001949
996 Ga0450913_000193
997 Ga0450914_000441
998 Ga0439458_0010240
999 Ga0439444_0004727
1000 Ga0439444_0024102
1001 Ga0439459_0029136
1002 Ga0439440_0013117
1003 Ga0439440_0042960
1004 Ga0466969_0018324
1005 Ga0466965_0062939
1006 Ga0466966_0000619
1007 Ga0466961_0049282
1008 Ga0466961_0113390
1009 Ga0466971_0045925
1010 Ga0466970_0008799
1011 Ga0466970_0324696
1012 Ga0466957_0388582
1013 Ga0466960_0148025
1014 Ga0466959_0035949
1015 Ga0495592_0039615
1016 Ga0495592_0167686
1017 Ga0495629_0019694
1018 Ga0495629_0055018
1019 Ga0495641_0173709
1020 Ga0495651_0014257
1021 Ga0495651_0061775
1022 Ga0495653_0200691
1023 Ga0495653_0292197
1024 Ga0495580_0137130
1025 Ga0495582_0000383
1026 Ga0495639_0005200
1027 Ga0495585_0132461
1028 Ga0495594_0154119
1029 Ga0495596_0041646
1030 Ga0495583_0070974
1031 Ga0495608_0024494
1032 Ga0495608_0077270
1033 Ga0495608_0178255
1034 Ga0495618_0074788
1035 Ga0495628_0020421
1036 Ga0495628_0431724
1037 Ga0495630_0106015
1038 Ga0495630_0157334
1039 Ga0495663_0033425
1040 Ga0495652_0013845
1041 Ga0495652_0151471
1042 Ga0495665_0015142
1043 Ga0495665_0101691
1044 Ga0495598_0065859
1045 Ga0495645_0122280
1046 Ga0495645_0136867
1047 Ga0495667_0014558
1048 Ga0495667_0072569
1049 Ga0495656_0007538
1050 Ga0495668_0225715
1051 Ga0495634_0023107
1052 Ga0495635_0019733
1053 Ga0495635_0171705
1054 Ga0495661_0103335
1055 Ga0495588_0243331
1056 Ga0495657_0012829
1057 Ga0495657_0044142
1058 Ga0495623_0003633
1059 Ga0495646_0010086
1060 Ga0495647_0127323
1061 Ga0495658_0007256
1062 Ga0495658_0054917
1063 Ga0495613_0003199
1064 Ga0495613_0179513
1065 Ga0495600_0010299
1066 Ga0495600_0034449
1067 Ga0495581_0042477
1068 Ga0495604_0040992
1069 Ga0495674_0230739
1070 Ga0495672_0001242
1071 Ga0495672_0011138
1072 Ga0495680_0005305
1073 Ga0495680_0149275
1074 Ga0495675_0001142
1075 Ga0495684_0033820
1076 Ga0495684_0173744
1077 Ga0495602_0029842
1078 Ga0496100_0292864
1079 Ga0496101_0240947
1080 Ga0496102_0007153
1081 Ga0496102_0236742
1082 Ga0496103_0075869
1083 Ga0496103_0088172
1084 Ga0496103_0281391
1085 Ga0496104_0012578
1086 Ga0496104_0019909
1087 Ga0496105_0008162
1088 Ga0496105_0047109
1089 Ga0496106_0054386
1090 Ga0496106_0636821
1091 Ga0496107_0005969
1092 Ga0496108_0008081
1093 Ga0496108_0044092
1094 Ga0496109_0335584
1095 Ga0496109_0989394
1096 Ga0496110_0003175
1097 Ga0496110_0933116
1098 Ga0496111_0024267
1099 Ga0496111_0037905
1100 Ga0496111_0427771
1101 Ga0496112_0069665
1102 Ga0496112_0222637
1103 Ga0496112_0361364
1104 Ga0496113_0021620
1105 Ga0496113_0117519
1106 Ga0496113_0583094
1107 Ga0496114_0174344
1108 Ga0496114_0813413
1109 Ga0496115_0046639
1110 Ga0496115_0264552
1111 Ga0496126_0070454
1112 Ga0501031_0000484
1113 Ga0501031_0007598
1114 Ga0501033_0016924
1115 Ga0501034_0582243
1116 Ga0501036_0001155
1117 Ga0501036_0258391
1118 Ga0501036_0374202
1119 Ga0501037_0039115
1120 Ga0501038_0000887
1121 Ga0501038_0001209
1122 Ga0501038_0038659
1123 Ga0501038_0167847
1124 Ga0501039_0001963
1125 Ga0501039_0028768
1126 Ga0501040_0001667
1127 Ga0501040_0009377
1128 Ga0501040_0027283
1129 Ga0501041_0000141
1130 Ga0501041_0067626
1131 Ga0501042_0000142
1132 Ga0501042_0027594
1133 Ga0501042_0059270
1134 Ga0501043_0017644
1135 Ga0501043_0022543
1136 Ga0501043_0054767
1137 Ga0501046_0002636
1138 Ga0501046_0477611
1139 Ga0501047_0036914
1140 Ga0501047_0168057
1141 Ga0501048_0001940
1142 Ga0501048_0042081
1143 Ga0501069_0292048
1144 Ga0501071_0000896
1145 Ga0501071_0002892
1146 Ga0501071_0034872
1147 Ga0501071_0594447
1148 Ga0501072_0000516
1149 Ga0501072_0040562
1150 Ga0501073_0281537
1151 Ga0501074_0011375
1152 Ga0501074_0236423
1153 Ga0501074_0375714
1154 Ga0501075_0000167
1155 Ga0501075_0027342
1156 Ga0501075_0256264
1157 Ga0501076_0003308
1158 Ga0501076_0121321
1159 Ga0501076_0146918
1160 Ga0501077_0000444
1161 Ga0501079_0000632
1162 Ga0501079_0053201
1163 Ga0501080_0016069
1164 Ga0501080_0083564
1165 Ga0501081_0027742
1166 Ga0501083_0106866
1167 Ga0501083_0371430
1168 Ga0501035_0007426
1169 Ga0501035_0303061
1170 Ga0501044_0280748
1171 Ga0501045_0002925
1172 Ga0501045_0019731
1173 Ga0501045_0081833
1174 nmdc:mga00v17_157755_c1
1175 nmdc:mga00v17_2333_c1
1176 nmdc:mga05p37_10210_c1
1177 nmdc:mga05p37_14213_c1
1178 nmdc:mga05p37_17734_c1
1179 nmdc:mga05p37_19083_c1
1180 nmdc:mga05p37_314580_c1
1181 nmdc:mga09592_161460_c1
1182 nmdc:mga09592_334782_c1
1183 nmdc:mga09592_356_c1
1184 nmdc:mga09592_591723_c1
1185 nmdc:mga0qj67_145930_c1
1186 nmdc:mga0qj67_223908_c1
1187 nmdc:mga0qj67_2728_c1
1188 nmdc:mga0qj67_9310_c1
1189 nmdc:mga06r32_128758_c1
1190 nmdc:mga06r32_218_c1
1191 nmdc:mga06r32_419_c1
1192 nmdc:mga06r32_462714_c1
1193 nmdc:mga06r32_673214_c1
1194 nmdc:mga06r32_74165_c1
1195 nmdc:mga08y16_126626_c1
1196 nmdc:mga08y16_13810_c1
1197 nmdc:mga08y16_326085_c1
1198 nmdc:mga0n895_12079_c1
1199 nmdc:mga0n895_19258_c1
1200 nmdc:mga0n895_207200_c1
1201 nmdc:mga0rr50_8353_c1
1202 nmdc:mga0a205_16780_c1
1203 nmdc:mga0a205_19844_c1
1204 nmdc:mga0a205_3997_c2
1205 nmdc:mga0a205_58423_c2
1206 nmdc:mga0a205_74637_c1
1207 Ga0495601_0007893
1208 Ga0495601_0062771
1209 Ga0495612_0041629
1210 Ga0495619_0094338
1211 Ga0495619_0333645
1212 Ga0500644_0032862
1213 Ga0500559_0024027
1214 Ga0501084_0000578
1215 Ga0501084_0014648
1216 Ga0501084_0260112
1217 Ga0590071_014413
1218 Ga0590074_020208
1219 Ga0501082_0016637
1220 Ga0501082_0691950
1221 Ga0530510_0000683
1222 2559428034
1223 2566993715
1224 2744957305
1225 2753267833
1226 2772647067
1227 2809591136
1228 2816503604
1229 2855672037
1230 2855678158
1231 2855685992
1232 2857291669
1233 2858849662
1234 2858889418
1235 2858898129
1236 2866613280
1237 2867308770
1238 2867314888
1239 2868091288
1240 2869049599
1241 2869069854
1242 2880492495
1243 2880499798
1244 2887486133
1245 2891330454
1246 2915771733
1247 2917743685
1248 2929221700
1249 2929228370
1250 8001783417
1251 8003835888
1252 8003871000
1253 8047710825
1254 8054710430
1255 8054728663
1256 8056062690

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

32

250

0.9

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

77

277

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i3a-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 in outward conformation 0.7367 56 244
8i3c-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 with chs 0.7121 30 246
8i38-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 in inward conformation 0.7095 30 244
8wd6-assembly1.cif.gz_B cryo-em structure of the abcg25 0.7054 30 244
7r8c-assembly1.cif.gz_B the structure of human abcg1 0.6971 59 245
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8525 50 237 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.83 50 237 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7913 52 236 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6603 50 237 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6444 50 237 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A358SL93-F1-model_v4 Transport permease protein 0.9881 50 247 GO:0043190
GO:0140359
AF-A0A2W6CIB2-F1-model_v4 Transport permease protein 0.9856 50 248 GO:0043190
GO:0140359
AF-A0A2B6RJH6-F1-model_v4 ABC transporter 0.9818 62 244 GO:0016020
GO:0140359
AF-D6M663-F1-model_v4 ABC transporter, permease 0.9811 132 246 GO:0016020
GO:0140359
AF-A0A519YB33-F1-model_v4 ABC transporter permease 0.9809 75 248 GO:0016020
GO:0140359

Map